glutamate receptor ionotropic, NMDA 3A

Overview
Nameglutamate receptor ionotropic, NMDA 3A
Smed IDSMED30008439
Length (bp)3359
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of glutamate receptor ionotropic, NMDA 3A (SMED30008439) t-SNE clustered cells

Violin plots show distribution of expression levels for glutamate receptor ionotropic, NMDA 3A (SMED30008439) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of glutamate receptor ionotropic, NMDA 3A (SMED30008439) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for glutamate receptor ionotropic, NMDA 3A (SMED30008439) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008439

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30008439SMESG000034930.1 SmedASXL_010161SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30008439SMESG000034930.1 dd_Smed_v6_22863_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30008439SMESG000034930.1 dd_Smed_v4_33083_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Human
Match: GRIN3A (glutamate ionotropic receptor NMDA type subunit 3A [Source:HGNC Symbol;Acc:HGNC:16767])

HSP 1 Score: 252.677 bits (644), Expect = 1.475e-68
Identity = 160/520 (30.77%), Postives = 263/520 (50.58%), Query Frame = 3
Query: 1395 WPE-ALMFKT-FVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRIC------------------YLIDATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGS-QIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGK--LKLGTISGSGTDYHLRMTQYPLYKYLLLF--QNSEDVLVALKEG--RIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMT-GIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
            WPE A   KT F    K+HLR+VT +E P V  R +  +  C +   G++C                  +  + T+ ++ + CC+G  ID++  +A   ++                     D   + D +   W+    GH + L+  + R  A +AV S  I  A+  V     T P+  T +G+L+  RD    I AF++P HW+MW+GIF+ + + +V  T+YEW SP+G TP+GRN+S++FSFSSAL +C++ LF  T   K PKCW+ RFLMN++A FC+  L++YTA LAA MVG+   + + GIHD K+ +     + GT+  S  + ++R +   +++Y+  +    + D +  LK    ++DAF+ D   L +   I       TVGKPF    Y +    N     + L   +S++IS       M+     W + +  G     +  + +M +++F+G  +++ +GF LS    + E IVY+  +PR +  +  Q  L  SQR +R +
Sbjct:  496 WPEQAQRHKTHFQHPSKLHLRVVTLIEHPFVFTREVDDEGLCPA---GQLCLDPMTNDSSTLDSLFSSLHSSNDTVPIKFKKCCYGYCIDLLEKIAEDMNFD-------------------FDLYIVGDGKYGAWK---NGHWTGLVGDLLRGTAHMAVTSFSINTARSQV--IDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAVFLTLYEWKSPFGLTPKGRNRSKVFSFSSALNICYALLFGRTVAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVEYLKNDPEKLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPN-----SPLTANISELISQYKSHGFMDMLHDKWYRVVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLLPRIKNKSKLQYWLHTSQRLHRAI 983          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Human
Match: GRIN3B (glutamate ionotropic receptor NMDA type subunit 3B [Source:HGNC Symbol;Acc:HGNC:16768])

HSP 1 Score: 215.698 bits (548), Expect = 1.041e-56
Identity = 147/500 (29.40%), Postives = 246/500 (49.20%), Query Frame = 3
Query: 1446 LRIVTYLESPHVMIRNLSRKDECSSKIYGRICY--------LIDA----------TMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGK--LKLGTISGSGTDYHLRMTQYPLYKYLLLFQNSED----VLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMT-GIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
            LR+VT LE P V  R+     +C +   G++C          +DA             LRK  CC+G  ID++  LA    +  + ++ L+G  +           ++ D +  G           L+  +    A +AV S   I          T P+  T +G+++  RD  + I AF++P HWS W+G+F  + + ++  TVYEW SPYG TPRGRN+S +FS+SSAL LC++ LF  T  +K+PKC + R LMN++A FC++ L+SYTA LAA MVG  T + + GIHD K+ +     + GT+  S  + +++ +   ++ ++             ++     +++AF+ D   L +   I       TVGKPF    Y +   +N   T + L++F+S+  SS    +  ++    W K +  G     +  + +M + +FAG  +++ LG   +  + + E   ++  +PR RK +  Q  L  SQ+ +R L
Sbjct:  417 LRVVTLLEHPFVFARDPDEDGQCPA---GQLCLDPGTNDSATLDALFAALANGSAPRALRK--CCYGYCIDLLERLAEDTPF--DFELYLVGDGKY---------GALRDGRWTG-----------LVGDLLAGRAHMAVTS-FSINSARSQVVDFTSPFFSTSLGIMVRARDTASPIGAFMWPLHWSTWLGVFAALHLTALFLTVYEWRSPYGLTPRGRNRSTVFSYSSALNLCYAILFRRTVSSKTPKCPTGRLLMNLWAIFCLLVLSSYTANLAAVMVGDKTFEELSGIHDPKLHHPAQGFRFGTVWESSAEAYIKKSFPDMHAHMRRHSAPTTPRGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLT-SNLSEFISRYKSSGFIDLLHDK----WYKMVPCGKRVFAVTETLQMSIYHFAGLFVLLCLGLGSALLSSLGEHAFFRLALPRIRKGSRLQYWLHTSQKIHRAL 883          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Human
Match: GRIN2A (glutamate ionotropic receptor NMDA type subunit 2A [Source:HGNC Symbol;Acc:HGNC:4585])

