HTH CENPB-type domain-containing protein

Overview
NameHTH CENPB-type domain-containing protein
Smed IDSMED30008448
Length (bp)1647
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of HTH CENPB-type domain-containing protein (SMED30008448) t-SNE clustered cells

Violin plots show distribution of expression levels for HTH CENPB-type domain-containing protein (SMED30008448) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of HTH CENPB-type domain-containing protein (SMED30008448) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for HTH CENPB-type domain-containing protein (SMED30008448) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008448

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30008448 dd_Smed_v4_62062_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30008448 dd_Smed_v4_62062_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30008448 dd_Smed_v4_30227_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Human
Match: TIGD1 (tigger transposable element derived 1 [Source:HGNC Symbol;Acc:HGNC:14523])

HSP 1 Score: 88.9669 bits (219), Expect = 9.907e-46
Identity = 41/80 (51.25%), Postives = 56/80 (70.00%), Query Frame = 2
Query:  941 FYEWFNTFFIPEVKVYMEEKGLEFKILLLIDNAPGH--TYLE-HTNVKIVFLPPNTTSLLRPQDQGIIATFKTYYLKQAF 1171
            F  WF  +F P V+ Y  EK + FKILLLIDNAP H    +E +  + ++F+P NTTS+L+P DQG+I+TFK+YYL+  F
Sbjct:  272 FTAWFTEYFKPTVETYCSEKKIPFKILLLIDNAPSHPRALMEIYEEINVIFMPANTTSILQPMDQGVISTFKSYYLRNTF 351          

HSP 2 Score: 56.6102 bits (135), Expect = 9.907e-46
Identity = 32/72 (44.44%), Postives = 45/72 (62.50%), Query Frame = 3
Query:  735 VTRSQKVASGFKASKERITLFC-SNVSRDRMLKPLFINKTFKPRAMKNKNVKTLHVHWMANNKAWVTALVFT 947
            + R +K   GFKASK+R+TL   +N + D  LKP+ I  +  PRA+KN    TL V +  N+KA +TA +FT
Sbjct:  202 IAREEKSVPGFKASKDRLTLLLGANAAGDFKLKPMLIYHSENPRALKNYTKSTLPVLYKWNSKARMTAHLFT 273          

HSP 3 Score: 45.8246 bits (107), Expect = 9.907e-46
Identity = 29/72 (40.28%), Postives = 43/72 (59.72%), Query Frame = 2
Query:  506 AKKTVFSASTGWLRAFLNRNSIHNL*IKCEIGSANDKSA*EFPEKLARIIEEAGCTP*KVCNADETGFFERK 721
            A +  F AS GW   F  R+  HN+  + E  SA+ ++A  +PE LA+II+E G T  ++ N DET F+ +K
Sbjct:  124 AAEEKFEASRGWFMRFKERSHFHNIKAQGEAASADVEAAASYPEALAKIIDEGGYTKQQIFNVDETAFYWKK 195          

HSP 4 Score: 45.0542 bits (105), Expect = 9.907e-46
Identity = 28/109 (25.69%), Postives = 51/109 (46.79%), Query Frame = 3
Query:  153 RKKRKCISLETKIQILDRIENGDSSTNLGKRFDANEAMIRTIKRNDSINLRYVMVGT*LSFKYSYVRCCVMEKTEKALAVWIADNNQKQVPLDGNTIKQKALHIYAGIK 479
            RK R  ++L  K++++   E G S   +G+R       +  +       L+ V   T ++ +    R  ++   EK L VWI D   + +PL  + I+ KAL ++  +K
Sbjct:    9 RKSRTSLTLNQKLEMIKLSEEGMSKAEIGRRLGLLRQTVSQVVNAKEKFLKEVKSATPMNTRMIRKRNSLIADMEKVLVVWIEDQTSRNIPLSQSLIQNKALTLFNSMK 117          

HSP 5 Score: 29.261 bits (64), Expect = 9.907e-46
Identity = 14/40 (35.00%), Postives = 22/40 (55.00%), Query Frame = 1
Query: 1225 WKKFSIMDCVKFVNIAVIHGLKPSTLNACWKAVWPECVKD 1344
            WK F+I+D +K +  +    +K STL   WK + P  + D
Sbjct:  375 WKGFTILDAIKNIRDS-WEEVKLSTLTGVWKKLIPTLIDD 413          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Human
Match: JRKL (JRK like [Source:HGNC Symbol;Acc:HGNC:6200])

HSP 1 Score: 87.4261 bits (215), Expect = 4.200e-24
Identity = 73/234 (31.20%), Postives = 108/234 (46.15%), Query Frame = 2
Query:  521 FSASTGWLRAFLNRNSIHNL*IKCEIGSANDKSA*EFPEKLARIIEEAGCTP*KVCNADETGFFERKCQKERD*ITKSRQWI*---SI*RTYYFILQQRFTGSH-VKTSIY**NV*TTCNEK*KRK-------NLACSLDGQ*QSMGNSISFYEWFNTFFIPEVKVYMEEKGLEFKILLLIDNAPGH---TYLEHTNVKI--VFLPPNTTSLLRPQDQGIIATFKTYYLKQAFQ 1174
            F+ S GWL  F  R+SI  + I+ E  + ++ +  +F       IE     P ++ NADETG F  KC   R  + K +  +    SI      +     TG H +K  +           K  R        NL  S   Q  +  +   F +WF+  F+P+V+ Y+  KGL+ K +LL+DN+P H     L   + +I   +LPPN  SL++P DQG+IAT K  Y     Q
Sbjct:  119 FNPSAGWLTRFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIERENLQPEQIYNADETGLFW-KCLPSRISVIKGKCTVPGHKSIEERVTIMCCANATGLHKLKLCV-------VGKAKKPRSFKSTDTLNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLPPNVASLIQPSDQGVIATMKRNYRAGLLQ 344          

HSP 2 Score: 38.5058 bits (88), Expect = 4.200e-24
Identity = 24/110 (21.82%), Postives = 52/110 (47.27%), Query Frame = 3
Query:  153 RKKRKCISLETKIQILDRIENGDSSTNLGKRFDANEAMIRTIKRNDSINLRYVMV--GT*LSFKYSYVRCCVMEKTEKALAVWIADNNQKQVPLDGNTIKQKALHIYAGI 476
            ++KR  ++++ K+ I+ ++E+G SS  L   +   E  +R I++N    + Y      T L  K   ++  + E+ ++A+  W      K  P+ G    ++A   +  +
Sbjct:    4 KRKRVVLTIKDKLDIIKKLEDGGSSKQLAVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAKRKSMKPSMYEELDRAMLEWFNQQRAKGNPISGPICAKRAEFFFYAL 113          

HSP 3 Score: 26.1794 bits (56), Expect = 4.200e-24
Identity = 11/35 (31.43%), Postives = 22/35 (62.86%), Query Frame = 1
Query: 1225 WKKFSIMDCVKFVNIAVIHGLKPSTLNACWKAVWP 1329
            WKK +++D +  + +A  + +KP T++  WK + P
Sbjct:  357 WKKLTLLDALYEIAMA-WNLVKPVTISRAWKKILP 390          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Human
Match: TIGD2 (tigger transposable element derived 2 [Source:HGNC Symbol;Acc:HGNC:18333])

HSP 1 Score: 66.6254 bits (161), Expect = 6.375e-21
Identity = 31/77 (40.26%), Postives = 49/77 (63.64%), Query Frame = 2
Query:  941 FYEWFNTFFIPEVKVYMEEKGLEFKILLLID---NAPGHTYLEHTNVKIV--FLPPNTTSLLRPQDQGIIATFKTYY 1156
            F +WF  +F+P+V+ +++ KGL  K +LL+D     P    L   + +I+  +LPPN TSL++P  QG++AT K YY
Sbjct:  262 FRQWFEKYFVPQVQKHLKSKGLLEKAVLLLDFPPARPNEEMLSSDDGRIIVKYLPPNVTSLIQPMSQGVLATVKRYY 338          

HSP 2 Score: 40.817 bits (94), Expect = 6.375e-21
Identity = 21/69 (30.43%), Postives = 35/69 (50.72%), Query Frame = 3
Query:  741 RSQKVASGFKASKERITLFC-SNVSRDRMLKPLFINKTFKPRAMKNKNVKTLHVHWMANNKAWVTALVF 944
             + +  SG ++S+ERI + C +N +    L    + K  KPRA K  ++  L V + +   AW+   VF
Sbjct:  194 ETDQSTSGCRSSRERIIIMCCANATGLHKLNLCVVGKAKKPRAFKGTDLSNLPVTYYSQKGAWIEQSVF 262          

HSP 3 Score: 33.8834 bits (76), Expect = 6.375e-21
Identity = 20/64 (31.25%), Postives = 31/64 (48.44%), Query Frame = 2
Query:  521 FSASTGWLRAFLNRNSIHNL*IKCEIGSANDKSA*EFPEKLARIIEEAGCTP*KVCNADETGFF 712
            F+AS+GWL  F  R+ I     K      ++ +A EF       +E+    P ++  AD+TG F
Sbjct:  119 FNASSGWLTRFKQRHGIPKAAGKGTKLKGDETAAREFCGSFQEFVEKENLQPEQIYGADQTGLF 182          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Human
Match: TIGD2 (tigger transposable element derived 2 [Source:HGNC Symbol;Acc:HGNC:18333])

HSP 1 Score: 66.6254 bits (161), Expect = 6.375e-21
Identity = 31/77 (40.26%), Postives = 49/77 (63.64%), Query Frame = 2
Query:  941 FYEWFNTFFIPEVKVYMEEKGLEFKILLLID---NAPGHTYLEHTNVKIV--FLPPNTTSLLRPQDQGIIATFKTYY 1156
            F +WF  +F+P+V+ +++ KGL  K +LL+D     P    L   + +I+  +LPPN TSL++P  QG++AT K YY
Sbjct:  262 FRQWFEKYFVPQVQKHLKSKGLLEKAVLLLDFPPARPNEEMLSSDDGRIIVKYLPPNVTSLIQPMSQGVLATVKRYY 338          

HSP 2 Score: 40.817 bits (94), Expect = 6.375e-21
Identity = 21/69 (30.43%), Postives = 35/69 (50.72%), Query Frame = 3
Query:  741 RSQKVASGFKASKERITLFC-SNVSRDRMLKPLFINKTFKPRAMKNKNVKTLHVHWMANNKAWVTALVF 944
             + +  SG ++S+ERI + C +N +    L    + K  KPRA K  ++  L V + +   AW+   VF
Sbjct:  194 ETDQSTSGCRSSRERIIIMCCANATGLHKLNLCVVGKAKKPRAFKGTDLSNLPVTYYSQKGAWIEQSVF 262          

HSP 3 Score: 33.8834 bits (76), Expect = 6.375e-21
Identity = 20/64 (31.25%), Postives = 31/64 (48.44%), Query Frame = 2
Query:  521 FSASTGWLRAFLNRNSIHNL*IKCEIGSANDKSA*EFPEKLARIIEEAGCTP*KVCNADETGFF 712
            F+AS+GWL  F  R+ I     K      ++ +A EF       +E+    P ++  AD+TG F
Sbjct:  119 FNASSGWLTRFKQRHGIPKAAGKGTKLKGDETAAREFCGSFQEFVEKENLQPEQIYGADQTGLF 182          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Human
Match: TIGD6 (tigger transposable element derived 6 [Source:HGNC Symbol;Acc:HGNC:18332])

HSP 1 Score: 50.447 bits (119), Expect = 2.558e-19
Identity = 29/81 (35.80%), Postives = 41/81 (50.62%), Query Frame = 2
Query:  941 FYEWFNTFFIPEVKVYMEEKGLEFKILLLIDNAPGHTYLEH-TNVKIVFLPPNTTSLLRPQDQGIIATFKTYYLKQAFQYI 1180
            F EW        ++V    K  E +ILLLIDN   H  L H   +++ +LP N T++L+P + GII T K  Y     + I
Sbjct:  261 FNEWL-------MQVDARMKRAERRILLLIDNCSAHNMLPHLERIQVGYLPSNCTAVLQPLNLGIIHTMKVLYQSHLLKQI 334          

