SMED30008443

Overview
NameSMED30008443
Smed IDSMED30008443
Length (bp)2164
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30008443 (SMED30008443) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30008443 (SMED30008443) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008443

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30008443SMESG000072826.1 SmedASXL_014375SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30008443SMESG000072826.1 SmedASXL_014375SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30008443 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000440:87097..91727 +10538
Homology
BLAST of SMED30008443 vs. Ensembl Human
Match: MCMDC2 (minichromosome maintenance domain containing 2 [Source:HGNC Symbol;Acc:HGNC:26368])

HSP 1 Score: 51.9878 bits (123), Expect = 3.993e-6
Identity = 63/244 (25.82%), Postives = 116/244 (47.54%), Query Frame = 1
Query: 1300 LALEFGALLGPRSHIVHITNLLTLAARQVAQLTKVLQTRLVQ---PVVREGISICQQ---PLLCKVWAIMDSDGKSGSGIE------GKLSNNL--RSLIEASDLFYVAEE-----PNVPSWETTMSSSLLDD--YVNASRSDCDEYHQLYNSFLQNASRIAITKWSREAELLLRIYYMIGRKATLETRSV----FPQSALSVLLQLAISLAKLNNSSIIRPCDSLLAVFIYECINSSKYGLKL 1956
            ++++ G+ L  +  I  I +L +    ++ QL  VL++R +    P  + G  I QQ   P+ C  W+ +D D  S    +      G++  +L   +L+EA  L     E     P +P+ + T++ ++  +  +  ASR    E  +   +F +N +     ++S EAE +   YY+  R+  + T SV       SAL  L+ L+ + A+LN  + +   D L+A  ++E   + KYG +L
Sbjct:  393 VSIQAGSALLAKGGICFIGDLASHKKDKLEQLQTVLESRSITVYIPGKKFGEDIDQQMTFPVQCSFWSFVDVDSSSRRNAQKINTLIGQMDCSLIPANLVEAFGLLINCNESSPCHPFLPTVQHTLNKAINPEGLFYAASRQFTTEDFEKLLAFAKNLN----VEFSLEAERMTHGYYLASRR--IRTGSVCGSKLSASALKYLVFLSEAHARLNLRNKVLKEDVLIAALLFETSLTLKYGNEL 630          
BLAST of SMED30008443 vs. Ensembl Human
Match: MCMDC2 (minichromosome maintenance domain containing 2 [Source:HGNC Symbol;Acc:HGNC:26368])