HSP 1 Score: 155.992 bits (393), Expect = 8.423e-38
Identity = 132/517 (25.53%), Postives = 242/517 (46.81%), Query Frame = 3
Query: 1344 KFKKVFQYQDAQMRTRN--WPEALMFKTF--VQVKKIHLRIVTYLESPHVMIRNLSR------KDECSSKIYGRICYLIDATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVS-VATTVYEWLSPYG--------KTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQ-----NGKLKLGTISGSGTDYHLRMTQYP-LYKYLLLF--QNSEDVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWS--SDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVY---KFC 2798
            +++KV ++++  +  R+  WP    +K+F   +    HL IVT  E+P V++ ++        ++    + + +I    +  M ++K  CC G  IDI+  L+    ++               ++ +V +          W          +I  +    A +AVGS + I +        + P++ T I +++ R +      AFL PF  S+W+ +F+ + +VS +A  V+E+ SP G        K P G +    F+   A+ L W  +F+++ P ++PK  +S+ +++++A F VIFLASYTA LAA+M+ +  +  + G+ D K Q     +   + GT+    T+ ++R   YP +++Y+  F  +  ED LV+LK G++DAF+YD   L +           T+G   G +F T  +   L   G+     +   +        ME+   LW   +TGI H++     S ++ + N AG   M+    +LS    + E + Y   +FC
Sbjct:  234 EWEKVGKWENHTLSLRHAVWPR---YKSFSDCEPDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKK--CCKGFCIDILKKLSRTVKFT--------------YDLYLVTNGKHGKKVNNVWNG--------MIGEVVYQRAVMAVGS-LTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPS----FTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIR-NNYPYMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGS--GYIFATTGYGIALQK-GSPWKRQIDLALLQFVGDGEMEELETLW---LTGICHNEKNEVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHLFYWKLRFC 711          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Human
Match: GRIN2A (glutamate ionotropic receptor NMDA type subunit 2A [Source:HGNC Symbol;Acc:HGNC:4585])

HSP 1 Score: 155.606 bits (392), Expect = 1.388e-37
Identity = 132/517 (25.53%), Postives = 243/517 (47.00%), Query Frame = 3
Query: 1344 KFKKVFQYQDAQMRTRN--WPEALMFKTF--VQVKKIHLRIVTYLESPHVMIRNLSR------KDECSSKIYGRICYLIDATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVS-VATTVYEWLSPYG--------KTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQ-----NGKLKLGTISGSGTDYHLRMTQYP-LYKYLLLF--QNSEDVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWS--SDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVY---KFC 2798
            +++KV ++++  +  R+  WP    +K+F   +    HL IVT  E+P V++ ++        ++    + + +I    +  M ++K  CC G  IDI+  L+    ++               ++ +V +          W        + +I  +    A +AVGS + I +        + P++ T I +++ R +      AFL PF  S+W+ +F+ + +VS +A  V+E+ SP G        K P G +    F+   A+ L W  +F+++ P ++PK  +S+ +++++A F VIFLASYTA LAA+M+ +  +  + G+ D K Q     +   + GT+    T+ ++R   YP +++Y+  F  +  ED LV+LK G++DAF+YD   L +           T+G   G +F T  +   L   G+     +   +        ME+   LW   +TGI H++     S ++ + N AG   M+    +LS    + E + Y   +FC
Sbjct:  371 EWEKVGKWENHTLSLRHAVWPR---YKSFSDCEPDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKK--CCKGFCIDILKKLSRTVKFT--------------YDLYLVTNGKHGKKVNNVW--------NGMIGEVVYQRAVMAVGS-LTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPS----FTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIR-NNYPYMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGS--GYIFATTGYGIAL-QKGSPWKRQIDLALLQFVGDGEMEELETLW---LTGICHNEKNEVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHLFYWKLRFC 848          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Human
Match: GRIN2A (glutamate ionotropic receptor NMDA type subunit 2A [Source:HGNC Symbol;Acc:HGNC:4585])

HSP 1 Score: 155.606 bits (392), Expect = 1.388e-37
Identity = 132/517 (25.53%), Postives = 243/517 (47.00%), Query Frame = 3
Query: 1344 KFKKVFQYQDAQMRTRN--WPEALMFKTF--VQVKKIHLRIVTYLESPHVMIRNLSR------KDECSSKIYGRICYLIDATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVS-VATTVYEWLSPYG--------KTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQ-----NGKLKLGTISGSGTDYHLRMTQYP-LYKYLLLF--QNSEDVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWS--SDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVY---KFC 2798
            +++KV ++++  +  R+  WP    +K+F   +    HL IVT  E+P V++ ++        ++    + + +I    +  M ++K  CC G  IDI+  L+    ++               ++ +V +          W        + +I  +    A +AVGS + I +        + P++ T I +++ R +      AFL PF  S+W+ +F+ + +VS +A  V+E+ SP G        K P G +    F+   A+ L W  +F+++ P ++PK  +S+ +++++A F VIFLASYTA LAA+M+ +  +  + G+ D K Q     +   + GT+    T+ ++R   YP +++Y+  F  +  ED LV+LK G++DAF+YD   L +           T+G   G +F T  +   L   G+     +   +        ME+   LW   +TGI H++     S ++ + N AG   M+    +LS    + E + Y   +FC
Sbjct:  371 EWEKVGKWENHTLSLRHAVWPR---YKSFSDCEPDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKK--CCKGFCIDILKKLSRTVKFT--------------YDLYLVTNGKHGKKVNNVW--------NGMIGEVVYQRAVMAVGS-LTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPS----FTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIR-NNYPYMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGS--GYIFATTGYGIAL-QKGSPWKRQIDLALLQFVGDGEMEELETLW---LTGICHNEKNEVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHLFYWKLRFC 848          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Celegans
Match: nmr-2 (NMDA class glutamate Receptor [Source:UniProtKB/TrEMBL;Acc:E0AHC1])