HSP 2 Score: 41.2022 bits (95), Expect = 2.558e-19
Identity = 20/61 (32.79%), Postives = 32/61 (52.46%), Query Frame = 3
Query:  762 GFKASKERITLFCSNVSRDRMLKPLFINKTFKPRAMKNKNVKTLHVHWMANNKAWVTALVF 944
            G KA +    LFC N S    ++PL + ++  P  +  KN+ +L   + AN  AW+T  +F
Sbjct:  203 GKKAKQRLTALFCCNASGTEKMRPLIVGRSASPHCL--KNIHSLPCDYRANQWAWMTRDLF 261          

HSP 3 Score: 37.7354 bits (86), Expect = 2.558e-19
Identity = 24/106 (22.64%), Postives = 55/106 (51.89%), Query Frame = 3
Query:  156 KKRKCISLETKIQILDRIENGDSSTNLGKRFDANEAMIRTIKRNDS---INLRYVMVGT*LSFKYSYVRCCVMEKTEKALAVWIADNNQKQVPLDGNTIKQKALHI 464
            KKR+  SLE K++++  +++G    ++ K F    + + T  ++ +     +R   VG     +   +R  + +  +KA+  W  + + K + + G+ I++KAL++
Sbjct:    7 KKRRQFSLEEKMKVVGAVDSGKRKGDVAKEFGITPSTLSTFLKDRTKFEEKVREASVGP----QRKRMRSALYDDIDKAVFAWFQEIHAKNILVTGSVIRKKALNL 108          

HSP 4 Score: 25.7942 bits (55), Expect = 2.558e-19
Identity = 24/71 (33.80%), Postives = 32/71 (45.07%), Query Frame = 2
Query:  521 FSASTGWLRAFLNRNSIHNL*IKCEIGSAN-------DKSA*EFPEKLARIIEEAGCTP*KVCNADETGFF 712
            F AS GWL  F +R+ I  L   C   S         DK       ++ ++I  A  +P  + NADETG F
Sbjct:  117 FQASVGWLNRFRDRHGIA-LKAVCREDSDRLMNGLGIDKINEWHAGEIIKLI--ADYSPDDIFNADETGVF 184          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Xenopus
Match: kif6 (kinesin family member 6 [Source:Xenbase;Acc:XB-GENE-1014042])

HSP 1 Score: 63.929 bits (154), Expect = 5.629e-16
Identity = 31/85 (36.47%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  941 FYEWFNTFFIPEVKVYMEEKGL--EFKILLLIDNAPGHTYLE---HTNVKIVFLPPNTTSLLRPQDQGIIATFKTYYLKQAFQYI 1180
            F +WF   F+PE + +    GL  + K++L++D+ P H   E     NV  V LPP+ TS ++P DQGI+  FK+ Y  +  Q +
Sbjct:  437 FQDWFENHFVPEARAHCMSVGLSQDAKVMLILDHCPTHPSAEFLVKDNVFAVCLPPDCTSFIQPLDQGILRLFKSNYKSEFLQRM 521          

HSP 2 Score: 41.2022 bits (95), Expect = 5.629e-16
Identity = 29/84 (34.52%), Postives = 45/84 (53.57%), Query Frame = 3
Query:  705 VFLKENAKKNVTRSQKV-ASGFKASKERIT-LFCSNVSRDRMLKPLFINKTFKPRAMKNKNVKTLHVHWMANNKAWVTALVFTN 950
            +F +   +K V  +QK  +SG +  KER+T L CSN +     + L I K+  PRA   K V+   V + AN +A +T  +F +
Sbjct:  358 LFWRHLPQKLVATAQKPPSSGLEDPKERLTVLACSNAAGTHKARLLVIGKSRNPRAF--KGVRVFPVTYTANKQAGITREIFQD 439          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000046714.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460367.1:582927:585046:-1 gene:ENSXETG00000018570.1 transcript:ENSXETT00000046714.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 5.187e-10
Identity = 78/271 (28.78%), Postives = 112/271 (41.33%), Query Frame = 3
Query:  162 RKCISLETKIQILDRIENGDSS-TNLGKRFDANEAMIRTI-KRNDSINLRYVMVGT*LSFKYSYVRCCVMEKTEKALAVWIADNNQKQVPLDGNTIKQKALHIYA--GIKQLQPSDSTRPR-----KLFFLQVQGG*EHF*TETRSITYKSNVK*AQLTINLLKNXXXXXXXXXXXXDALHKKFVMQMKLVFLKENAKKNVTRSQKVASGFKASKERIT-LFCSNVSRDRMLKPLFINKTFKPRAMKNKNVKTLHVHWMANNKAWVTALVF 944
            RK +SLE KI ILDR ++   +   L K      + + TI K+  S        G   + K  YV     E+ EK L  W A  +   VP+ G  +++KA+HI    GI     S+    R      + +  V G       E++S+            I+ + N   +      +   L   F      +F      K      +   G K SK R+T LF +N      LKPL I K+ KPR    KNV TL  ++ AN KAW+T  +F
Sbjct:    8 RKSLSLEEKIAILDRADSYHGTRVALAKELGIPVSTLGTIIKQRASTEGSADKCGP-QAKKRKYVTQSKYEQMEKLLQEWFAGLHASNVPISGIMLREKAVHIATRLGIDNFTASNGWIDRFKKRYNVVYKAVCG-------ESKSVD-----------IDTVTNWKTNQLPCYLEGYELKNIFNTDETGLFFNVLPGKTFCFRGEDCHGGKLSKLRLTVLFTTNADGSEKLKPLVIGKSVKPRCF--KNVNTLPTNYTANTKAWMTTKLF 257          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Xenopus
Match: apmapl (adipocyte plasma membrane associated protein LIKE [Source:Xenbase;Acc:XB-GENE-5754317])

HSP 1 Score: 54.299 bits (129), Expect = 9.369e-10
Identity = 27/78 (34.62%), Postives = 44/78 (56.41%), Query Frame = 2
Query:  947 EWFNTFFIPEVKVYMEEKGLEFKILLLIDNAPGHTYLE-----HTNVKIVFLPPNTTSLLRPQDQGIIATFKTYYLKQ 1165
            EWF   F+P VK Y++   L+ K +LL++  PG    E       N++++FL   T S +   DQG+I++FK  Y ++
Sbjct:  231 EWFLEEFVPAVKRYLKRCCLQQKAVLLVNQCPGKPPEEDLQTADGNIRVLFLSKTTRSKIPSMDQGVISSFKQLYRRE 308          

HSP 2 Score: 29.6462 bits (65), Expect = 9.369e-10
Identity = 16/58 (27.59%), Postives = 27/58 (46.55%), Query Frame = 3
Query:  759 SGFKASKERITLFCSNVSRDRMLKPLFINKTFKPRAMKNKNVKTLHVHWMANNKAWVT 932
            SG+    E   L  +N++    LKPL + K   P ++++ N       +  +  AWVT
Sbjct:  170 SGY--GDEVTVLLAANLTGSHKLKPLVVGKLRDPPSLRHHNQDKFPAVYHYSRNAWVT 225          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Mouse
Match: Jrkl (Jrk-like [Source:MGI Symbol;Acc:MGI:1924782])

HSP 1 Score: 81.6481 bits (200), Expect = 7.391e-23
Identity = 66/226 (29.20%), Postives = 107/226 (47.35%), Query Frame = 2
Query:  521 FSASTGWLRAFLNRNSIHNL*IKCEIGSANDKSA*EFPEKLARIIEEAGCTP*KVCNADETGFFERKCQKERD*ITKSRQWI*SI*RTYYFILQQRFT--GSHVKTSIY**NV*TTCNEK*KRK-------NLACSLDGQ*QSMGNSISFYEWFNTFFIPEVKVYMEEKGLEFKILLLIDNAPGH---TYLEHTNVKI--VFLPPNTTSLLRPQDQGIIATFKTYY 1156
            F+ S GWL  F  R+SI  + I+ E  + ++ +  +F       IE+    P ++ NADETG F  KC   R  + K +  +       + + ++R T       T ++   +      +  R        NL  S   Q  +  +   F +WF+  F+P+V+ Y+  KGL+ K +LL+DN+P H     L   + +I   +LPPN  SL++P  QG+IA  K  Y
Sbjct:  119 FNPSAGWLTRFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIEQENLQPEQIYNADETGLF-WKCLPSRTTVIKGKCTV-----PGHNLGEERITVMCCTNATGLHKLKLCVVGKARKPRSFKSTDTLNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLPPNVASLIQPLGQGVIAAMKRNY 338          

HSP 2 Score: 39.2762 bits (90), Expect = 7.391e-23
Identity = 25/110 (22.73%), Postives = 52/110 (47.27%), Query Frame = 3
Query:  153 RKKRKCISLETKIQILDRIENGDSSTNLGKRFDANEAMIRTIKRNDSINLRYVMV--GT*LSFKYSYVRCCVMEKTEKALAVWIADNNQKQVPLDGNTIKQKALHIYAGI 476
            ++KR  ++++ K+ I+ ++E+G SS  L   +   E  +R I++N    + Y      T L  K   ++  + E+ +KA+  W      K  P+ G    ++A   +  +
Sbjct:    4 KRKRVVLTIKDKLDIIKKLEDGGSSKQLAVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAKRKSMKPSMYEELDKAMLEWFNQQRAKGNPISGPICAKRAEFFFYAL 113          

HSP 3 Score: 26.5646 bits (57), Expect = 7.391e-23
Identity = 11/35 (31.43%), Postives = 22/35 (62.86%), Query Frame = 1
Query: 1225 WKKFSIMDCVKFVNIAVIHGLKPSTLNACWKAVWP 1329
            WKK +++D +  + +A  + +KP T++  WK + P
Sbjct:  357 WKKLTLLDALYEIAMA-WNLVKPVTISRAWKQILP 390          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Mouse
Match: Tigd2 (tigger transposable element derived 2 [Source:MGI Symbol;Acc:MGI:1915390])

HSP 1 Score: 62.7734 bits (151), Expect = 1.805e-18
Identity = 29/75 (38.67%), Postives = 46/75 (61.33%), Query Frame = 2
Query:  947 EWFNTFFIPEVKVYMEEKGLEFKILLLID---NAPGHTYLEHTNVKIV--FLPPNTTSLLRPQDQGIIATFKTYY 1156
            +WF   F+P+V+ +++ KGL  K +LL+D     P    L   + +I+  +LPPN TSL++P  QG++ T K YY
Sbjct:  264 QWFEKCFVPQVQKHLKSKGLREKAVLLLDFPAAHPAEELLSSDDGRIIVKYLPPNVTSLIQPMSQGVLTTVKRYY 338          

HSP 2 Score: 36.5798 bits (83), Expect = 1.805e-18
Identity = 17/61 (27.87%), Postives = 30/61 (49.18%), Query Frame = 3
Query:  765 FKASKERITLFC-SNVSRDRMLKPLFINKTFKPRAMKNKNVKTLHVHWMANNKAWVTALVF 944
            ++ S+ERI + C +N +    L    + K  +PRA K  ++  L V + +   AW+   V 
Sbjct:  202 YRTSRERIIIMCCANATGSHKLNLCVVGKAKRPRAFKGTDLSNLPVTYFSQKSAWIEPSVL 262          