HSP 1 Score: 51.6026 bits (122), Expect = 4.895e-6
Identity = 62/241 (25.73%), Postives = 114/241 (47.30%), Query Frame = 1
Query: 1300 LALEFGALLGPRSHIVHITNLLTLAARQVAQLTKVLQTRLVQ---PVVREGISICQQ---PLLCKVWAIMDSDGKSGSGIE------GKLSNNL--RSLIEASDLFYVAEE-----PNVPSWETTMSSSLLDD--YVNASRSDCDEYHQLYNSFLQNASRIAITKWSREAELLLRIYYMIGRKATLETRSV----FPQSALSVLLQLAISLAKLNNSSIIRPCDSLLAVFIYECINSSKYG 1947
            ++++ G+ L  +  I  I +L +    ++ QL  VL++R +    P  + G  I QQ   P+ C  W+ +D D  S    +      G++  +L   +L+EA  L     E     P +P+ + T++ ++  +  +  ASR    E  +   +F +N +     ++S EAE +   YY+  R+  + T SV       SAL  L+ L+ + A+LN  + +   D L+A  ++E   + KYG
Sbjct:  393 VSIQAGSALLAKGGICFIGDLASHKKDKLEQLQTVLESRSITVYIPGKKFGEDIDQQMTFPVQCSFWSFVDVDSSSRRNAQKINTLIGQMDCSLIPANLVEAFGLLINCNESSPCHPFLPTVQHTLNKAINPEGLFYAASRQFTTEDFEKLLAFAKNLN----VEFSLEAERMTHGYYLASRR--IRTGSVCGSKLSASALKYLVFLSEAHARLNLRNKVLKEDVLIAALLFETSLTLKYG 627          
BLAST of SMED30008443 vs. TrEMBL
Match: A0A0L8GTL8 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22028053mg PE=4 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 5.609e-8
Identity = 107/459 (23.31%), Postives = 203/459 (44.23%), Query Frame = 1
Query:  661 PSCHGKRSKSI-NRAVSCIARGDVCKSIEIGKDLYFIGYLMTRGSVMNLTYVIEVCNVTVLP-DLSASRVEHLSWMKIWHMMP-ADVSSYEFGPCFLMAFMFAGAVILVPIALPLYCIFIYHLDEVSPAGSFFXXXXXXXXXXXSNTDEHQMEANGNRKYLTAEDLRYRAISLVVSAHDTNLVGRIISTASKYTKCFHWHGSQDLLLGRVSSDDKFLA---LEFGALLGPRSHIVHITNLLTLAARQVAQLTKVLQTRLVQPVV----REGIS-ICQQPLLCKVWAIMDSDGKSGSGIEGKLSNN-----LRSLIEASDLFYVAEEPNVPSWETTMSSSLLDDYVNASRSDCDEYHQLYNSFLQNASRIAITKWSREAELLLRIYYMIGRKA---TLETRSVFPQSALSVLLQLAISLAKLNNSSIIRPCDSLLAVFIYECINSSKYGLKLLN--LSQE 1974
            PS     SKS  ++A+    RGD+ K + +GK+  F G +        +   IE  N+T +P DL A   + L    +W +      + + F     +AF FA                    D++ P GSF++LKL ++L L+ + +E+                    + L+V   +++++ +I+  + ++      H + + L G+V++D    A   +E G+LL   + + ++ ++         +LT +L  + ++  V     EG+  + + PL C++WA   ++ K     +  LS +     L  L++A +           +    +  S  DD   AS  D D    L N   Q  S       + ++E +L+ YY+  R+A   ++++ S+ P SAL VL Q+  S AKL+        D+++A+ +YE     ++G+ + +  LSQ+
Sbjct:  212 PSWAFMDSKSFRHQAILVYIRGDLIKKVGLGKEHQFFGIVRRDYQDSEILVTIEANNITNIPYDLFARHFKCLP-NSLWDIFQNTSETPWRFASS--LAFYFA--------------------DKIVPPGSFWVLKLAILLNLVCSGNENT-----------------DPLHLLVIGEESHIISKILLYSLRFCPRAIRHTANNYLTGKVTADTYCSAPYFVEAGSLLLASNGVCYLGDVSQCTKNTTERLTSILIEKKIKLEVGSKFTEGLPHLIEYPLKCRIWAFDSTNCKITEKGDDLLSKSNFVSRLGYLMDAFNFIVFTSPHENYNIMNHIFESYFDDDHTASILDSDLLQLLTNLRAQEVS------LTDKSEHILKTYYIASRRARSISMDS-SLVPVSALQVLAQITQSFAKLSLRHKATVPDAIMAIRLYEEALMMRFGMSVFDVHLSQQ 623          
BLAST of SMED30008443 vs. TrEMBL
Match: A0A5K4F7B1 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 7.941e-6
Identity = 29/89 (32.58%), Postives = 48/89 (53.93%), Query Frame = 1
Query: 1681 QLYNSFLQNASRIAITKWSREAELLLRIYYMIGRKATLETRSVFPQSALSVLLQLAISLAKLNNSSIIRPCDSLLAVFIYECINSSKYG 1947
            ++Y+S L         K    A  LL++YYM  R++++  R   P SAL  L +LA S AK+N   +    D+ +A++IY+   S++ G
Sbjct:   31 KIYSSLLDACKNAPTVKMEENASKLLQVYYMAMRRSSVRDRKTAPASALPTLFKLAKSNAKINGRIVANELDATIAIYIYDTFISNQTG 119          
BLAST of SMED30008443 vs. Planmine SMEST
Match: SMESG000072826.1 (SMESG000072826.1)