HSP 1 Score: 143.28 bits (360), Expect = 2.054e-34
Identity = 144/577 (24.96%), Postives = 242/577 (41.94%), Query Frame = 3
Query: 1356 VFQYQDAQMRTRNWPEALMFKTFVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRIC------YLIDATMKLRKEY--CCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYAL---LTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGI-FITIQVVSVATTVYEWLSPYG----KTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKI-----QNGKLKLGTISGSGTDYHLRMTQYPLYKYL----LLFQNSEDVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLW-TKEMTGIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNR-LLFCDLYYSKSSWSERHKFMKQDG---LIGERLINHRRLSETLNIDF 2996
            +F   + +M    WP            K H+++VT  E P + + ++    +      G IC      Y   A +K  +    CC G  +D++N LA+            IG +    ++           ++ G + E+G +   LI+ +  + AD+ V S     K+N   A     + P+L T I +++  R  +    AFL PF +S W+ I F+ I V +++  ++EW+SPY     K P   ++   FS   +  L W+ LFS +  T  PK   SR +  ++A F + FLA YTA LAA+M+ +    ++ GIHD  +     Q    + GT+ G  T   ++   + +++Y+        N    + A+K   +DAF+YD   L ++          TVGK      Y + F KN   T + +N +M +       K  +E+    W T   T   HS+  S+  + ++NF    +++  G  +S   L  E I         +K + +  C  IS    + L F +       W  R + +       L   R  N R   E  N D 
Sbjct:  433 IFTNNELKMADVQWPGEKANPPQGAADKFHVKVVTLHEPPFIAVSDVDPDTQKCPGNQGSICDWGDVEYTDGAGVKKNRTLLKCCSGYCVDLLNKLAND-----------IGFTYTLYKV---------RDEKWGLKTENGWNG--LIADLMHNKADMCVTS----LKLNSERARDIDFSLPFLDTGISIIVKIRSGVLSPTAFLEPFEYSTWVIILFVCIHVAAISIFLFEWVSPYSFNMQKYPPPEHK---FSLFRSYWLVWATLFSASVSTDVPKSTVSRLMALVWAAFGLTFLAVYTANLAAFMITRVQYYDLSGIHDPMLNFPHDQKPPFRFGTVDGGNTHETMKRNWHKMHEYVKHNKYFRMNISAGIEAVKNEELDAFIYDAVVLDYWAGKDANCALMTVGKWASMTGYGIGFPKNSPHT-SLVNHYMLQYQQ----KGDLERLQNFWLTGACTPDSHSQTQSAP-LGIENFLSAFVLLAGGIIVSVIVLGFEHIYCMHLRKPLQKIDPNGWCGIISMAMGKSLTFTEAVDRVQEWRSRTQSLASTNSPQLKRRRSANLRPTEEPFNQDL 974          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Celegans
Match: nmr-2 (NMDA class glutamate Receptor [Source:UniProtKB/TrEMBL;Acc:E0AHC1])

HSP 1 Score: 121.324 bits (303), Expect = 7.289e-29
Identity = 104/395 (26.33%), Postives = 169/395 (42.78%), Query Frame = 3
Query: 1866 PYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGI-FITIQVVSVATTVYEWLSPYG----KTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKI-----QNGKLKLGTISGSGTDYHLRMTQYPLYKYL----LLFQNSEDVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNR-LLFCDLYYSKSSWSERHKFMKQDG---LIGERLINHRRLSETLNIDF 2996
            P+L T I +++  R  +    AFL PF +S W+ I F+ I V +++  ++EW+SPY     K P   ++   FS   +  L W+ LFS +  T  PK   SR +  ++A F + FLA YTA LAA+M+ +    ++ GIHD  +     Q    + GT+ G  T   ++   + +++Y+        N    + A+K   +DAF+YD   L ++          TVGK      Y + F KN   T + +N +M +       K  +E+    W       D      S  + ++NF    +++  G  +S   L  E I         +K + +  C  IS    + L F +       W  R + +       L   R  N R   E  N D 
Sbjct:   27 PFLDTGISIIVKIRSGVLSPTAFLEPFEYSTWVIILFVCIHVAAISIFLFEWVSPYSFNMQKYPPPEHK---FSLFRSYWLVWATLFSASVSTDVPKSTVSRLMALVWAAFGLTFLAVYTANLAAFMITRVQYYDLSGIHDPMLNFPHDQKPPFRFGTVDGGNTHETMKRNWHKMHEYVKHNKYFRMNISAGIEAVKNEELDAFIYDAVVLDYWAGKDANCALMTVGKWASMTGYGIGFPKNSPHT-SLVNHYMLQYQQ----KGDLERLQNFWLTGACTPDSHSQTQSAPLGIENFLSAFVLLAGGIIVSVIVLGFEHIYCMHLRKPLQKIDPNGWCGIISMAMGKSLTFTEAVDRVQEWRSRTQSLASTNSPQLKRRRSANLRPTEEPFNQDL 413          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Celegans
Match: nmr-1 (NMDA class glutamate Receptor; NMDA-type ionotropic glutamate receptor NMR-1 [Source:UniProtKB/TrEMBL;Acc:G5EGQ9])

HSP 1 Score: 110.923 bits (276), Expect = 2.312e-24
Identity = 96/406 (23.65%), Postives = 176/406 (43.35%), Query Frame = 3
Query: 1443 HLRIVTYLESPHVMIRNLSRKDECSS--------KIYGRIC-----YLIDATMKLRKEY-CCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPR-----------------GRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQN--GKLKLGTISGSGT----DYHLRMTQYPLYKYLLLFQNSEDVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKN 2549
            HLR+VT  + P V    +    +C+          I+ +I      Y    T++   EY CC G+AID+   L++L+    NN +     +  +  + + +S  +  +        +G   S +I  ++   AD+A+G  I I          T+P+L   I +L     R + + +FL P   S+W  +FI++ +V +A    ++ SP+ +  +                 G++     +F  A+   W  L +     K+P+  S+R L  ++  FC+I +ASYTA LAA++V     + + G+ D +++N       GT+  S        H+ ++           + + + + +L  G +DAF++D   L+F    H      T G  FG+  Y +   KN
Sbjct:  396 HLRVVTVADPPFVYTTPIGSPSQCAELGNTVVEWSIFDKIVVSGPWYSCPLTLENSTEYFCCAGLAIDL---LSNLSLPEANNSID----TSFTFSLHLNESYGVVQASE-----TTGITISGVIGELDGDTADMAIGG-ITINPERERIVDFTEPWLYHGIRILEKNIPRDSPMQSFLQPLQSSLWTALFISVILVGLAIYCLDFKSPFERFYQADKEMEQDLKKEFELWIGKDADENVNFGEAMWFVWGVLLNSGVSEKTPRSCSARVLGIVWCGFCMIMVASYTANLAAFLVLDQPEKGLTGVTDPRLRNPSANFSFGTVLNSNVYQYFKRHVELSSMFRKMEPHNVRRASEAVHSLLNGSLDAFIWDSTRLEFEAARHC--ELRTRGSLFGRSAYGIGLQKN 786          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Celegans
Match: nmr-1 (NMDA class glutamate Receptor; NMDA-type ionotropic glutamate receptor NMR-1 [Source:UniProtKB/TrEMBL;Acc:G5EGQ9])