HSP 3 Score: 33.113 bits (74), Expect = 1.805e-18
Identity = 20/64 (31.25%), Postives = 30/64 (46.88%), Query Frame = 2
Query:  521 FSASTGWLRAFLNRNSIHNL*IKCEIGSANDKSA*EFPEKLARIIEEAGCTP*KVCNADETGFF 712
            F+AS+GWL  F  R+ I     K      ++ +A EF       +E     P ++  AD+TG F
Sbjct:  119 FNASSGWLTRFKQRHGIPKAAGKGTKLKGDETAASEFCGNFQEFVERENLLPEQIYGADQTGLF 182          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Mouse
Match: Jrk (jerky [Source:MGI Symbol;Acc:MGI:106214])

HSP 1 Score: 52.373 bits (124), Expect = 1.056e-13
Identity = 28/78 (35.90%), Postives = 45/78 (57.69%), Query Frame = 2
Query:  941 FYEWFNTFFIPEVKVYMEEKGL--EFKILLLIDNAPGHTY---LEHTNVKIVFLPPNTTSLLRPQDQGIIATFKTYYL 1159
            F +WF+  F+P V+ +    GL  + K +LL+D++  H+    L   NV  +FLP + TSLL+P +QGI   F   ++
Sbjct:  267 FSDWFHHIFVPSVREHFRTIGLPEDSKAILLLDHSRAHSQESELVSENVFTIFLPSSVTSLLQPTEQGIRRAFMRLFI 344          

HSP 2 Score: 44.2838 bits (103), Expect = 1.056e-13
Identity = 22/63 (34.92%), Postives = 35/63 (55.56%), Query Frame = 3
Query:  765 FKASKERIT-LFCSNVSRDRMLKPLFINKTFKPRAMKNKNVKTLHVHWMANNKAWVTALVFTN 950
            FK  K+R+T L C+N +    +KPL I K   PRA   + ++ L + + A   AWV   +F++
Sbjct:  209 FKQGKDRLTVLMCANATGSHRIKPLAIGKGGGPRAF--RGIQHLPIAYKAQGNAWVDKEIFSD 269          
BLAST of HTH CENPB-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96MW7|TIGD1_HUMAN (Tigger transposable element-derived protein 1 OS=Homo sapiens OX=9606 GN=TIGD1 PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 4.338e-45
Identity = 41/80 (51.25%), Postives = 56/80 (70.00%), Query Frame = 2
Query:  941 FYEWFNTFFIPEVKVYMEEKGLEFKILLLIDNAPGH--TYLE-HTNVKIVFLPPNTTSLLRPQDQGIIATFKTYYLKQAF 1171
            F  WF  +F P V+ Y  EK + FKILLLIDNAP H    +E +  + ++F+P NTTS+L+P DQG+I+TFK+YYL+  F
Sbjct:  272 FTAWFTEYFKPTVETYCSEKKIPFKILLLIDNAPSHPRALMEIYEEINVIFMPANTTSILQPMDQGVISTFKSYYLRNTF 351          

HSP 2 Score: 56.6102 bits (135), Expect = 4.338e-45
Identity = 32/72 (44.44%), Postives = 45/72 (62.50%), Query Frame = 3
Query:  735 VTRSQKVASGFKASKERITLFC-SNVSRDRMLKPLFINKTFKPRAMKNKNVKTLHVHWMANNKAWVTALVFT 947
            + R +K   GFKASK+R+TL   +N + D  LKP+ I  +  PRA+KN    TL V +  N+KA +TA +FT
Sbjct:  202 IAREEKSVPGFKASKDRLTLLLGANAAGDFKLKPMLIYHSENPRALKNYTKSTLPVLYKWNSKARMTAHLFT 273          

HSP 3 Score: 45.8246 bits (107), Expect = 4.338e-45
Identity = 29/72 (40.28%), Postives = 43/72 (59.72%), Query Frame = 2
Query:  506 AKKTVFSASTGWLRAFLNRNSIHNL*IKCEIGSANDKSA*EFPEKLARIIEEAGCTP*KVCNADETGFFERK 721
            A +  F AS GW   F  R+  HN+  + E  SA+ ++A  +PE LA+II+E G T  ++ N DET F+ +K
Sbjct:  124 AAEEKFEASRGWFMRFKERSHFHNIKAQGEAASADVEAAASYPEALAKIIDEGGYTKQQIFNVDETAFYWKK 195          

HSP 4 Score: 45.0542 bits (105), Expect = 4.338e-45
Identity = 28/109 (25.69%), Postives = 51/109 (46.79%), Query Frame = 3
Query:  153 RKKRKCISLETKIQILDRIENGDSSTNLGKRFDANEAMIRTIKRNDSINLRYVMVGT*LSFKYSYVRCCVMEKTEKALAVWIADNNQKQVPLDGNTIKQKALHIYAGIK 479
            RK R  ++L  K++++   E G S   +G+R       +  +       L+ V   T ++ +    R  ++   EK L VWI D   + +PL  + I+ KAL ++  +K
Sbjct:    9 RKSRTSLTLNQKLEMIKLSEEGMSKAEIGRRLGLLRQTVSQVVNAKEKFLKEVKSATPMNTRMIRKRNSLIADMEKVLVVWIEDQTSRNIPLSQSLIQNKALTLFNSMK 117          

HSP 5 Score: 29.261 bits (64), Expect = 4.338e-45
Identity = 14/40 (35.00%), Postives = 22/40 (55.00%), Query Frame = 1
Query: 1225 WKKFSIMDCVKFVNIAVIHGLKPSTLNACWKAVWPECVKD 1344
            WK F+I+D +K +  +    +K STL   WK + P  + D
Sbjct:  375 WKGFTILDAIKNIRDS-WEEVKLSTLTGVWKKLIPTLIDD 413          
BLAST of HTH CENPB-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y4A0|JERKL_HUMAN (Jerky protein homolog-like OS=Homo sapiens OX=9606 GN=JRKL PE=2 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 1.838e-23
Identity = 73/234 (31.20%), Postives = 108/234 (46.15%), Query Frame = 2
Query:  521 FSASTGWLRAFLNRNSIHNL*IKCEIGSANDKSA*EFPEKLARIIEEAGCTP*KVCNADETGFFERKCQKERD*ITKSRQWI*---SI*RTYYFILQQRFTGSH-VKTSIY**NV*TTCNEK*KRK-------NLACSLDGQ*QSMGNSISFYEWFNTFFIPEVKVYMEEKGLEFKILLLIDNAPGH---TYLEHTNVKI--VFLPPNTTSLLRPQDQGIIATFKTYYLKQAFQ 1174
            F+ S GWL  F  R+SI  + I+ E  + ++ +  +F       IE     P ++ NADETG F  KC   R  + K +  +    SI      +     TG H +K  +           K  R        NL  S   Q  +  +   F +WF+  F+P+V+ Y+  KGL+ K +LL+DN+P H     L   + +I   +LPPN  SL++P DQG+IAT K  Y     Q
Sbjct:  119 FNPSAGWLTRFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIERENLQPEQIYNADETGLFW-KCLPSRISVIKGKCTVPGHKSIEERVTIMCCANATGLHKLKLCV-------VGKAKKPRSFKSTDTLNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLPPNVASLIQPSDQGVIATMKRNYRAGLLQ 344          

HSP 2 Score: 38.5058 bits (88), Expect = 1.838e-23
Identity = 24/110 (21.82%), Postives = 52/110 (47.27%), Query Frame = 3
Query:  153 RKKRKCISLETKIQILDRIENGDSSTNLGKRFDANEAMIRTIKRNDSINLRYVMV--GT*LSFKYSYVRCCVMEKTEKALAVWIADNNQKQVPLDGNTIKQKALHIYAGI 476
            ++KR  ++++ K+ I+ ++E+G SS  L   +   E  +R I++N    + Y      T L  K   ++  + E+ ++A+  W      K  P+ G    ++A   +  +
Sbjct:    4 KRKRVVLTIKDKLDIIKKLEDGGSSKQLAVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAKRKSMKPSMYEELDRAMLEWFNQQRAKGNPISGPICAKRAEFFFYAL 113          

HSP 3 Score: 26.1794 bits (56), Expect = 1.838e-23
Identity = 11/35 (31.43%), Postives = 22/35 (62.86%), Query Frame = 1
Query: 1225 WKKFSIMDCVKFVNIAVIHGLKPSTLNACWKAVWP 1329
            WKK +++D +  + +A  + +KP T++  WK + P
Sbjct:  357 WKKLTLLDALYEIAMA-WNLVKPVTISRAWKKILP 390          
BLAST of HTH CENPB-type domain-containing protein vs. UniProt/SwissProt
Match: sp|B2RRL2|JERKL_MOUSE (Jerky protein homolog-like OS=Mus musculus OX=10090 GN=Jrkl PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.469e-22
Identity = 66/226 (29.20%), Postives = 107/226 (47.35%), Query Frame = 2
Query:  521 FSASTGWLRAFLNRNSIHNL*IKCEIGSANDKSA*EFPEKLARIIEEAGCTP*KVCNADETGFFERKCQKERD*ITKSRQWI*SI*RTYYFILQQRFT--GSHVKTSIY**NV*TTCNEK*KRK-------NLACSLDGQ*QSMGNSISFYEWFNTFFIPEVKVYMEEKGLEFKILLLIDNAPGH---TYLEHTNVKI--VFLPPNTTSLLRPQDQGIIATFKTYY 1156
            F+ S GWL  F  R+SI  + I+ E  + ++ +  +F       IE+    P ++ NADETG F  KC   R  + K +  +       + + ++R T       T ++   +      +  R        NL  S   Q  +  +   F +WF+  F+P+V+ Y+  KGL+ K +LL+DN+P H     L   + +I   +LPPN  SL++P  QG+IA  K  Y
Sbjct:  119 FNPSAGWLTRFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIEQENLQPEQIYNADETGLF-WKCLPSRTTVIKGKCTV-----PGHNLGEERITVMCCTNATGLHKLKLCVVGKARKPRSFKSTDTLNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLPPNVASLIQPLGQGVIAAMKRNY 338          

HSP 2 Score: 39.2762 bits (90), Expect = 4.469e-22
Identity = 25/110 (22.73%), Postives = 52/110 (47.27%), Query Frame = 3
Query:  153 RKKRKCISLETKIQILDRIENGDSSTNLGKRFDANEAMIRTIKRNDSINLRYVMV--GT*LSFKYSYVRCCVMEKTEKALAVWIADNNQKQVPLDGNTIKQKALHIYAGI 476
            ++KR  ++++ K+ I+ ++E+G SS  L   +   E  +R I++N    + Y      T L  K   ++  + E+ +KA+  W      K  P+ G    ++A   +  +
Sbjct:    4 KRKRVVLTIKDKLDIIKKLEDGGSSKQLAVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAKRKSMKPSMYEELDKAMLEWFNQQRAKGNPISGPICAKRAEFFFYAL 113          

HSP 3 Score: 26.5646 bits (57), Expect = 4.469e-22
Identity = 11/35 (31.43%), Postives = 22/35 (62.86%), Query Frame = 1
Query: 1225 WKKFSIMDCVKFVNIAVIHGLKPSTLNACWKAVWP 1329
            WKK +++D +  + +A  + +KP T++  WK + P
Sbjct:  357 WKKLTLLDALYEIAMA-WNLVKPVTISRAWKQILP 390          
BLAST of HTH CENPB-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4W5G0|TIGD2_HUMAN (Tigger transposable element-derived protein 2 OS=Homo sapiens OX=9606 GN=TIGD2 PE=3 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 2.791e-20
Identity = 31/77 (40.26%), Postives = 49/77 (63.64%), Query Frame = 2
Query:  941 FYEWFNTFFIPEVKVYMEEKGLEFKILLLID---NAPGHTYLEHTNVKIV--FLPPNTTSLLRPQDQGIIATFKTYY 1156
            F +WF  +F+P+V+ +++ KGL  K +LL+D     P    L   + +I+  +LPPN TSL++P  QG++AT K YY
Sbjct:  262 FRQWFEKYFVPQVQKHLKSKGLLEKAVLLLDFPPARPNEEMLSSDDGRIIVKYLPPNVTSLIQPMSQGVLATVKRYY 338          