HSP 1 Score: 942.569 bits (2435), Expect = 0.000e+0
Identity = 475/499 (95.19%), Postives = 476/499 (95.39%), Query Frame = 1
Query:  613 SDLCFLELREFSVILPPSCHGKRSKSINRAVSCIARGDVCKSIEIGKDLYFIGYLMTRGSVMNLTYVIEVCNVTVLPDLSASRVEHLSWMKIWHMMPADVSSYEFGPCFLMAFMFAGAVILVPIALPLYCIFIYHLDEVSPAGSFFXXXXXXXXXXXSNTDEHQMEANGNRKYLTAEDLRYRAISLVVSAHDTNLVGRIISTASKYTKCFHWHGSQDLLLGRVSSDDKFLALEFGALLGPRSHIVHITNLLTLAARQVAQLTKVLQTRLVQPVVREGISICQQPLLCKVWAIMDSDGKSGSGIEGKLSNNLRSLIEASDLFYVAEEPNVPSWETTMSSSLLDDYVNASRSDCDEYHQLYNSFLQNASRIAITKWSREAELLLRIYYMIGRKATLETRSVFPQSALSVLLQLAISLAKLNNSSIIRPCDSLLAVFIYECINSSKYGLKLLNLSQECFDCISHVQFIKEPFLGQFQNMLYGIRVFLLDRMDTSLKPIFFEE 2109
            S+  F ELREFSVILPPSCHGKRSKSINRAVSCIARGDVCKSIEIGKDLYFIGYLMTRGSVMNLTYVIEVCNVTVLPDLSASRVEHLSWMKIWHMMPADVSSYEFGPCFLMAFMFA                    DEVSPAGSFFLLKLLLMLLLLSNTDEHQMEANGNRKYLTAEDLRYRAISLVVSAHDTNLVGRIISTASKYTKCFHWHGSQDLLLGRVSSDDKFLALEFGALLGPRSHIVHITNLLTLAARQVAQLTKVLQTRLVQPVVREGISICQQPLLCKVWAIMDSDGKSGSGIEGKLSNNLRSLIEASDLFYVAEEPNVPSWETTMSSSLLDDYVNASRSDCDEYHQLYNSFLQNASRIAITKWSREAELLLRIYYMIGRKATLETRSVFPQSALSVLLQLAISLAKLNNSSIIRPCDSLLAVFIYECINSSKYGLKLLNLSQECFDCISHVQFIKEPFLGQFQNMLYGIRVFLLDRMDTSLKPIFFEE
Sbjct:  191 SERVFQELREFSVILPPSCHGKRSKSINRAVSCIARGDVCKSIEIGKDLYFIGYLMTRGSVMNLTYVIEVCNVTVLPDLSASRVEHLSWMKIWHMMPADVSSYEFGPCFLMAFMFA--------------------DEVSPAGSFFLLKLLLMLLLLSNTDEHQMEANGNRKYLTAEDLRYRAISLVVSAHDTNLVGRIISTASKYTKCFHWHGSQDLLLGRVSSDDKFLALEFGALLGPRSHIVHITNLLTLAARQVAQLTKVLQTRLVQPVVREGISICQQPLLCKVWAIMDSDGKSGSGIEGKLSNNLRSLIEASDLFYVAEEPNVPSWETTMSSSLLDDYVNASRSDCDEYHQLYNSFLQNASRIAITKWSREAELLLRIYYMIGRKATLETRSVFPQSALSVLLQLAISLAKLNNSSIIRPCDSLLAVFIYECINSSKYGLKLLNLSQECFDCISHVQFIKEPFLGQFQNMLYGIRVFLLDRMDTSLKPIFFEE 669          