HSP 1 Score: 110.923 bits (276), Expect = 2.312e-24
Identity = 96/406 (23.65%), Postives = 176/406 (43.35%), Query Frame = 3
Query: 1443 HLRIVTYLESPHVMIRNLSRKDECSS--------KIYGRIC-----YLIDATMKLRKEY-CCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPR-----------------GRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQN--GKLKLGTISGSGT----DYHLRMTQYPLYKYLLLFQNSEDVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKN 2549
            HLR+VT  + P V    +    +C+          I+ +I      Y    T++   EY CC G+AID+   L++L+    NN +     +  +  + + +S  +  +        +G   S +I  ++   AD+A+G  I I          T+P+L   I +L     R + + +FL P   S+W  +FI++ +V +A    ++ SP+ +  +                 G++     +F  A+   W  L +     K+P+  S+R L  ++  FC+I +ASYTA LAA++V     + + G+ D +++N       GT+  S        H+ ++           + + + + +L  G +DAF++D   L+F    H      T G  FG+  Y +   KN
Sbjct:  396 HLRVVTVADPPFVYTTPIGSPSQCAELGNTVVEWSIFDKIVVSGPWYSCPLTLENSTEYFCCAGLAIDL---LSNLSLPEANNSID----TSFTFSLHLNESYGVVQASE-----TTGITISGVIGELDGDTADMAIGG-ITINPERERIVDFTEPWLYHGIRILEKNIPRDSPMQSFLQPLQSSLWTALFISVILVGLAIYCLDFKSPFERFYQADKEMEQDLKKEFELWIGKDADENVNFGEAMWFVWGVLLNSGVSEKTPRSCSARVLGIVWCGFCMIMVASYTANLAAFLVLDQPEKGLTGVTDPRLRNPSANFSFGTVLNSNVYQYFKRHVELSSMFRKMEPHNVRRASEAVHSLLNGSLDAFIWDSTRLEFEAARHC--ELRTRGSLFGRSAYGIGLQKN 786          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Celegans
Match: glr-3 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q21415])

HSP 1 Score: 73.9442 bits (180), Expect = 4.661e-13
Identity = 87/367 (23.71%), Postives = 150/367 (40.87%), Query Frame = 3
Query: 1746 ESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYR-RDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFS-----HTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHD----TKIQNGKLKLGT----ISGSGTDYHLRMTQYPLYKYLLLFQNSEDVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVP 2804
            ES G  S ++  + R DAD+AV S + I+         T PY+   I +L  + R R +    F+ P    +WI  F +  VVSVA  +   +SPY +  R  +  +     +  +L  S  F+            P+  S+R L  I+  F +I ++SYTA LAA +  +     I    D    TKI+ G L  G+     + S  + + RM Q       L  Q+S++ +  +K      + Y  ES      +        +G    Q  Y +   K     G+   + +S  I     K  + +  + W K+ + +        D+   ++  G  I++++G  L+   ++ E I  +   P
Sbjct:  455 ESNGKWSGMVGELQRGDADLAVAS-LTISYGRSEVIDFTVPYMHLGISILFKKPRIRDSDWFKFMDPLSTQVWIMTFASYFVVSVAIWIIAKISPYEQFERDEDNGQYKPVDNQFSLRNSFWFTVCSLMQQGSELCPRAASTRLLTGIWWFFALILISSYTANLAAVLTTRRMETPIENADDLAAQTKIKYGTLGRGSTMSFFNESKIETYERMWQLMSSSPGLFVQSSKEGIARVKSSD---YAYLMESSMLEYAVERDCELMQIGGLIDQKGYGIGLPK-----GSPYRELISTAILRLQEKTELTELKEKWWKDKSVVCEQPK-RKDQDDGESIGGIFIILVVGLVLTAVLVIFELITTRKPSP 811          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Fly
Match: Nmdar1 (gene:FBgn0010399 transcript:FBtr0078763)

HSP 1 Score: 137.502 bits (345), Expect = 1.656e-32
Identity = 119/497 (23.94%), Postives = 234/497 (47.08%), Query Frame = 3
Query: 1383 RTRNWPEALMFKTFVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICYLIDATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGK---TPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNG--KLKLGTISGSGTDYHLR--MTQYPLYKYLLL--FQNSEDVLVALKEGRIDAFVYDFESLQFFKRIHFRENFE--TVGKPFGQLFYTVAFSKNLDSTGT--------ELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRK 2816
            + R  PE +M  T       HLR++T  E P V +R +   DE   +   R C L + +     E+CC G  ID++ +L+   +++ +  +S  G  +    I+  ++ ++T   R+ W        + LI  +    AD+ V + + I      Y   +KP+    I +L  +  R + +V+FL PF  ++WI + +++ VV++   + +  SP+G+   +    N+ +  + SSA+   W  L +      +P+ +S+R L  ++A F +I +ASYTA LAA++V +     + GI+D +++N    L   T+ GS  D + R  +    +Y+ +    +  +E  +  +K+G++ AF++D   L++       ++ E  T G+ FG+  Y +   K    T            + FM K+     F   ++Q  +L+ K           + + + ++N AG  I++ +G +     +++E I  K  V + ++
Sbjct:  406 KQRRKPEGIMIPT-------HLRLLTIEEKPFVYVRRMG-DDEFRCEPDERPCPLFNNSDATANEFCCRGYCIDLLIELSKRINFTYDLALSPDG--QFGHYILRNNTGAMT--LRKEW--------TGLIGELVNERADMIV-APLTINPERAEYIEFSKPFKYQGITILEKKPSRSSTLVSFLQPFSNTLWILVMVSVHVVALVLYLLDRFSPFGRFKLSHSDSNEEKALNLSSAVWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLERPKTKLSGINDARLRNTMENLTCATVKGSSVDMYFRRQVELSNMYRTMEANNYATAEQAIQDVKKGKLMAFIWDSSRLEY----EASKDCELVTAGELFGRSGYGIGLQKGSPWTDAVTLAILEFHESGFMEKLDKQWIFHGHVQQNCELFEK-----------TPNTLGLKNMAGVFILVGVGIAGGVGLIIIEVIYKKHQVKKQKR 866          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0091453)