HSP 2 Score: 40.817 bits (94), Expect = 2.791e-20
Identity = 21/69 (30.43%), Postives = 35/69 (50.72%), Query Frame = 3
Query:  741 RSQKVASGFKASKERITLFC-SNVSRDRMLKPLFINKTFKPRAMKNKNVKTLHVHWMANNKAWVTALVF 944
             + +  SG ++S+ERI + C +N +    L    + K  KPRA K  ++  L V + +   AW+   VF
Sbjct:  194 ETDQSTSGCRSSRERIIIMCCANATGLHKLNLCVVGKAKKPRAFKGTDLSNLPVTYYSQKGAWIEQSVF 262          

HSP 3 Score: 33.8834 bits (76), Expect = 2.791e-20
Identity = 20/64 (31.25%), Postives = 31/64 (48.44%), Query Frame = 2
Query:  521 FSASTGWLRAFLNRNSIHNL*IKCEIGSANDKSA*EFPEKLARIIEEAGCTP*KVCNADETGFF 712
            F+AS+GWL  F  R+ I     K      ++ +A EF       +E+    P ++  AD+TG F
Sbjct:  119 FNASSGWLTRFKQRHGIPKAAGKGTKLKGDETAAREFCGSFQEFVEKENLQPEQIYGADQTGLF 182          
BLAST of HTH CENPB-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q17RP2|TIGD6_HUMAN (Tigger transposable element-derived protein 6 OS=Homo sapiens OX=9606 GN=TIGD6 PE=2 SV=2)

HSP 1 Score: 50.447 bits (119), Expect = 1.121e-18
Identity = 29/81 (35.80%), Postives = 41/81 (50.62%), Query Frame = 2
Query:  941 FYEWFNTFFIPEVKVYMEEKGLEFKILLLIDNAPGHTYLEH-TNVKIVFLPPNTTSLLRPQDQGIIATFKTYYLKQAFQYI 1180
            F EW        ++V    K  E +ILLLIDN   H  L H   +++ +LP N T++L+P + GII T K  Y     + I
Sbjct:  261 FNEWL-------MQVDARMKRAERRILLLIDNCSAHNMLPHLERIQVGYLPSNCTAVLQPLNLGIIHTMKVLYQSHLLKQI 334          

HSP 2 Score: 41.2022 bits (95), Expect = 1.121e-18
Identity = 20/61 (32.79%), Postives = 32/61 (52.46%), Query Frame = 3
Query:  762 GFKASKERITLFCSNVSRDRMLKPLFINKTFKPRAMKNKNVKTLHVHWMANNKAWVTALVF 944
            G KA +    LFC N S    ++PL + ++  P  +  KN+ +L   + AN  AW+T  +F
Sbjct:  203 GKKAKQRLTALFCCNASGTEKMRPLIVGRSASPHCL--KNIHSLPCDYRANQWAWMTRDLF 261          

HSP 3 Score: 37.7354 bits (86), Expect = 1.121e-18
Identity = 24/106 (22.64%), Postives = 55/106 (51.89%), Query Frame = 3
Query:  156 KKRKCISLETKIQILDRIENGDSSTNLGKRFDANEAMIRTIKRNDS---INLRYVMVGT*LSFKYSYVRCCVMEKTEKALAVWIADNNQKQVPLDGNTIKQKALHI 464
            KKR+  SLE K++++  +++G    ++ K F    + + T  ++ +     +R   VG     +   +R  + +  +KA+  W  + + K + + G+ I++KAL++
Sbjct:    7 KKRRQFSLEEKMKVVGAVDSGKRKGDVAKEFGITPSTLSTFLKDRTKFEEKVREASVGP----QRKRMRSALYDDIDKAVFAWFQEIHAKNILVTGSVIRKKALNL 108          

HSP 4 Score: 25.7942 bits (55), Expect = 1.121e-18
Identity = 24/71 (33.80%), Postives = 32/71 (45.07%), Query Frame = 2
Query:  521 FSASTGWLRAFLNRNSIHNL*IKCEIGSAN-------DKSA*EFPEKLARIIEEAGCTP*KVCNADETGFF 712
            F AS GWL  F +R+ I  L   C   S         DK       ++ ++I  A  +P  + NADETG F
Sbjct:  117 FQASVGWLNRFRDRHGIA-LKAVCREDSDRLMNGLGIDKINEWHAGEIIKLI--ADYSPDDIFNADETGVF 184          
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Match: A0A2A4JVK0 (HTH CENPB-type domain-containing protein OS=Heliothis virescens OX=7102 GN=B5V51_10937 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.434e-74
Identity = 44/86 (51.16%), Postives = 62/86 (72.09%), Query Frame = 2
Query:  932 SISFYEWFNTFFIPEVKVYMEEKGLEFKILLLIDNAPGHTY---LEHTNVKIVFLPPNTTSLLRPQDQGIIATFKTYYLKQAFQYI 1180
            S  F +WF   F+PEV+ Y++ K L+FK +L++DNAPGH       H N+K+ FLPPNTT+LL+P DQGII  FK YY+++ F++I
Sbjct:  272 SAVFCDWFRNCFVPEVETYLKSKNLDFKAVLVLDNAPGHPRELGTMHPNIKVTFLPPNTTALLQPMDQGIIQAFKLYYIRRTFKFI 357          

HSP 2 Score: 83.5741 bits (205), Expect = 1.434e-74
Identity = 44/109 (40.37%), Postives = 71/109 (65.14%), Query Frame = 3
Query:  156 KKRKCISLETKIQILDRIENGDSSTNLGKRFDANEAMIRTIKRNDSINLRYVMVGT*LSFKYSYVRCCVMEKTEKALAVWIADNNQKQVPLDGNTIKQKALHIYAGIKQ 482
            +K+  + L+ KI++LDR+  G+S  ++ + FD NE+ +R+IK+++   +R  +  T LS K   VR   +EK E AL++WI D NQK+VPL G  I++KA  +YA  K+
Sbjct:   13 RKKSVLPLKVKIEMLDRLRLGESFASISRSFDVNESTVRSIKKSED-RIRSSVASTSLSAKV--VRDPAIEKMEVALSLWIEDRNQKRVPLSGPMIREKAKRLYAHFKE 118          

HSP 3 Score: 76.6406 bits (187), Expect = 1.434e-74
Identity = 35/71 (49.30%), Postives = 51/71 (71.83%), Query Frame = 3
Query:  735 VTRSQKVASGFKASKERITLF-CSNVSRDRMLKPLFINKTFKPRAMKNKNVKTLHVHWMANNKAWVTALVF 944
            +++S+K A GFKA+K+R+TL  CSN S D ++KPL + +   PRA++N+N   L V W A+ KAWVT+ VF
Sbjct:  205 ISKSEKSAPGFKAAKDRVTLLLCSNASGDCVIKPLMLYRCLNPRALQNQNKDNLPVFWRADKKAWVTSAVF 275          

HSP 4 Score: 61.6178 bits (148), Expect = 1.434e-74
Identity = 35/102 (34.31%), Postives = 57/102 (55.88%), Query Frame = 1
Query: 1207 ITVIDAWKKFSIMDCVKFVNIA-VIHGLKPSTLNACWKAVWPECVKDN-NCVLPISTEYSNIINLSNAVGGIGFEDLAFEDIEEVILDPVISNESLMEVALE 1506
            ++V++ WKKF I  C+  +NI   +  LKP TL +CWK +WP  +  N    L I +  +NI  +++ +G  GFE +   D++E++      +E L E  LE
Sbjct:  367 MSVMECWKKFDIAKCI--INIKESLQELKPHTLKSCWKKLWPVLMAGNEEESLQIQSLAANIAEIASEIGRDGFEQIESSDVQELL---ASQDEDLTETDLE 463          

HSP 5 Score: 48.9062 bits (115), Expect = 1.434e-74
Identity = 27/64 (42.19%), Postives = 38/64 (59.38%), Query Frame = 2
Query:  521 FSASTGWLRAFLNRNSIHNL*IKCEIGSANDKSA*EFPEKLARIIEEAGCTP*KVCNADETGFF 712
            F AS GW   F  R S+HN+ I  E   A+  +A  +PE+ A ++ + G TP ++ NADETG F
Sbjct:  132 FQASEGWFNKFKMRQSLHNIKIVGEAAYADTAAAERYPEEFANLVADGGYTPEQIFNADETGLF 195          
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Match: A0A4Y2B316 (Tigger transposable element-derived protein 1 OS=Araneus ventricosus OX=182803 GN=TIGD1_66 PE=4 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 4.294e-74
Identity = 100/268 (37.31%), Postives = 152/268 (56.72%), Query Frame = 3
Query:  159 KRKCISLETKIQILDRIENGDSSTNLGKRFDANEAMIRTIKRNDSINLRYVMVGT*LSFK-YSYVRCCVMEKTEKALAVWIADNNQKQVPLDGNTIKQKALHIYAGIKQLQPSDSTRPRKLFFLQVQGG*EHF*TE----TRSITYKSNVK*AQLTINLLKNXXXXXXXXXXXXDALHKKFVMQMKLVFLKENAKKNVTRSQKVASGFKASKERIT-LFCSNVSRDRMLKPLFINKTFKPRAMKNKNVKTLHVHWMANNKAWVTALVF 944
            KRK I+LETKIQILDR++ G+ S+++ K F+ NEA +RTIK+N+      V  G   S K  S+VR   +E  EKAL  W+ +N QK++P++G+ I+QKA+ I+  IK  QP+ S +  +  F   +G  E F          I  +  +   +      K   K   +    PD +      +M L + K   +  +++S++  +GFKASKERIT L CSN S D ++KP+ I+++  PRAMK+ +   L V+W A+NK  VT  +F
Sbjct:    9 KRKRITLETKIQILDRLKTGEGSSSVAKHFELNEATVRTIKKNEEKIRASVAAGCSESLKRTSHVRDTTLELMEKALIHWVEENIQKKIPIEGDAIRQKAVEIFNNIKAKQPATSNQATE--FSGSKGWLERFKKRFSLCNAKIRGEVAITDEKAATEYPKEFSKIIQDGAYTPDQVFN--ANEMGLFWKKMPRRTYLSQSERSNAGFKASKERITVLLCSNASGDYLMKPMVISRSLNPRAMKSLDKGNLPVYWKADNKTCVTVPIF 272          

HSP 2 Score: 93.5893 bits (231), Expect = 4.294e-74
Identity = 43/81 (53.09%), Postives = 59/81 (72.84%), Query Frame = 2
Query:  941 FYEWFNTFFIPEVKVYMEEKGLEFKILLLIDNAPGH-TYLEHTNVKIVFLPPNTTSLLRPQDQGIIATFKTYYLKQAFQYI 1180
            F +WF   F+ +V++Y++EK L FK+LLLID+AP H T L H NVK+VFLPPNT SL++P ++ I  TF  YY+K  F+ I
Sbjct:  272 FRDWFYNCFVSDVELYVKEKNLSFKVLLLIDSAPRHPTDLHHDNVKVVFLPPNTASLIQPLERSIFTTFNAYYIKHIFKRI 352          