HSP 2 Score: 407.527 bits (1046), Expect = 1.260e-132
Identity = 195/195 (100.00%), Postives = 195/195 (100.00%), Query Frame = 2
Query:    2 ENLNDYVKYIQCSYKLLDECGILCQIRQQINKFSKKEKCREVKIIISLFSFYDSNAKEFCENPIKLINIVEEVALSTEDVLTPTLKGATNHRFYINLSYTDVPPIEGMVLAGGSQTSSVNNRIVTFSGLIISINSGSKFSRSCSYRCADKLCQDRSNHFIDVFYPEFPTPLNSSRAANCSCGMEYEEDMSERVFQ 586
            ENLNDYVKYIQCSYKLLDECGILCQIRQQINKFSKKEKCREVKIIISLFSFYDSNAKEFCENPIKLINIVEEVALSTEDVLTPTLKGATNHRFYINLSYTDVPPIEGMVLAGGSQTSSVNNRIVTFSGLIISINSGSKFSRSCSYRCADKLCQDRSNHFIDVFYPEFPTPLNSSRAANCSCGMEYEEDMSERVFQ
Sbjct:    2 ENLNDYVKYIQCSYKLLDECGILCQIRQQINKFSKKEKCREVKIIISLFSFYDSNAKEFCENPIKLINIVEEVALSTEDVLTPTLKGATNHRFYINLSYTDVPPIEGMVLAGGSQTSSVNNRIVTFSGLIISINSGSKFSRSCSYRCADKLCQDRSNHFIDVFYPEFPTPLNSSRAANCSCGMEYEEDMSERVFQ 196          
BLAST of SMED30008443 vs. Planmine SMEST
Match: SMESG000072826.1 (SMESG000072826.1)

HSP 1 Score: 942.569 bits (2435), Expect = 0.000e+0
Identity = 475/499 (95.19%), Postives = 476/499 (95.39%), Query Frame = 1
Query:  613 SDLCFLELREFSVILPPSCHGKRSKSINRAVSCIARGDVCKSIEIGKDLYFIGYLMTRGSVMNLTYVIEVCNVTVLPDLSASRVEHLSWMKIWHMMPADVSSYEFGPCFLMAFMFAGAVILVPIALPLYCIFIYHLDEVSPAGSFFXXXXXXXXXXXSNTDEHQMEANGNRKYLTAEDLRYRAISLVVSAHDTNLVGRIISTASKYTKCFHWHGSQDLLLGRVSSDDKFLALEFGALLGPRSHIVHITNLLTLAARQVAQLTKVLQTRLVQPVVREGISICQQPLLCKVWAIMDSDGKSGSGIEGKLSNNLRSLIEASDLFYVAEEPNVPSWETTMSSSLLDDYVNASRSDCDEYHQLYNSFLQNASRIAITKWSREAELLLRIYYMIGRKATLETRSVFPQSALSVLLQLAISLAKLNNSSIIRPCDSLLAVFIYECINSSKYGLKLLNLSQECFDCISHVQFIKEPFLGQFQNMLYGIRVFLLDRMDTSLKPIFFEE 2109
            S+  F ELREFSVILPPSCHGKRSKSINRAVSCIARGDVCKSIEIGKDLYFIGYLMTRGSVMNLTYVIEVCNVTVLPDLSASRVEHLSWMKIWHMMPADVSSYEFGPCFLMAFMFA                    DEVSPAGSFFLLKLLLMLLLLSNTDEHQMEANGNRKYLTAEDLRYRAISLVVSAHDTNLVGRIISTASKYTKCFHWHGSQDLLLGRVSSDDKFLALEFGALLGPRSHIVHITNLLTLAARQVAQLTKVLQTRLVQPVVREGISICQQPLLCKVWAIMDSDGKSGSGIEGKLSNNLRSLIEASDLFYVAEEPNVPSWETTMSSSLLDDYVNASRSDCDEYHQLYNSFLQNASRIAITKWSREAELLLRIYYMIGRKATLETRSVFPQSALSVLLQLAISLAKLNNSSIIRPCDSLLAVFIYECINSSKYGLKLLNLSQECFDCISHVQFIKEPFLGQFQNMLYGIRVFLLDRMDTSLKPIFFEE
Sbjct:  194 SERVFQELREFSVILPPSCHGKRSKSINRAVSCIARGDVCKSIEIGKDLYFIGYLMTRGSVMNLTYVIEVCNVTVLPDLSASRVEHLSWMKIWHMMPADVSSYEFGPCFLMAFMFA--------------------DEVSPAGSFFLLKLLLMLLLLSNTDEHQMEANGNRKYLTAEDLRYRAISLVVSAHDTNLVGRIISTASKYTKCFHWHGSQDLLLGRVSSDDKFLALEFGALLGPRSHIVHITNLLTLAARQVAQLTKVLQTRLVQPVVREGISICQQPLLCKVWAIMDSDGKSGSGIEGKLSNNLRSLIEASDLFYVAEEPNVPSWETTMSSSLLDDYVNASRSDCDEYHQLYNSFLQNASRIAITKWSREAELLLRIYYMIGRKATLETRSVFPQSALSVLLQLAISLAKLNNSSIIRPCDSLLAVFIYECINSSKYGLKLLNLSQECFDCISHVQFIKEPFLGQFQNMLYGIRVFLLDRMDTSLKPIFFEE 672          