HSP 1 Score: 127.487 bits (319), Expect = 1.744e-29
Identity = 129/535 (24.11%), Postives = 223/535 (41.68%), Query Frame = 3
Query: 1353 KVFQYQDAQMRTRNWPEALMFKTFVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIY---GRICYL---------IDATMKLRKE---YCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMW--IGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSR-----IFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKI-----QNGKLKLGTISGSGTDYHLRMTQYPLYKYLLLFQNSE--DVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
            K ++ Q   +R   WP           +K HL+I    E+P++   NLS  D  S K     G +C +         ID     R E    CC G  ID++   A    ++               E++ V+           W     G  + LI+ +     D+ + S ++I          ++P++ T I +++ +R  +    AFL PF  + W  +GI + IQ  +    ++EWLSP G   +   Q+       FS      L W+ LF       SP+ ++SRF+ N++A F V+FLA YTA LAA+M+ +       G++D+++          K GTI  S TD  +      ++ Y+  +  +   D + A+  G +D+F+YD   L +           TVG  +    Y +AFS+N     ++     +K +        +E+  + W          +  SSD + ++ F    ++++ G  L+   L+LE + +K+   R  K +    C  IS    + L
Sbjct:  293 KSWETQKLDIRDIAWPGNSHAPPQGVPEKFHLKITFLEEAPYI---NLSPADPVSGKCLMDRGVLCRVAADHEMAADIDVGQAHRNESFYQCCSGFCIDLLEKFAEELGFT--------------YELVRVEDGK--------WGTLENGKWNGLIADLVNRKTDMVLTS-LMINTEREAVVDFSEPFMETGIAIVVAKRTGIISPTAFLEPFDTASWMLVGI-VAIQAATFMIFLFEWLSPSGYDMKLYLQNTNVTPYRFSLFRTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTANLAAFMITREEFHEFSGLNDSRLVHPFSHKPSFKFGTIPYSHTDSTIHKYFNVMHNYMRQYNKTSVADGVAAVLNGNLDSFIYDGTVLDYLVAQDEDCRLMTVGSWYAMTGYGLAFSRN-----SKYVQMFNKRLLEFRANGDLERLRRYWMTGTCRPGKQEHKSSDPLALEQFLSAFLLLMAGILLAALLLLLEHVYFKYIRKRLAKKDGGHCCALISLSMGKSL 795          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0301842)

HSP 1 Score: 127.487 bits (319), Expect = 1.744e-29
Identity = 129/535 (24.11%), Postives = 223/535 (41.68%), Query Frame = 3
Query: 1353 KVFQYQDAQMRTRNWPEALMFKTFVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIY---GRICYL---------IDATMKLRKE---YCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMW--IGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSR-----IFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKI-----QNGKLKLGTISGSGTDYHLRMTQYPLYKYLLLFQNSE--DVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
            K ++ Q   +R   WP           +K HL+I    E+P++   NLS  D  S K     G +C +         ID     R E    CC G  ID++   A    ++               E++ V+           W     G  + LI+ +     D+ + S ++I          ++P++ T I +++ +R  +    AFL PF  + W  +GI + IQ  +    ++EWLSP G   +   Q+       FS      L W+ LF       SP+ ++SRF+ N++A F V+FLA YTA LAA+M+ +       G++D+++          K GTI  S TD  +      ++ Y+  +  +   D + A+  G +D+F+YD   L +           TVG  +    Y +AFS+N     ++     +K +        +E+  + W          +  SSD + ++ F    ++++ G  L+   L+LE + +K+   R  K +    C  IS    + L
Sbjct:  293 KSWETQKLDIRDIAWPGNSHAPPQGVPEKFHLKITFLEEAPYI---NLSPADPVSGKCLMDRGVLCRVAADHEMAADIDVGQAHRNESFYQCCSGFCIDLLEKFAEELGFT--------------YELVRVEDGK--------WGTLENGKWNGLIADLVNRKTDMVLTS-LMINTEREAVVDFSEPFMETGIAIVVAKRTGIISPTAFLEPFDTASWMLVGI-VAIQAATFMIFLFEWLSPSGYDMKLYLQNTNVTPYRFSLFRTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTANLAAFMITREEFHEFSGLNDSRLVHPFSHKPSFKFGTIPYSHTDSTIHKYFNVMHNYMRQYNKTSVADGVAAVLNGNLDSFIYDGTVLDYLVAQDEDCRLMTVGSWYAMTGYGLAFSRN-----SKYVQMFNKRLLEFRANGDLERLRRYWMTGTCRPGKQEHKSSDPLALEQFLSAFLLLMAGILLAALLLLLEHVYFKYIRKRLAKKDGGHCCALISLSMGKSL 795          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0091454)

HSP 1 Score: 127.487 bits (319), Expect = 1.744e-29
Identity = 129/535 (24.11%), Postives = 223/535 (41.68%), Query Frame = 3
Query: 1353 KVFQYQDAQMRTRNWPEALMFKTFVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIY---GRICYL---------IDATMKLRKE---YCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMW--IGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSR-----IFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKI-----QNGKLKLGTISGSGTDYHLRMTQYPLYKYLLLFQNSE--DVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
            K ++ Q   +R   WP           +K HL+I    E+P++   NLS  D  S K     G +C +         ID     R E    CC G  ID++   A    ++               E++ V+           W     G  + LI+ +     D+ + S ++I          ++P++ T I +++ +R  +    AFL PF  + W  +GI + IQ  +    ++EWLSP G   +   Q+       FS      L W+ LF       SP+ ++SRF+ N++A F V+FLA YTA LAA+M+ +       G++D+++          K GTI  S TD  +      ++ Y+  +  +   D + A+  G +D+F+YD   L +           TVG  +    Y +AFS+N     ++     +K +        +E+  + W          +  SSD + ++ F    ++++ G  L+   L+LE + +K+   R  K +    C  IS    + L
Sbjct:  293 KSWETQKLDIRDIAWPGNSHAPPQGVPEKFHLKITFLEEAPYI---NLSPADPVSGKCLMDRGVLCRVAADHEMAADIDVGQAHRNESFYQCCSGFCIDLLEKFAEELGFT--------------YELVRVEDGK--------WGTLENGKWNGLIADLVNRKTDMVLTS-LMINTEREAVVDFSEPFMETGIAIVVAKRTGIISPTAFLEPFDTASWMLVGI-VAIQAATFMIFLFEWLSPSGYDMKLYLQNTNVTPYRFSLFRTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTANLAAFMITREEFHEFSGLNDSRLVHPFSHKPSFKFGTIPYSHTDSTIHKYFNVMHNYMRQYNKTSVADGVAAVLNGNLDSFIYDGTVLDYLVAQDEDCRLMTVGSWYAMTGYGLAFSRN-----SKYVQMFNKRLLEFRANGDLERLRRYWMTGTCRPGKQEHKSSDPLALEQFLSAFLLLMAGILLAALLLLLEHVYFKYIRKRLAKKDGGHCCALISLSMGKSL 795          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0301844)