HSP 3 Score: 88.9669 bits (219), Expect = 4.294e-74
Identity = 40/110 (36.36%), Postives = 70/110 (63.64%), Query Frame = 1
Query: 1183 NELKNDRAITVIDAWKKFSIMDCVKFVNIAVIHGLKPSTLNACWKAVWPECVKDNNCVLPISTEYSNIINLSNAVGGIGFEDLAFEDIEEVILDPVISNESLMEVALEGT 1512
            +E+ +   ++V   W+ +SI+DCV+ + +A+   +K STLNACWK++WP+ V   + V  +  EYS I+ L++ VGG GF+D+A  ++EE++ D   +    +EV  + T
Sbjct:  354 DEVNSGNTLSVTRVWENYSIVDCVELIKLAITE-IKKSTLNACWKSIWPDVVVSGHDVPALENEYSEIMRLAHRVGGEGFDDMASNELEELMTDSEFNAAKQVEVVFDST 462          
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Match: T2M7L0 (Tigger transposable element-derived protein 1 (Fragment) OS=Hydra vulgaris OX=6087 GN=TIGD1 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.670e-71
Identity = 40/81 (49.38%), Postives = 59/81 (72.84%), Query Frame = 2
Query:  941 FYEWFNTFFIPEVKVYMEEKGLEFKILLLIDNAPGHTY-LEHTNVKIVFLPPNTTSLLRPQDQGIIATFKTYYLKQAFQYI 1180
            F +WF   F+P+V+ +M EK L F++LL++DNA  H+  + H NVK+++ PPN TSL++P DQGII TFK YY++  F+ I
Sbjct:  356 FKDWFYNCFVPQVESFMVEKNLSFRVLLILDNASSHSAEINHPNVKVLYFPPNCTSLIQPLDQGIIQTFKMYYIQIFFEVI 436          

HSP 2 Score: 74.3294 bits (181), Expect = 1.670e-71
Identity = 42/109 (38.53%), Postives = 68/109 (62.39%), Query Frame = 3
Query:  159 KRKCISLETKIQILDRIENGDSSTNLGKRFDANEAMIRTIKRNDSINLRYVMVGT*LSF--KYSYVRCCVMEKTEKALAVWIADNNQKQVPLDGNTIKQKALHIYAGIK 479
            KRK I+L  K  ILDR++NG+   ++ K  + NE+ IRT+K+N+ + +R  +  +  S   + + +R  +M K E+AL +W+ D   K++P+ GN IK+KAL IY   K
Sbjct:   92 KRKSITLMEKTAILDRLKNGEKVFSVAKSLNLNESTIRTLKKNE-VKIRKTVANSCPSGAKRATRIRNAIMIKMERALMIWLEDCVSKKIPVCGNLIKRKALKIYEHFK 199          

HSP 3 Score: 73.9442 bits (180), Expect = 1.670e-71
Identity = 37/82 (45.12%), Postives = 55/82 (67.07%), Query Frame = 3
Query:  702 LVFLKENAKKNVTRSQKVASGFKASKERITLF-CSNVSRDRMLKPLFINKTFKPRAMKNKNVKTLHVHWMANNKAWVTALVF 944
            L + K  ++ +++ ++K ASGFK+SK+RIT+  CSN+S   ++KP+ IN    PRA KN N+  L V W AN KAW+T  +F
Sbjct:  275 LYWKKLPSRTHISINEKKASGFKSSKQRITIHKCSNLSGSLLIKPMIINNFLNPRAFKNVNMSELPVFWRANKKAWMTRELF 356          

HSP 4 Score: 72.7886 bits (177), Expect = 1.670e-71
Identity = 41/120 (34.17%), Postives = 68/120 (56.67%), Query Frame = 1
Query: 1210 TVIDAWKKFSIMDCVKFVNIAVIHGLKPSTLNACWKAVWPECVKDNNCVLPISTEYSNIINLSNAVGGIGFEDLAFEDIEEVILDPVISNESLMEVALEGTDLQFFY-----KIFLNGTY 1554
            T+++ WK+FSI+DC + V++A    +K STLNACW+ + P+ VK  + +     E + I+   ++ G  GF D+  +DIE+++ +  ++ E L E+  E T   F       K  LN TY
Sbjct:  447 TLLEVWKEFSILDCTRIVSLACTE-IKQSTLNACWRPLLPQIVKKEDNISETVKEITRIV---SSFGKEGFADIQVQDIEQLLQERSLNEEELAELIDESTSETFVEEDTNNKSALNFTY 562          

HSP 5 Score: 50.447 bits (119), Expect = 1.670e-71
Identity = 27/67 (40.30%), Postives = 40/67 (59.70%), Query Frame = 2
Query:  521 FSASTGWLRAFLNRNSIHNL*IKCEIGSANDKSA*EFPEKLARIIEEAGCTP*KVCNADETGFFERK 721
            F+AS GWL     R S+HN+  + E  SA+ K+A +F   L  II++ G    ++ NADETG + +K
Sbjct:  213 FTASAGWLDKLKKRYSLHNIKFQGEQASADVKAAEKFKTDLPEIIDKEGYVADQIFNADETGLYWKK 279          
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Match: A0A034WGK8 (Tigger transposable element-derived protein 1 OS=Bactrocera dorsalis OX=27457 GN=TIGD1 PE=4 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 7.137e-71
Identity = 98/269 (36.43%), Postives = 136/269 (50.56%), Query Frame = 3
Query:  159 KRKCISLETKIQILDRIENGDSSTNLGKRFDANEAMIRTIKRND-SINLRYVMVGT*LSFKYSY-VRCCVMEKTEKALAVWIADNNQKQVPLDGNTIKQKALHIYAGIKQLQPSDSTRPRKLFFLQVQGG*EHF*TETR----SITYKSNVK*AQLTINLLKNXXXXXXXXXXXXDALHKKFVMQMKLVFLKENAKKNVTRSQKVASGFKASKERITLF-CSNVSRDRMLKPLFINKTFKPRAMKNKNVKTLHVHWMANNKAWVTALVF 944
            KRK +SL  KI IL+ +++G+   N+ KR   NE+ +RTIKR + +I   +   G+  S  YS+  R  VM K E+AL  WI D   +++P+D   IK+KA   Y   K  +PS S       F    G    F          IT +S     +      K    +        D +      +  L + K  ++  V +  K   GFK +KERITL  CSN S D++LKPL +NK  KPRA+K  ++K L VHWMAN KAWVTA +F
Sbjct:    4 KRKRLSLRQKIVILNSLKSGEKPANIAKRHKINESSVRTIKRKENAIRKTFTECGS-SSLTYSFNTRDVVMVKVERALVWWIEDLVHRRIPVDTRCIKEKATVFYEKFKCEKPSSSNMQNTKQFCASNGWLRCFLKRNSLHNVKITGESASADEEAAKIFPKTFSDTIKAHGYVADQIFN--ADETGLYWKKMPSRTYVAKQTKSVHGFKTAKERITLLLCSNASGDKLLKPLLVNKNLKPRALKGMDLKKLPVHWMANKKAWVTASLF 269          

HSP 2 Score: 121.709 bits (304), Expect = 7.137e-71
Identity = 54/80 (67.50%), Postives = 65/80 (81.25%), Query Frame = 2
Query:  941 FYEWFNTFFIPEVKVYMEEKGLEFKILLLIDNAPGHTYLEHTNVKIVFLPPNTTSLLRPQDQGIIATFKTYYLKQAFQYI 1180
            F EWF   F+PEV+ YM  K LEFK+LLLIDNAPGH  +EH NVK++FLPPNTTSLL+P DQGIIA  KTYY+K +F++I
Sbjct:  269 FKEWFEKCFVPEVRGYMISKNLEFKVLLLIDNAPGHPVIEHPNVKVLFLPPNTTSLLQPLDQGIIAALKTYYIKHSFRFI 348          

HSP 3 Score: 65.0846 bits (157), Expect = 7.137e-71
Identity = 34/99 (34.34%), Postives = 56/99 (56.57%), Query Frame = 1
Query: 1159 KTSISIY*NELKNDRAITVIDAWKKFSIMDCVKFVNIAVIHGLKPSTLNACWKAVWPECVKDNNCVLPISTEYSNIINLSNAVGGIGFEDLAFEDIEEV 1455
            K S     N+L+++ AI VI AWK F++ +C+  + IAV   +  +TL+ CWK +W + V            Y+ I  L+ ++GG GF+D+  +DI E+
Sbjct:  342 KHSFRFILNKLESNSAINVISAWKDFNVKNCIDCIKIAV-KDITKTTLSKCWKNLWQDVVLQEESDNEGLVTYAEIFELAKSIGGEGFDDMDIDDINEL 439          
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Match: A0A384C0Q3 (tigger transposable element-derived protein 1-like OS=Ursus maritimus OX=29073 GN=LOC103662117 PE=4 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 4.704e-62
Identity = 42/89 (47.19%), Postives = 63/89 (70.79%), Query Frame = 2
Query:  947 EWFNTFFIPEVKVYMEEKGLEFKILLLIDNAPGHTYLE----HTNVKIVFLPPNTTSLLRPQDQGIIATFKTYYLKQ----AFQYIRMN 1189
            +WF+  FIPEV+ Y++ + L FK+LL++DNAP H   E    H NV+++F+PPNTTSL++P DQGII  FK +Y ++    AF+ ++ N
Sbjct:  275 DWFHNCFIPEVECYLQGRNLAFKVLLILDNAPVHCCEELKNAHPNVEVLFMPPNTTSLIQPLDQGIIKAFKAHYTRELYSKAFEALKSN 363          

HSP 2 Score: 78.1814 bits (191), Expect = 4.704e-62
Identity = 38/114 (33.33%), Postives = 70/114 (61.40%), Query Frame = 1
Query: 1189 LKNDRAITVIDAWKKFSIMDCVKFVNIAVIHGLKPSTLNACWKAVWPECVKD----NNCVLPISTEYSNIINLSNAVGGIGFEDLAFEDIEEVILDPVI--SNESLMEVALEGT 1512
            LK++   T++D WK  ++ + + +V  A    +K +T+N+CWK VWP+CV+D     +    I     NI+++++ + G GF+D+  ED+EE++ +  +  +NE L E+A +GT
Sbjct:  360 LKSNTETTMLDYWKSVTLRNVIDYVGTA-WDSIKQATINSCWKNVWPDCVQDFEGFEDVTETIKDSVKNIMHIAHQITGEGFDDMKEEDVEEILTEKAVEPTNEDLDEMAKQGT 472          

HSP 3 Score: 55.8398 bits (133), Expect = 4.704e-62
Identity = 31/84 (36.90%), Postives = 46/84 (54.76%), Query Frame = 3
Query:  705 VFLKENAKKN-VTRSQKVASGFKASKERITLF-CSNVSRDRMLKPLFINKTFKPRAMKNKNVKTLHVHWMANNKAWVTALVFTN 950
            +F K+  K+  +TR    A GFK+ ++  TL  C+N   D   KPL + +   P A+  K+V  + VHW  N KAW+T+  F N
Sbjct:  196 LFYKDVGKRTYITRMACKAPGFKSFQDYATLLLCTNAKGDFKCKPLMVYRAQNPPALTGKSVNHMPVHWRWNKKAWMTSDWFHN 279          

HSP 4 Score: 53.9138 bits (128), Expect = 4.704e-62
Identity = 39/114 (34.21%), Postives = 62/114 (54.39%), Query Frame = 3
Query:  153 RKKRKCISLETKIQILDRIENGDSSTNLGKRFDANEAMIRTIKRNDSINLRYVMVGT*LSFKY-SYVRCCVMEKTEKALAVWIAD-NNQKQVPLDGNTIKQKALHIYAGIKQLQ 488
            ++K+  + L  KI++LD++ +G S + +G+ F+ NE+ IR IK+ +    R V      S K  S VR   MEK EK L +WI +    K+  +D   ++ KA  IY  + Q Q
Sbjct:   15 KRKKAVMCLMEKIRVLDKLRSGMSCSAVGREFNVNESTIRYIKKKEKEIRRSVREAAPESAKVTSIVREEAMEKMEKRLNLWIHEMTTDKKGVVDSIVVRLKAKEIYGHVTQGQ 128          