HSP 2 Score: 402.134 bits (1032), Expect = 1.423e-130
Identity = 195/198 (98.48%), Postives = 195/198 (98.48%), Query Frame = 2
Query:    2 ENLNDYVKYIQCSYKLLDECGILCQIRQQINKFSKKEKCREVKIIISLFSFYDSN---AKEFCENPIKLINIVEEVALSTEDVLTPTLKGATNHRFYINLSYTDVPPIEGMVLAGGSQTSSVNNRIVTFSGLIISINSGSKFSRSCSYRCADKLCQDRSNHFIDVFYPEFPTPLNSSRAANCSCGMEYEEDMSERVFQ 586
            ENLNDYVKYIQCSYKLLDECGILCQIRQQINKFSKKEKCREVKIIISLFSFYDSN   AKEFCENPIKLINIVEEVALSTEDVLTPTLKGATNHRFYINLSYTDVPPIEGMVLAGGSQTSSVNNRIVTFSGLIISINSGSKFSRSCSYRCADKLCQDRSNHFIDVFYPEFPTPLNSSRAANCSCGMEYEEDMSERVFQ
Sbjct:    2 ENLNDYVKYIQCSYKLLDECGILCQIRQQINKFSKKEKCREVKIIISLFSFYDSNVNLAKEFCENPIKLINIVEEVALSTEDVLTPTLKGATNHRFYINLSYTDVPPIEGMVLAGGSQTSSVNNRIVTFSGLIISINSGSKFSRSCSYRCADKLCQDRSNHFIDVFYPEFPTPLNSSRAANCSCGMEYEEDMSERVFQ 199          
The following BLAST results are available for this feature:
BLAST of SMED30008443 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
MCMDC23.993e-625.82minichromosome maintenance domain containing 2 [So... [more]
MCMDC24.895e-625.73minichromosome maintenance domain containing 2 [So... [more]
back to top
BLAST of SMED30008443 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008443 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008443 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008443 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008443 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008443 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008443 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 2
Match NameE-valueIdentityDescription
A0A0L8GTL85.609e-823.31Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A5K4F7B17.941e-632.58Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of SMED30008443 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008443 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008443 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008443 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008443 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008443 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000072826.11.260e-13295.19SMESG000072826.1[more]
SMESG000072826.11.423e-13095.19SMESG000072826.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008443 ID=SMED30008443|Name=SMED30008443|organism=Schmidtea mediterranea sexual|type=transcript|length=2164bp