HSP 1 Score: 127.487 bits (319), Expect = 2.462e-29
Identity = 129/535 (24.11%), Postives = 223/535 (41.68%), Query Frame = 3
Query: 1353 KVFQYQDAQMRTRNWPEALMFKTFVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIY---GRICYL---------IDATMKLRKE---YCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMW--IGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSR-----IFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKI-----QNGKLKLGTISGSGTDYHLRMTQYPLYKYLLLFQNSE--DVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
            K ++ Q   +R   WP           +K HL+I    E+P++   NLS  D  S K     G +C +         ID     R E    CC G  ID++   A    ++               E++ V+           W     G  + LI+ +     D+ + S ++I          ++P++ T I +++ +R  +    AFL PF  + W  +GI + IQ  +    ++EWLSP G   +   Q+       FS      L W+ LF       SP+ ++SRF+ N++A F V+FLA YTA LAA+M+ +       G++D+++          K GTI  S TD  +      ++ Y+  +  +   D + A+  G +D+F+YD   L +           TVG  +    Y +AFS+N     ++     +K +        +E+  + W          +  SSD + ++ F    ++++ G  L+   L+LE + +K+   R  K +    C  IS    + L
Sbjct:  474 KSWETQKLDIRDIAWPGNSHAPPQGVPEKFHLKITFLEEAPYI---NLSPADPVSGKCLMDRGVLCRVAADHEMAADIDVGQAHRNESFYQCCSGFCIDLLEKFAEELGFT--------------YELVRVEDGK--------WGTLENGKWNGLIADLVNRKTDMVLTS-LMINTEREAVVDFSEPFMETGIAIVVAKRTGIISPTAFLEPFDTASWMLVGI-VAIQAATFMIFLFEWLSPSGYDMKLYLQNTNVTPYRFSLFRTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTANLAAFMITREEFHEFSGLNDSRLVHPFSHKPSFKFGTIPYSHTDSTIHKYFNVMHNYMRQYNKTSVADGVAAVLNGNLDSFIYDGTVLDYLVAQDEDCRLMTVGSWYAMTGYGLAFSRN-----SKYVQMFNKRLLEFRANGDLERLRRYWMTGTCRPGKQEHKSSDPLALEQFLSAFLLLMAGILLAALLLLLEHVYFKYIRKRLAKKDGGHCCALISLSMGKSL 976          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Zebrafish
Match: grin3ba (glutamate receptor, ionotropic, N-methyl-D-aspartate 3Ba [Source:ZFIN;Acc:ZDB-GENE-070912-354])

HSP 1 Score: 236.884 bits (603), Expect = 1.842e-63
Identity = 153/517 (29.59%), Postives = 258/517 (49.90%), Query Frame = 3
Query: 1413 FKTFVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICY-------------------LIDATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGKL--KLGTISGSGTDYHLRMTQYPLYKYLLLFQ--NSEDVLVALK--EGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMT-GIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRL--LFCD 2879
            ++  + V    LR+VT +E P V  R +  + +C +   G++C                       +++      CC+G  ID++  LA    +            E  L I+        D +   W+   GG  S L+  +    AD+AV S   I          T P+  T +G+L+  +D    I AF++P HWSMW+GIF+ + + ++  T+YEW SP+G TP GRN+ R+FS+SSAL LC++ LF  T  +K+PKCW+ RFLMN++A FC++ L+SYTA LAA MVG+ T + + GIHD K+ +  L  + GT+  S  + +++ +   +++Y+  F    + D +  LK    ++DAF+ D   L +   I       TVGKPF    Y +   +N   T   +++++S+   SD +   M+     W K +  G     +  + +M +Q+F+G  +++ +G + +   L+ E   ++F +P  R     +  L  SQ+ +R   + CD
Sbjct:  485 WQAGLPVAGSRLRVVTLVEHPFVFTREVDEEGQCPA---GQLCLDPQTNNSEVLNQLFRELEQTNSSSLPTDMRKCCYGYCIDLLEKLAEDMHF------------EFDLYIV-------GDGKYGAWK---GGRWSGLVGDLLSGVADMAVTS-FSINSARSRVIDFTSPFFSTSLGILVRSKDTAAPIGAFMWPLHWSMWVGIFVALHITALFITLYEWNSPFGMTPHGRNRIRVFSYSSALNLCYAILFGRTVASKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVGEKTFEEVSGIHDVKLHHPSLGFRFGTVRESSAEDYVKKSFPEMHEYMRRFNKPTTPDGVSTLKTDPPQLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLT-RNVSEYVSR-YKSDGY---MDMLHDKWYKVVPCGKRVFAVTETLQMGIQHFSGLFVLLCVGVAGALLTLLGEHAFFRFILPHLRHQQRFKYWLHTSQKIHRAINMGCD 970          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Zebrafish
Match: grin3bb (glutamate receptor, ionotropic, N-methyl-D-aspartate 3Bb [Source:ZFIN;Acc:ZDB-GENE-131122-77])