HSP 5 Score: 49.2914 bits (116), Expect = 4.704e-62
Identity = 27/64 (42.19%), Postives = 37/64 (57.81%), Query Frame = 2
Query:  521 FSASTGWLRAFLNRNSIHNL*IKCEIGSANDKSA*EFPEKLARIIEEAGCTP*KVCNADETGFF 712
            FSAS GWL  F  R  ++N+ +  E  SA+  +A  F + L  +I+E G    +V NADETG F
Sbjct:  134 FSASAGWLARFKRRYGVNNVKLAGEANSADQDAAEGFKKYLLNVIQEKGYVEEQVFNADETGLF 197          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006798.1 (pep scaffold:Pmarinus_7.0:GL478691:31611:33359:1 gene:ENSPMAG00000006139.1 transcript:ENSPMAT00000006798.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.1814 bits (191), Expect = 2.258e-32
Identity = 36/82 (43.90%), Postives = 55/82 (67.07%), Query Frame = 2
Query:  947 EWFNTFFIPEVKVYMEEKGLEFKILLLIDNAPG---HTYLEHTNVKIVFLPPNTTSLLRPQDQ-GIIATFKTYYLKQAFQYI 1180
            +WF   F+ E + Y  ++ L FK+LL++DNAPG   H    + NV+++ LPPNT SLL+P DQ G+++TFK YYL++    +
Sbjct:  209 DWFTQHFLVESERYCRKENLAFKVLLILDNAPGYPKHLANINPNVRVLLLPPNTASLLQPLDQGGVVSTFKAYYLRRTISQL 290          

HSP 2 Score: 60.4622 bits (145), Expect = 2.258e-32
Identity = 29/83 (34.94%), Postives = 48/83 (57.83%), Query Frame = 1
Query: 1210 TVIDAWKKFSIMDCVKFVNIAVIHGLKPSTLNACWKAVWPECVKDNNCVLPISTEYSNIINLSNAVGGIGFEDLAFEDIEEVI 1458
            TV D WK ++I D +  +  +    +K ST+N  W A+W ECV   NC   +ST   ++++L   +GG GF D+  +D+ E++
Sbjct:  301 TVRDCWKAYNIRDAINNIK-SSWDDVKQSTMNCAWNAIWKECVIYLNCFPEMSTAVQDVVDLGRELGGEGFSDMREDDVLELL 382          

HSP 3 Score: 38.5058 bits (88), Expect = 2.258e-32
Identity = 15/42 (35.71%), Postives = 24/42 (57.14%), Query Frame = 3
Query:  825 LKPLFINKTFKPRAMKNKNVKTLHVHWMANNKAWVTALVFTN 950
            L  + +N++  PRA+K  +   L VHW AN  AW+T  +  +
Sbjct:  168 LHAITVNRSLNPRALKGLSRNMLPVHWTANKMAWMTGQIMED 209          

HSP 4 Score: 74.3294 bits (181), Expect = 1.584e-19
Identity = 40/112 (35.71%), Postives = 66/112 (58.93%), Query Frame = 3
Query:  150 LRKKRKCISLETKIQILDRIENGDSSTNLGKRFDANEAMIRTIKRNDSINLRYVMVGT*LSF-KYSYVRCCVMEKTEKALAVWIADNNQKQVPLDGNTIKQKALHIYAGIKQ 482
            +++KR  ++LE K++IL R E G+    LG+ F+  E+ IR I +N +     VM  T LS  K + VR  ++EK EK L VW+ D  QK++ +  +  + KA+ +Y  ++Q
Sbjct:    8 MKRKRTALTLEVKLEILRRAEAGEGPAALGRAFNLGESTIRAINKNSAKIRSSVMHSTPLSAKKTTRVRNPLLEKMEKMLVVWVEDQYQKKIHISSSATRAKAMELYERLQQ 119          

HSP 5 Score: 39.2762 bits (90), Expect = 1.584e-19
Identity = 18/44 (40.91%), Postives = 29/44 (65.91%), Query Frame = 2
Query:  521 FSASTGWLRAFLNRNSIHNL*IKCEIGSANDKSA*EFPEKLARI 652
            F AS GW   F+NR ++H++ +  E  SA+ ++A +FPE+L  I
Sbjct:  128 FLASKGWFDKFINRQNLHSIKVTGESASADREAAAKFPEELHAI 171          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003283.1 (pep scaffold:Pmarinus_7.0:GL479064:1419:3178:1 gene:ENSPMAG00000003000.1 transcript:ENSPMAT00000003283.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 2.453e-29
Identity = 36/69 (52.17%), Postives = 50/69 (72.46%), Query Frame = 2
Query:  974 EVKVYMEEKGLEFKILLLIDNAPGHT-YLE--HTNVKIVFLPPNTTSLLRPQDQGIIATFKTYYLKQAF 1171
            E++ Y + K  +FKILL++DNAP H  Y+      +K+VFLPP+TTSLL+P  QG+IA FK YYL++ F
Sbjct:  254 ELRRYCKRKNQDFKILLVVDNAPSHPPYIVDLSEQIKVVFLPPHTTSLLQPMGQGVIAAFKAYYLRRTF 322          

HSP 2 Score: 70.4774 bits (171), Expect = 2.453e-29
Identity = 71/283 (25.09%), Postives = 130/283 (45.94%), Query Frame = 3
Query:  156 KKRKCISLETKIQILDRIENGDSSTNLGKRFDANEAMIRTIKRNDSINLRYVMVGT*LSFKYSYVRCCVMEKTEKALAVWIADNNQKQVPLDGNTIKQKALHIYAGIKQLQPSDSTRPRKLFFLQVQGG*EHF*TETRSITYKSNVK*AQLTINLLKNXXXXXXXXXXXXDALHKKFVMQMKLVFLKENAKKNVTRSQKVASGFKASKERIT-LFCSNVSRDRMLKPLFINKTFKPRAMKNKNVKTLHVHWMANNKAWVTALVFTNGSIRFLFQKLKCIWKKK 1001
            KKRK I+LE K+ ++ R E  + + ++ +     E+ +RT  R     LR   +    S +    R  ++E+TE+ L++WI    +++      TIKQKAL IY  +K+    D+ +P       + G  + F      +T ++    A +  N               PDAL++          + E      +  +  A G +A+K+R+T +  +N S    LKP+ ++ +  PR +K      L VH+ ++ + W+T  +FT+  +  L  +L+   K+K
Sbjct:   10 KKRKAITLEQKLDVIKRYERNERTHDIIRTTGLTESTLRTSSRCRK-KLRKANISASRSVR---ARPKIVEETERLLSLWIESQTKRRSGPSFLTIKQKALSIYEDLKKKCKPDNVQPFNASSEWLAGFKKRFDLHNAKLTVEAASADAAVAANF--------------PDALNR---------VIDEGG---YSPDRATAPGLRAAKDRLTVMLGANASGGYRLKPVVVHHSANPRTLKGFVRADLGVHFRSSKRGWMTDQMFTDYVLETLQDELRRYCKRK 262          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003106.1 (pep scaffold:Pmarinus_7.0:GL476998:37517:41189:1 gene:ENSPMAG00000002845.1 transcript:ENSPMAT00000003106.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 89.3521 bits (220), Expect = 9.577e-26
Identity = 41/80 (51.25%), Postives = 56/80 (70.00%), Query Frame = 2
Query:  941 FYEWFNTFFIPEVKVYMEEKGLEFKILLLIDNAPGH-TYLE--HTNVKIVFLPPNTTSLLRPQDQGIIATFKTYYLKQAF 1171
            F EWF  +F+P VK Y     L FK +L++DNAP H   +E    N+K+VFL PNTT+LL+P DQG++++FK YYL+Q F
Sbjct:  212 FEEWFRVYFVPAVKEYCRTNNLAFKAILVLDNAPCHPVSVEGFDPNIKVVFLTPNTTALLQPMDQGVMSSFKAYYLRQTF 291          

HSP 2 Score: 35.4242 bits (80), Expect = 9.577e-26
Identity = 20/46 (43.48%), Postives = 27/46 (58.70%), Query Frame = 1
Query: 1210 TVIDAWKKFSIMDCVKFVNIAVI-HGLKPSTLNACWKAVWPECVKD 1344
            T+ + WK FSI+D VK  NIA     +K S LN  W+ + PE V +
Sbjct:  305 TLTEFWKGFSILDAVK--NIAASWKEMKQSNLNGVWRKLCPEFVSN 348          

HSP 3 Score: 29.6462 bits (65), Expect = 9.577e-26
Identity = 14/29 (48.28%), Postives = 17/29 (58.62%), Query Frame = 3
Query:  858 PRAMKNKNVKTLHVHWMANNKAWVTALVF 944
            PRA+K     TL V W +N KA VT  +F
Sbjct:  184 PRALKGYTKNTLPVIWKSNPKARVTGAIF 212          

HSP 4 Score: 49.2914 bits (116), Expect = 2.506e-12
Identity = 29/114 (25.44%), Postives = 57/114 (50.00%), Query Frame = 3
Query:  138 RLCLLRKKRKCISLETKIQILDRIENGDSSTNLGKRFDANEAMIRTIKRNDSINLRYVMVGT*LSFKYSYVRCCVMEKTEKALAVWIADNNQKQVPLDGNTIKQKALHIYAGIK 479
            R    ++ RK ++LE K +I+   +NG+S+T + ++ +     + TI ++ +  L  V     +   Y   R  ++ + EK L VW+ D  +  VP+    I+ KA  ++  +K
Sbjct:    4 RYSKTKRSRKSVTLEIKYKIIKLADNGESNTEIARKLELPRTTVVTILKDKARILEEVKGQAPMQAAYIRQRAGLIAEMEKHLIVWLDDQTRHHVPVSLAIIQAKARSLFEHLK 117          

HSP 5 Score: 40.0466 bits (92), Expect = 2.506e-12
Identity = 21/57 (36.84%), Postives = 29/57 (50.88%), Query Frame = 2
Query:  494 RFNAAKKTVFSASTGWLRAFLNRNSIHNL*IKCEIGSANDKSA*EFPEKLARIIEEA 664
            R   ++   F AS GW   F +R   H + +K E  SA+  +A +F   LA IIEE 
Sbjct:  120 RGEGSQSETFQASKGWFNRFKSRFKFHEMRVKGEAKSADVATAGDFSRTLAEIIEEG 176          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005921.1 (pep scaffold:Pmarinus_7.0:GL487978:976:2666:1 gene:ENSPMAG00000005352.1 transcript:ENSPMAT00000005921.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.8189 bits (229), Expect = 4.965e-23
Identity = 42/78 (53.85%), Postives = 58/78 (74.36%), Query Frame = 2
Query:  941 FYEWFNTFFIPEVKVYMEEKGLEFKILLLIDNAPGH-TYLE--HTNVKIVFLPPNTTSLLRPQDQGIIATFKTYYLKQ 1165
            F +WF   FIP+V+ Y  ++G+ FKILL+IDNAP H  +L+  H N+K+VFLPPN TS+L+P DQG+ A  K YYL++
Sbjct:  219 FEDWFINCFIPDVEKYCRDEGIPFKILLVIDNAPSHPAHLDDFHPNIKVVFLPPNATSVLQPMDQGVNAKCKAYYLRR 296          

HSP 2 Score: 32.7278 bits (73), Expect = 4.965e-23
Identity = 15/34 (44.12%), Postives = 20/34 (58.82%), Query Frame = 3
Query:  858 PRAMKNKNVKTLHVHWMANNKAWVTALVFTNGSI 959
            PRA K  +  TL V++ AN  AWVT  +F +  I
Sbjct:  191 PRAFKGISKATLPVYFRANPTAWVTVAIFEDWFI 224          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005656.1 (pep scaffold:Pmarinus_7.0:GL476578:539135:542172:1 gene:ENSPMAG00000005132.1 transcript:ENSPMAT00000005656.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 6.388e-23
Identity = 31/71 (43.66%), Postives = 43/71 (60.56%), Query Frame = 3
Query:  735 VTRSQKVASGFKASKERITLFC-SNVSRDRMLKPLFINKTFKPRAMKNKNVKTLHVHWMANNKAWVTALVF 944
            ++R +K A GFKASK+R+ L   +N + D  LKPL +  +  PRA+K      L V W +N K W+TA VF
Sbjct:  203 LSREEKTAPGFKASKDRLALLVGANAAGDCKLKPLLVYHSKTPRALKGCIKADLPVIWRSNKKGWITASVF 273          