GGAAAATTTAAATGATTACGTAAAATATATTCAATGCTCTTATAAACTAC
TTGATGAATGCGGTATTCTATGTCAAATTAGGCAGCAAATTAATAAATTT
TCAAAGAAAGAGAAATGCAGGGAAGTTAAAATAATTATTTCGTTATTCTC
ATTCTATGATTCAAATGCAAAGGAATTTTGTGAAAATCCAATCAAATTGA
TAAACATTGTGGAAGAAGTTGCGCTTTCTACTGAGGATGTTTTGACTCCG
ACATTGAAGGGAGCAACTAATCATCGGTTCTATATTAATCTCAGCTACAC
CGATGTTCCTCCAATTGAAGGAATGGTGCTTGCTGGGGGCTCCCAAACGT
CCTCAGTTAACAACAGAATTGTCACCTTCTCTGGTCTGATCATTTCCATC
AATTCCGGATCCAAGTTCTCCAGGAGTTGTTCCTATCGTTGTGCCGACAA
ATTGTGCCAGGACCGTTCCAATCATTTCATTGATGTATTTTATCCTGAAT
TTCCCACTCCATTGAACAGTTCCAGAGCGGCGAATTGCTCCTGCGGAATG
GAGTATGAAGAAGACATGAGTGAGAGAGTATTTCAAGGTTTTCTCCACAC
ATTTTAATGCAATCGGATCTTTGTTTTCTAGAACTCCGGGAATTCTCTGT
CATATTGCCTCCTAGTTGCCATGGGAAACGCAGTAAATCAATAAATCGTG
CGGTCTCATGCATTGCTCGAGGAGATGTTTGTAAATCGATTGAGATCGGG
AAGGATCTGTATTTCATTGGATATCTGATGACTCGGGGCTCAGTGATGAA
TCTCACATATGTAATCGAGGTTTGCAATGTGACGGTCCTGCCGGACCTGT
CGGCCTCCAGGGTGGAGCATTTATCATGGATGAAGATCTGGCACATGATG
CCAGCAGACGTTTCCAGCTATGAATTCGGGCCGTGTTTCTTGATGGCATT
TATGTTTGCCGGTGCCGTTATACTTGTTCCGATTGCATTGCCACTTTATT
GCATATTCATTTATCATTTAGATGAAGTTTCTCCTGCAGGATCCTTTTTC
CTTTTGAAGCTCTTGTTGATGCTGCTATTGTTGTCCAATACAGATGAGCA
TCAAATGGAGGCCAACGGCAATCGCAAATATCTGACAGCAGAGGATCTGC
GATATAGAGCGATCTCATTGGTTGTTTCTGCGCATGATACTAACTTGGTC
GGGAGGATCATCAGCACTGCCAGCAAGTACACCAAATGCTTTCATTGGCA
CGGTAGTCAGGACCTGTTGCTGGGCAGGGTGAGCAGTGACGACAAATTCT
TGGCACTCGAATTCGGTGCATTGCTGGGACCGAGGAGCCACATTGTGCAC
ATCACAAATCTGCTGACTCTTGCAGCCCGGCAGGTCGCCCAGCTCACCAA
AGTGCTGCAGACTCGCCTCGTGCAGCCGGTAGTTAGGGAGGGCATTTCGA
TATGCCAGCAACCGTTGCTATGCAAGGTCTGGGCTATTATGGATTCTGAC
GGGAAATCTGGAAGTGGAATCGAGGGCAAATTGTCAAATAACTTGCGCTC
ATTGATCGAGGCCTCCGACTTGTTCTATGTTGCCGAGGAACCAAATGTGC
CATCCTGGGAGACAACTATGAGCAGCAGTTTATTGGATGATTATGTGAAC
GCCTCACGTTCCGATTGTGACGAATATCATCAGCTGTATAATTCGTTCCT
GCAGAACGCGTCTCGAATCGCCATAACCAAGTGGAGTCGTGAGGCTGAAC
TGCTGCTGCGCATTTATTATATGATCGGCCGCAAAGCTACCCTAGAAACC
AGATCTGTCTTCCCTCAATCGGCTCTATCCGTTTTACTCCAGCTAGCAAT
CAGTCTTGCCAAGCTCAATAATAGCTCCATCATCAGGCCTTGTGACTCCC
TATTGGCTGTCTTTATATACGAATGTATCAATTCTTCCAAATATGGATTG
AAATTGTTAAATTTATCCCAAGAGTGTTTCGACTGCATTTCCCATGTTCA
ATTCATTAAAGAACCGTTTCTGGGGCAATTTCAAAATATGCTTTATGGGA
TTCGAGTCTTTCTCCTTGATCGGATGGACACAAGTTTGAAACCGATATTC
TTTGAGGAATAGGTGTTCTGATTGCCGTTGATGTAGCTTTGCATTTATTG
CAGATGGACATTTT
back to top