HSP 1 Score: 229.18 bits (583), Expect = 2.798e-62
Identity = 156/540 (28.89%), Postives = 263/540 (48.70%), Query Frame = 3
Query: 1335 GVYKFKKVFQYQDAQMRTRNWPEALMFKTFVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICYLIDATMK-------------------LRKEY--CCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGK--LKLGTISGSGTDYHLRMTQYPLYKYLLLFQ--NSEDVLVALK--EGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMT-GIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
            G+++     Q  + QM      E   ++    V    LR+VT +E P V  R +     C +   G+ C  +DA                      L  +Y  CC+G  ID++  L+   ++            E  L I+        D +   +    GG  + L+  +    AD+AV S   I          T P+  T +G+L+  +D    I AF++P HWSMW+GIF+ + + ++  T+YEW SP+G TP GRN+ ++FS+SSAL LC++ LF  T  +K+PKCW+ RFLMN++A FC++ L+SYTA LAA MVG+ T + + GIHD K+ +     + GT+  S  + +++ +   +++Y+  F    + D +  LK    ++DAF+ D   L +   I       TVGKPF    Y +   +N   T + +++F+S+   SD +   M+     W K +  G     +  + +M +++F+G  +++ +G + +   L  E   Y+  +P  R+    +  L  SQ+ +R L
Sbjct:  269 GLWQGSSPRQRTEGQMGR----EGRRWRAGFPVSGSRLRVVTLVEHPFVFTREVDEDGNCPA---GQYC--LDAGTNSSETLDHLYAERAQGNKSFLPPDYSKCCYGYCIDLLEKLSEDMNF------------EFDLYIV-------GDGK---YGAVKGGQWTGLVGDLLSGVADMAVTS-FSINSARSKVIDFTSPFFSTSLGILVRSKDTAAPIGAFMWPLHWSMWMGIFVALHITALFLTLYEWKSPFGMTPHGRNRVKVFSYSSALNLCYAILFGRTVSSKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVGEKTFEEVSGIHDAKLHHPSQGFRFGTVRESSAEDYMKKSFPEMHEYMRKFNEPTTPDGVATLKTDPPQLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLT-SNISEFVSR-YKSDGY---MDMLHDKWYKVVPCGKRVFAVTETLQMGIRHFSGLFVLLCVGVTGALLTLAGEHAFYRLVLPHIRRKQKFKYWLHTSQKIHRAL 771          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Zebrafish
Match: grin3bb (glutamate receptor, ionotropic, N-methyl-D-aspartate 3Bb [Source:ZFIN;Acc:ZDB-GENE-131122-77])

HSP 1 Score: 229.565 bits (584), Expect = 1.205e-61
Identity = 156/538 (29.00%), Postives = 261/538 (48.51%), Query Frame = 3
Query: 1335 GVYKFKKVFQYQDAQMRTRNWPEALMFKTFVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICYLIDATMK-------------------LRKEY--CCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGKLKLGTISGSGTDYHLRMTQYPLYKYLLLFQ--NSEDVLVALK--EGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMT-GIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
            G+++     Q  + QM      E   ++    V    LR+VT +E P V  R +     C +   G+ C  +DA                      L  +Y  CC+G  ID++  L+   ++            E  L I+        D +   +    GG  + L+  +    AD+AV S   I          T P+  T +G+L+  +D    I AF++P HWSMW+GIF+ + + ++  T+YEW SP+G TP GRN+ ++FS+SSAL LC++ LF  T  +K+PKCW+ RFLMN++A FC++ L+SYTA LAA MVG+ T + + GIHD K      + GT+  S  + +++ +   +++Y+  F    + D +  LK    ++DAF+ D   L +   I       TVGKPF    Y +   +N   T + +++F+S+   SD +   M+     W K +  G     +  + +M +++F+G  +++ +G + +   L  E   Y+  +P  R+    +  L  SQ+ +R L
Sbjct:  271 GLWQGSSPRQRTEGQMGR----EGRRWRAGFPVSGSRLRVVTLVEHPFVFTREVDEDGNCPA---GQYC--LDAGTNSSETLDHLYAERAQGNKSFLPPDYSKCCYGYCIDLLEKLSEDMNF------------EFDLYIV-------GDGK---YGAVKGGQWTGLVGDLLSGVADMAVTS-FSINSARSKVIDFTSPFFSTSLGILVRSKDTAAPIGAFMWPLHWSMWMGIFVALHITALFLTLYEWKSPFGMTPHGRNRVKVFSYSSALNLCYAILFGRTVSSKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVGEKTFEEVSGIHDAK----GFRFGTVRESSAEDYMKKSFPEMHEYMRKFNEPTTPDGVATLKTDPPQLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLT-SNISEFVSR-YKSDGY---MDMLHDKWYKVVPCGKRVFAVTETLQMGIRHFSGLFVLLCVGVTGALLTLAGEHAFYRLVLPHIRRKQKFKYWLHTSQKIHRAL 767          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Zebrafish
Match: grin3a (glutamate receptor, ionotropic, N-methyl-D-aspartate 3A [Source:ZFIN;Acc:ZDB-GENE-130530-780])

HSP 1 Score: 223.402 bits (568), Expect = 3.013e-59
Identity = 155/557 (27.83%), Postives = 263/557 (47.22%), Query Frame = 3
Query: 1284 NHIQGNIQNTL--QPMYI-FGVYKFKKV-FQYQDAQMRTRNWPEALMFKTFVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICY--------LIDA----------TMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGK--LKLGTISGSGTDYHLRMTQYPLYKYLLLFQ--NSEDVLVALKEG--RIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
            +H   N+Q+    +PM+   G +K  KV   Y     + R+ P A     +    ++HLR+VT +E P V  R++  +  C +   G++C         L+++          T+ L  + CC+G  ID++  LA    +                     D   + D +   ++    G  + L+  +    A +AV S   I          T P+  T +G+L+  RD    I AF++P HWSMW+GIF+++ V +V  T+YEW SP+G TPRGRN+ R+FSFSSAL +C++ LF  T   K PKCW+ RFLMN++A FC+  L++YTA LAA MVG+ T + + GIHD K+ +     + GT+  S  + +++ +   +++Y+  +    + D +  LK+   ++DAF+ D  S                  P       +      D     L+D   K++        + + +Q                   M +++F+G  +M+ +G +LS    + E IV+++ +PR +++   +  L  SQR +R L
Sbjct:  473 HHFIWNLQHDPIGKPMWTRLGSWKHGKVVMDYGVWPNKRRSQPGA----DWRHSSRLHLRVVTLVEHPFVFTRDVDDEGLCPA---GQLCLDPLTNDTALLESLFQGLQGANDTVPLEFKKCCYGYCIDLLEKLAEDMGFD-------------------FDLYIVGDGKYGAYK---NGRWTGLVGDLMSGAAHLAVTS-FSINSARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWSMWLGIFVSLHVTAVFLTLYEWKSPFGMTPRGRNRDRVFSFSSALNVCYAILFGRTAAIKPPKCWTGRFLMNLWAIFCLFCLSTYTANLAAVMVGEKTYEQLSGIHDPKLHHPSQGFRFGTVRESSAEDYVKKSFPEMHEYMRRYNAPTTPDGIDHLKDDPQKLDAFIMDKNS------------------PLTSNISELVSQYKSDGFMDMLHDKWYKVVPCGKRSFAVTETLQ-------------------MGIKHFSGLFVMLCVGVALSLLTTLGEHIVHRWVIPRMQESTEHKYWLHTSQRLHRAL 962          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Zebrafish
Match: grin3a (glutamate receptor, ionotropic, N-methyl-D-aspartate 3A [Source:ZFIN;Acc:ZDB-GENE-130530-780])