HSP 2 Score: 47.3654 bits (111), Expect = 6.388e-23
Identity = 26/74 (35.14%), Postives = 39/74 (52.70%), Query Frame = 2
Query:  503 AAKKTVFSASTGWLRAFLNRNSIHNL*IKCEIGSANDKSA*EFPEKLARIIEEAGCTP*KVCNADETGFFERKC 724
            +A    F ASTGW   F  R ++ +L +  E   A+ ++A  F   L  IIE  G +P +V N +ETG F ++ 
Sbjct:  124 SAANETFGASTGWYAKFKGRYNLRHLKMTGETAGADVEAAEAFKSTLKEIIEGGGYSPEQVFNVNETGLFWKRM 197          

HSP 3 Score: 38.891 bits (89), Expect = 6.388e-23
Identity = 25/100 (25.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query:  171 ISLETKIQILDRIENGDSSTNLGKRFDANEAMIRTI-KRNDSINLRYVMVGT*LSFKYSYVRCCVMEKTEKALAVWIADNNQKQVPLDGNTIKQKALHIY 467
            +++  K  I+ R E G++  ++ K      + +  I K +++I  R   +   ++ K +  R  +ME  E++L +WI   N+ ++PL    I+ KAL ++
Sbjct:   15 LTINMKKYIIRRYEGGETVRDISKSLGLATSTVCGIHKASENIKARAQRMTPLVAAKLTRKRSPLMENMEESLGMWIKHQNEHRMPLSTALIQAKALRLF 114          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000031980.1 (pep primary_assembly:ASM223467v1:3:6881985:6888319:-1 gene:ENSORLG00000025652.1 transcript:ENSORLT00000031980.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.2857 bits (238), Expect = 1.257e-42
Identity = 43/79 (54.43%), Postives = 56/79 (70.89%), Query Frame = 2
Query:  947 EWFNTFFIPEVKVYMEEKGLEFKILLLIDNAPGHT-YLEHTNVKIVFLPPNTTSLLRPQDQGIIATFKTYYLKQAFQYI 1180
            +WF   FIP+VK Y+  KGL+FK+LLL+DNA GH   L +  V+I FLPPNTTSL++P DQGII  FK  Y +   Q++
Sbjct:  201 DWFKNCFIPQVKCYLRGKGLDFKVLLLVDNAGGHADDLAYDCVQIKFLPPNTTSLIQPMDQGIIRAFKALYTRNTLQHL 279          

HSP 2 Score: 61.2326 bits (147), Expect = 1.257e-42
Identity = 32/67 (47.76%), Postives = 43/67 (64.18%), Query Frame = 3
Query:  735 VTRSQKVASGFKASKERITLF-CSNVSRDRMLKPLFINKTFKPRAMKNKNVKTLHVHWMANNKAWVT 932
            + + +  A GFKA K+R+TL  C N +   M+KP  I ++  PRA+KNKN   LHV WM N KAW+T
Sbjct:  130 IMQEEAKAPGFKAQKDRLTLVKCGNAA-GFMIKPGLIYRSKNPRALKNKNKDDLHVCWMYNAKAWMT 195          

HSP 3 Score: 46.595 bits (109), Expect = 1.257e-42
Identity = 19/54 (35.19%), Postives = 35/54 (64.81%), Query Frame = 1
Query: 1183 NELKNDRAITVIDAWKKFSIMDCVKFVNIAVIHGLKPSTLNACWKAVWPECVKD 1344
            + + +D+  ++ D W+ ++I  C++ +  A I  +K  TLNACWK +WPE V++
Sbjct:  281 DAMDSDQDSSLKDYWRGYTIASCLQNIQRA-IQEMKTETLNACWKKLWPEAVQN 333          

HSP 4 Score: 30.0314 bits (66), Expect = 1.257e-42
Identity = 21/72 (29.17%), Postives = 30/72 (41.67%), Query Frame = 2
Query:  506 AKKTVFSASTGWLRAFLNRNSIHNL*IKCEIGSANDKSA*EFPEKLARIIEEAGCTP*KVCNADETGFFERK 721
            A+   F+AS GW   F  +  ++N                    K   IIEE G  P ++ N DETG F ++
Sbjct:   72 AEPCAFNASKGWFENFKKQAFVNN--------------------KFKAIIEEGGYKPEQIFNIDETGLFWKR 123          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000036785.1 (pep primary_assembly:ASM223467v1:22:11796267:11802170:-1 gene:ENSORLG00000024024.1 transcript:ENSORLT00000036785.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.0561 bits (240), Expect = 4.199e-41
Identity = 46/78 (58.97%), Postives = 56/78 (71.79%), Query Frame = 2
Query:  950 WFNTFFIPEVKVYMEEKGLEFKILLLIDNAPG-HTYLEHTNVKIVFLPPNTTSLLRPQDQGIIATFKTYYLKQAFQYI 1180
            WF   FIPEVK Y+ EKGL+FK+LLLIDNA G    L H  V+I FLPPNT+SL++P DQGII TFK  Y +   Q++
Sbjct:  241 WFKGCFIPEVKGYLTEKGLDFKVLLLIDNAGGFADDLSHDGVQIEFLPPNTSSLIQPMDQGIIRTFKALYTRNTLQHL 318          

HSP 2 Score: 62.003 bits (149), Expect = 4.199e-41
Identity = 31/64 (48.44%), Postives = 42/64 (65.62%), Query Frame = 3
Query:  744 SQKVASGFKASKERITL-FCSNVSRDRMLKPLFINKTFKPRAMKNKNVKTLHVHWMANNKAWVT 932
            SQ  ASGF+  K+R+TL  C N +   M+KP  I++   PRA+KNKN+  L V+WM N  AW+T
Sbjct:  172 SQAKASGFRGQKDRVTLVMCGNAA-GFMIKPGLISRLKNPRALKNKNMSALPVYWMHNTMAWMT 234          

HSP 3 Score: 50.447 bits (119), Expect = 4.199e-41
Identity = 27/114 (23.68%), Postives = 57/114 (50.00%), Query Frame = 1
Query: 1189 LKNDRAITVIDAWKKFSIMDCVKFVNIAVIHGLKPSTLNACWKAVWPECVKDNNCVLPISTEYSNI--------INLSNAVGGIGFEDLAFEDIEEVI--LDPVISNESLMEVA 1500
            + +D+  +  D W++++I  C++ +  A    +K  TLN CW+ +WPE V +     P  +    I        ++L+  + G GF+++  +D+  +I      +++E L E+ 
Sbjct:  322 MDSDQNFSFKDYWREYTIASCLQHIQRAH-QEMKSETLNGCWEKLWPEAVHN-----PTESRLDEIHRSVVETAVSLAKRLRGDGFDEITSDDVNSLIDAHSQPLTDEDLAEMT 429          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000029563.1 (pep primary_assembly:ASM223467v1:22:22280271:22280612:-1 gene:ENSORLG00000027274.1 transcript:ENSORLT00000029563.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.4394 bits (106), Expect = 9.754e-6
Identity = 27/92 (29.35%), Postives = 53/92 (57.61%), Query Frame = 3
Query:  153 RKKRKCISLETKIQILDRIENGDSSTNLGKRFDANEAMIRTIKRNDS---INLRYVMVGT*LSFKYSYVRCCVMEKTEKALAVWIADNNQKQ 419
            ++++K ++L  KI++LD++  G S + +G+ +  NE+ +R IK+N+     ++  V  G+  +   + VR   + K E ALA W  D  +K+
Sbjct:   17 KRQKKVLTLHEKIELLDKLMGGKSYSAVGRHYGLNESTVRYIKKNEKEVRSSVASVFCGS--AKMVNVVRDKTIVKMESALAFWFQDLRKKK 106          
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000058229.1 (SMESG000058229.1)

HSP 1 Score: 199.904 bits (507), Expect = 8.171e-57
Identity = 99/133 (74.44%), Postives = 110/133 (82.71%), Query Frame = 1
Query: 1117 TRSRYNCHV*NLLFKTSISIY*NELKNDRAITVIDAWKKFSIMDCVKFVNIAVIHGLKPSTLNACWKAVWPECVKDNNCVLPISTEYSNIINLSNAVGGIGFEDLAFEDIEEVILDPVISNESLMEVALEGTD 1515
            + +RYNCHV     K +     +EL+NDR I VIDAWKKFSIMDC+K +NIAV    +PSTLNACWKAVWPEC+KDNNCVLP+STEYSNIINLSNAV GIGFEDLAFEDIEEVILD  IS ESL+EVALEGTD
Sbjct:   83 SANRYNCHVKTYYLKQAFQYILDELENDRTIIVIDAWKKFSIMDCLKLLNIAV---HEPSTLNACWKAVWPECIKDNNCVLPLSTEYSNIINLSNAVRGIGFEDLAFEDIEEVILDLFISEESLIEVALEGTD 212          
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000058229.1 (SMESG000058229.1)

HSP 1 Score: 180.644 bits (457), Expect = 4.653e-50
Identity = 89/111 (80.18%), Postives = 96/111 (86.49%), Query Frame = 1
Query: 1183 NELKNDRAITVIDAWKKFSIMDCVKFVNIAVIHGLKPSTLNACWKAVWPECVKDNNCVLPISTEYSNIINLSNAVGGIGFEDLAFEDIEEVILDPVISNESLMEVALEGTD 1515
            N    +R I VIDAWKKFSIMDC+K +NIAV    +PSTLNACWKAVWPEC+KDNNCVLP+STEYSNIINLSNAV GIGFEDLAFEDIEEVILD  IS ESL+EVALEGTD
Sbjct:   80 NSFSANRTIIVIDAWKKFSIMDCLKLLNIAV---HEPSTLNACWKAVWPECIKDNNCVLPLSTEYSNIINLSNAVRGIGFEDLAFEDIEEVILDLFISEESLIEVALEGTD 187          
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000032104.1 (SMESG000032104.1)

HSP 1 Score: 107.457 bits (267), Expect = 5.652e-26
Identity = 49/117 (41.88%), Postives = 77/117 (65.81%), Query Frame = 1
Query: 1183 NELKNDRAITVIDAWKKFSIMDCVKFVNIAVIHGLKPSTLNACWKAVWPECVKDNNCVLPISTEYSNIINLSNAVGGIGFEDLAFEDIEEVILDPVISNESLMEVALEGTDLQFFYK 1533
            +E+ +D ++TV   WK F+I+DCVK V +AV   L+PSTLN  WK +WPE V  NN + P+  EY  I++L++++GG GFEDLA +D++E +++P +  E     +L+   +Q   K
Sbjct:  133 DEMDSDSSLTVSQVWKNFTILDCVKIVALAV-EELRPSTLNGSWKPIWPEVVLLNNRIQPVVDEYRAIVDLAHSLGGEGFEDLAIQDVKEFLVEPNLGEEEKRTKSLDLMTIQIMQK 248          

HSP 2 Score: 55.0694 bits (131), Expect = 5.511e-17
Identity = 23/44 (52.27%), Postives = 33/44 (75.00%), Query Frame = 3
Query:  363 MEKTEKALAVWIADNNQKQVPLDGNTIKQKALHIYAGIKQLQPS 494
            ME  EKAL +WI DN QK++PLDGN I+ KA+ I+  +K+ +P+
Sbjct:    1 MEMMEKALMIWIEDNTQKRMPLDGNVIRYKAVKIFNHLKETRPA 44          