protein sequence of SMED30008443-orf-1

>SMED30008443-orf-1 ID=SMED30008443-orf-1|Name=SMED30008443-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=502bp
MQSDLCFLELREFSVILPPSCHGKRSKSINRAVSCIARGDVCKSIEIGKD
LYFIGYLMTRGSVMNLTYVIEVCNVTVLPDLSASRVEHLSWMKIWHMMPA
DVSSYEFGPCFLMAFMFAGAVILVPIALPLYCIFIYHLDEVSPAGSFFLL
KLLLMLLLLSNTDEHQMEANGNRKYLTAEDLRYRAISLVVSAHDTNLVGR
IISTASKYTKCFHWHGSQDLLLGRVSSDDKFLALEFGALLGPRSHIVHIT
NLLTLAARQVAQLTKVLQTRLVQPVVREGISICQQPLLCKVWAIMDSDGK
SGSGIEGKLSNNLRSLIEASDLFYVAEEPNVPSWETTMSSSLLDDYVNAS
RSDCDEYHQLYNSFLQNASRIAITKWSREAELLLRIYYMIGRKATLETRS
VFPQSALSVLLQLAISLAKLNNSSIIRPCDSLLAVFIYECINSSKYGLKL
LNLSQECFDCISHVQFIKEPFLGQFQNMLYGIRVFLLDRMDTSLKPIFFE
E*
back to top

protein sequence of SMED30008443-orf-2

>SMED30008443-orf-2 ID=SMED30008443-orf-2|Name=SMED30008443-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=140bp
MCQIFIHDKCSTLEADRSGRTVTLQTSITYVRFITEPRVIRYPMKYRSFP
ISIDLQTSPRAMHETARFIDLLRFPWQLGGNMTENSRSSRKQRSDCIKMC
GENLEILSHSCLLHTPFRRSNSPLWNCSMEWEIQDKIHQ*
back to top

protein sequence of SMED30008443-orf-3

>SMED30008443-orf-3 ID=SMED30008443-orf-3|Name=SMED30008443-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=202bp
ENLNDYVKYIQCSYKLLDECGILCQIRQQINKFSKKEKCREVKIIISLFS
FYDSNAKEFCENPIKLINIVEEVALSTEDVLTPTLKGATNHRFYINLSYT
DVPPIEGMVLAGGSQTSSVNNRIVTFSGLIISINSGSKFSRSCSYRCADK
LCQDRSNHFIDVFYPEFPTPLNSSRAANCSCGMEYEEDMSERVFQGFLHT
F*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR031327MCM
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0005524ATP binding
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0007130synaptonemal complex assembly
GO:0007146meiotic recombination nodule assembly
GO:0007283spermatogenesis
GO:0042140late meiotic recombination nodule assembly
GO:0048477oogenesis
GO:1990918double-strand break repair involved in meiotic recombination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR11630:SF75MINICHROMOSOME MAINTENANCE DOMAIN-CONTAINING PROTEIN 2coord: 22..439
NoneNo IPR availableTMHMMTMhelixcoord: 141..160
NoneNo IPR availableTMHMMTMhelixcoord: 112..134
IPR031327Mini-chromosome maintenance proteinPANTHERPTHR11630DNA REPLICATION LICENSING FACTORcoord: 22..439