HSP 3 Score: 51.9878 bits (123), Expect = 5.511e-17
Identity = 29/73 (39.73%), Postives = 43/73 (58.90%), Query Frame = 2
Query:  521 FSASTGWLRAFLNRNSIHNL*IKCEIGSANDKSA*EFPEKLARIIEEAGCTP*KVCNADETGFFERKCQKERD 739
            FS S GW   F  R S+HN+ ++ EI SA++ +A  FP++LA+IIEE G T      AD+  +  +  +K  D
Sbjct:   67 FSGSKGWFENFEKRFSLHNVKLQGEIASADEAAAKIFPKELAKIIEEHGYT------ADQAYYIRQTFKKILD 133          
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000071434.1 (SMESG000071434.1)

HSP 1 Score: 78.5666 bits (192), Expect = 2.623e-24
Identity = 52/130 (40.00%), Postives = 78/130 (60.00%), Query Frame = 3
Query:  153 RKKRKCISLETKIQILDRIENGDSSTNLGKRFDANEAMIRTIKRNDSINLRYVMVGT*LSFKYSY-VRCCVMEKTEKALAVWIADNNQKQVPLDGNTIKQKALHIYAGIKQLQPSDSTRPRKLFFLQVQG 539
            RK    + ++ K QILDR+  G+ ++++ K  + NEA +RTIK+ +      V  G  LS KYS  +R  ++EK EKAL++WI D+ Q+++ LD N I+QKAL  Y  +KQ + S S  P    FL  +G
Sbjct:  126 RKWSSKLMMKMKKQILDRLLKGEKASHIAKTLNLNEATVRTIKKKEKEIRCAVAAGCSLSSKYSSRLRVPIIEKMEKALSIWINDSCQERIRLDSNIIRQKALKTYNYLKQNRES-SVNPD---FLASKG 251          

HSP 2 Score: 53.1434 bits (126), Expect = 2.623e-24
Identity = 29/68 (42.65%), Postives = 40/68 (58.82%), Query Frame = 2
Query:  521 FSASTGWLRAFLNRNSIHNL*IKCEIGSANDKSA*EFPEKLARIIEEAGCTP*KVCNADETGFFERKC 724
            F AS GWL       ++H + I+ EI SA   +A  +PEK+ +IIE+ G T  +V NADE G   +KC
Sbjct:  246 FLASKGWLERVKKWFTLHKIKIQGEIASAYHAAAISYPEKILKIIEDQGYTWKQVFNADEIGLRWQKC 313          
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000057528.1 (SMESG000057528.1)

HSP 1 Score: 76.6406 bits (187), Expect = 3.617e-24
Identity = 39/77 (50.65%), Postives = 50/77 (64.94%), Query Frame = 1
Query: 1225 WKKFSIMDCVKFVNIAVIHGLKPSTLNACWKAVWPECVKDNNCVLPISTEYSNIINLSNAVGGIGFEDLAFEDIEEV 1455
            WKKF+I+DC+  V  A I+ ++P TLN CWKA+WPECV  N  +  IS E   II L++  GG GFE     DIEE+
Sbjct:  154 WKKFTILDCINHVANA-INQIRPMTLNLCWKAIWPECVTGNGTIAEISDE---IIALAHLFGGEGFETFNQNDIEEL 226          

HSP 2 Score: 54.299 bits (129), Expect = 3.617e-24
Identity = 21/36 (58.33%), Postives = 29/36 (80.56%), Query Frame = 2
Query: 1073 KIVFLPPNTTSLLRPQDQGIIATFKTYYLKQAFQYI 1180
            +I+F+PPN TSL++P DQGIIA FK YY+K  ++ I
Sbjct:  105 QILFIPPNMTSLIQPLDQGIIAPFKKYYIKSTYESI 140          

HSP 3 Score: 53.1434 bits (126), Expect = 2.705e-7
Identity = 25/49 (51.02%), Postives = 34/49 (69.39%), Query Frame = 2
Query:  521 FSASTGWLRAFLNRNSIHNL*IKCEIGSANDKSA*EFPEKLARIIEEAG 667
            F AS GWL  FL RN+ HNL I+ ++ S N + A +FPEK+ +IIE+ G
Sbjct:   53 FIASNGWLSGFLKRNAFHNLKIRVDVASTN-QEAKKFPEKMIKIIEDGG 100          
The following BLAST results are available for this feature:
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TIGD19.907e-4651.25tigger transposable element derived 1 [Source:HGNC... [more]
JRKL4.200e-2431.20JRK like [Source:HGNC Symbol;Acc:HGNC:6200][more]
TIGD26.375e-2140.26tigger transposable element derived 2 [Source:HGNC... [more]
TIGD26.375e-2140.26tigger transposable element derived 2 [Source:HGNC... [more]
TIGD62.558e-1935.80tigger transposable element derived 6 [Source:HGNC... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
kif65.629e-1636.47kinesin family member 6 [Source:Xenbase;Acc:XB-GEN... [more]
ENSXETT00000046714.15.187e-1028.78pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
apmapl9.369e-1034.62adipocyte plasma membrane associated protein LIKE ... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Jrkl7.391e-2329.20Jrk-like [Source:MGI Symbol;Acc:MGI:1924782][more]
Tigd21.805e-1838.67tigger transposable element derived 2 [Source:MGI ... [more]
Jrk1.056e-1335.90jerky [Source:MGI Symbol;Acc:MGI:106214][more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96MW7|TIGD1_HUMAN4.338e-4551.25Tigger transposable element-derived protein 1 OS=H... [more]
sp|Q9Y4A0|JERKL_HUMAN1.838e-2331.20Jerky protein homolog-like OS=Homo sapiens OX=9606... [more]
sp|B2RRL2|JERKL_MOUSE4.469e-2229.20Jerky protein homolog-like OS=Mus musculus OX=1009... [more]
sp|Q4W5G0|TIGD2_HUMAN2.791e-2040.26Tigger transposable element-derived protein 2 OS=H... [more]
sp|Q17RP2|TIGD6_HUMAN1.121e-1835.80Tigger transposable element-derived protein 6 OS=H... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2A4JVK01.434e-7451.16HTH CENPB-type domain-containing protein OS=Heliot... [more]
A0A4Y2B3164.294e-7437.31Tigger transposable element-derived protein 1 OS=A... [more]
T2M7L01.670e-7149.38Tigger transposable element-derived protein 1 (Fra... [more]
A0A034WGK87.137e-7136.43Tigger transposable element-derived protein 1 OS=B... [more]
A0A384C0Q34.704e-6247.19tigger transposable element-derived protein 1-like... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006798.12.258e-3243.90pep scaffold:Pmarinus_7.0:GL478691:31611:33359:1 g... [more]
ENSPMAT00000003283.12.453e-2952.17pep scaffold:Pmarinus_7.0:GL479064:1419:3178:1 gen... [more]
ENSPMAT00000003106.19.577e-2651.25pep scaffold:Pmarinus_7.0:GL476998:37517:41189:1 g... [more]
ENSPMAT00000005921.14.965e-2353.85pep scaffold:Pmarinus_7.0:GL487978:976:2666:1 gene... [more]
ENSPMAT00000005656.16.388e-2343.66pep scaffold:Pmarinus_7.0:GL476578:539135:542172:1... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000031980.11.257e-4254.43pep primary_assembly:ASM223467v1:3:6881985:6888319... [more]
ENSORLT00000036785.14.199e-4158.97pep primary_assembly:ASM223467v1:22:11796267:11802... [more]
ENSORLT00000029563.19.754e-629.35pep primary_assembly:ASM223467v1:22:22280271:22280... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058229.18.171e-5774.44SMESG000058229.1[more]
SMESG000058229.14.653e-5080.18SMESG000058229.1[more]
SMESG000032104.15.652e-2641.88SMESG000032104.1[more]
SMESG000071434.12.623e-2440.00SMESG000071434.1[more]
SMESG000057528.13.617e-2450.65SMESG000057528.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008448 ID=SMED30008448|Name=HTH CENPB-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1647bp
TGTATGTAAGTTGCTAATACATTTATGTATTTTATTTTGATAGATATTTT
AATTATTTTCTTATTATTAATTTGAAGTTCATTCGGTTCAAGTAATTCTA
GCTAATATCATAGTTTCGTTAGGATTTACCTGCCATACGCTTATGCCTGT
TAAGAAAAAAAAGAAAATGTATTTCATTAGAAACCAAAATTCAAATTTTA
GACCGTATTGAAAATGGAGATAGTTCTACGAACCTTGGTAAAAGGTTTGA
TGCAAATGAAGCTATGATACGCACTATAAAGAGAAATGACAGTATTAACC
TAAGATATGTGATGGTTGGAACTTAACTATCTTTCAAGTACTCATATGTA
AGATGTTGCGTTATGGAAAAAACTGAAAAGGCATTGGCTGTATGGATAGC
AGACAACAACCAAAAACAAGTTCCATTGGATGGAAATACAATCAAGCAGA
AAGCATTACATATATATGCCGGGATTAAACAATTGCAACCATCCGATTCA
ACGCGGCCAAGAAAACTGTTTTTTCTGCAAGTACAGGGTGGCTAAGAGCA
TTTCTAAACAGAAACTCGATCCATAACCTATAAATCAAATGTGAAATAGG
CTCAGCTAACGATAAATCTGCTTAAGAATTCCCCGAAAAGTTAGCCAGAA
TAATTGAAGAAGCCGGATGCACTCCATAAAAAGTTTGTAATGCAGATGAA
ACTGGTTTTTTTGAAAGAAAATGCCAAAAAGAACGTGACTAGATCACAAA
AAGTCGCCAGTGGATTTAAAGCATCTAAAGAACGTATTACTTTATTTTGC
AGCAACGTTTCACGGGATCGCATGTTAAAACCTCTATTTATTAATAAAAC
GTTTAAACCACGTGCAATGAAAAATAAAAACGTAAAAACCTTGCATGTTC
ATTGGATGGCCAATAACAAAGCATGGGTAACAGCATTAGTTTTTACGAAT
GGTTCAATACGTTTTTTATTCCAGAAGTTAAAGTGTATATGGAAGAAAAA
GGTTTGGAATTCAAAATTCTTTTGCTTATAGATAATGCTCCCGGACATAC
ATATTTAGAACACACAAATGTAAAAATTGTATTTTTGCCACCTAATACAA
CGTCTTTATTACGACCACAAGATCAAGGTATAATTGCCACGTTTAAAACT
TATTATTTAAAACAAGCATTTCAATATATTAGAATGAACTAAAAAATGAC
AGAGCAATAACAGTTATTGATGCTTGGAAGAAGTTTTCAATTATGGATTG
TGTAAAATTTGTAAATATTGCAGTAATACATGGATTAAAACCATCAACTT
TAAATGCGTGTTGGAAAGCAGTTTGGCCAGAATGTGTCAAAGATAACAAT
TGCGTGCTTCCAATTTCCACCGAATATTCCAACATTATAAATTTATCAAA
CGCAGTTGGTGGAATAGGGTTTGAAGATTTGGCTTTTGAAGATATTGAAG
AAGTCATACTAGATCCAGTTATTAGCAATGAGTCATTAATGGAAGTAGCT
CTAGAGGGTACTGATTTACAGTTCTTTTACAAGATTTTTTTAAACGGTAC
CTATCCATCGTGTAAAAAAAGACTTAGGTGTATAGTACAAAAAATATTTT
GTTTAATTATTTTACTAGAAATAAATTTTATTTTCAATTTTTATAGT
back to top

protein sequence of SMED30008448-orf-1

>SMED30008448-orf-1 ID=SMED30008448-orf-1|Name=SMED30008448-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=135bp
MDCVKFVNIAVIHGLKPSTLNACWKAVWPECVKDNNCVLPISTEYSNIIN
LSNAVGGIGFEDLAFEDIEEVILDPVISNESLMEVALEGTDLQFFYKIFL
NGTYPSCKKRLRCIVQKIFCLIILLEINFIFNFYS
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0003104enteric muscle cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR006600HTH_CenpB_DNA-bd_dom
IPR009057Homeobox-like_sf
IPR004875DDE_SF_endonuclease_dom
IPR007889HTH_Psq
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003676nucleic acid binding