HSP 1 Score: 223.016 bits (567), Expect = 3.557e-59
Identity = 152/544 (27.94%), Postives = 257/544 (47.24%), Query Frame = 3
Query: 1317 QPMYI-FGVYKFKKV-FQYQDAQMRTRNWPEALMFKTFVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICY--------LIDA----------TMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGK--LKLGTISGSGTDYHLRMTQYPLYKYLLLFQ--NSEDVLVALKEG--RIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
            +PM+   G +K  KV   Y     + R+ P A     +    ++HLR+VT +E P V  R++  +  C +   G++C         L+++          T+ L  + CC+G  ID++  LA    +                     D   + D +   ++    G  + L+  +    A +AV S   I          T P+  T +G+L+  RD    I AF++P HWSMW+GIF+++ V +V  T+YEW SP+G TPRGRN+ R+FSFSSAL +C++ LF  T   K PKCW+ RFLMN++A FC+  L++YTA LAA MVG+ T + + GIHD K+ +     + GT+  S  + +++ +   +++Y+  +    + D +  LK+   ++DAF+ D  S                  P       +      D     L+D   K++        + + +Q                   M +++F+G  +M+ +G +LS    + E IV+++ +PR +++   +  L  SQR +R L
Sbjct:  476 KPMWTRLGSWKHGKVVMDYGVWPNKRRSQPGA----DWRHSSRLHLRVVTLVEHPFVFTRDVDDEGLCPA---GQLCLDPLTNDTALLESLFQGLQGANDTVPLEFKKCCYGYCIDLLEKLAEDMGFD-------------------FDLYIVGDGKYGAYK---NGRWTGLVGDLMSGAAHLAVTS-FSINSARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWSMWLGIFVSLHVTAVFLTLYEWKSPFGMTPRGRNRDRVFSFSSALNVCYAILFGRTAAIKPPKCWTGRFLMNLWAIFCLFCLSTYTANLAAVMVGEKTYEQLSGIHDPKLHHPSQGFRFGTVRESSAEDYVKKSFPEMHEYMRRYNAPTTPDGIDHLKDDPQKLDAFIMDKNS------------------PLTSNISELVSQYKSDGFMDMLHDKWYKVVPCGKRSFAVTETLQ-------------------MGIKHFSGLFVMLCVGVALSLLTTLGEHIVHRWVIPRMQESTEHKYWLHTSQRLHRAL 952          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Xenopus
Match: nup155 (nucleoporin 155kDa [Source:Xenbase;Acc:XB-GENE-973827])

HSP 1 Score: 247.284 bits (630), Expect = 8.682e-67
Identity = 156/520 (30.00%), Postives = 264/520 (50.77%), Query Frame = 3
Query: 1395 WP-EALMFKT-FVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICY--------LIDA----------TMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGS-QIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGK--LKLGTISGSGTDYHLRMTQYPLYKYLLLFQ---NSEDVLVALKEGR-IDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMT-GIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
            WP +A   K+ + Q  ++HLR+VT +E P V  RN+    +C +   G++C         ++D+          ++ +  + CC+G  ID++  LA   ++                     D   + D +   W+    GH + L+  +    A +AV S  I  A+  V     T P+  T +G+L+  +D    I AF++P HW+MW+GIF+++ + ++  T+YEW SP+G TP GRN+S++FSFSSAL +C++ LF  T   K+PKCW+ RFLMN++A FC+  L++YTA LAA MVG+   + + GIHD K+ +     + GT+  S  + +++ +   +++Y+  +     SE V     +   +DAF+ D   L +   I       TVGKPF    Y +    N     + L   +S+++S       M+     W K +  G     +  + +M + +F+G  +M+ +GF LS    + E IV++  +PR +K +  +  L  SQR +R L
Sbjct:  508 WPDQAQRHKSHYQQPARLHLRVVTLIEHPFVFTRNVDDDGQCPA---GQLCLDPMTNDSKVLDSLFESLQGGNDSVPIEFKKCCYGYCIDLLEKLAEDMNFD-------------------FDLYIVGDGKYGAWK---NGHWTGLVGDLLSGAAHLAVTSFSINTARSQV--IDFTSPFFSTSLGILVRTKDTAAPIGAFMWPLHWTMWLGIFVSLHITAIFLTLYEWKSPFGLTPNGRNRSKVFSFSSALNVCYAILFGRTAAIKTPKCWTGRFLMNLWAIFCLFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVKKSFPEMHEYMRRYNAPSTSEGVTFLKNDPEALDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPN-----SPLTSNISELVSQYKSSGFMDSLHDKWYKVVPCGKRSFAVTETLQMGITHFSGLFVMLCIGFGLSILTTIGEHIVFRLVLPRIKKKSKLKYWLHTSQRLHRAL 995          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Xenopus
Match: GRIN3B (glutamate receptor, ionotropic, N-methyl-D-aspartate 3B [Source:NCBI gene;Acc:100497172])

HSP 1 Score: 214.927 bits (546), Expect = 1.603e-56
Identity = 150/521 (28.79%), Postives = 253/521 (48.56%), Query Frame = 3
Query: 1377 QMRTRNWPEALMFKTFVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICY--------LID----------ATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGK--LKLGTISGSGTDYHLRMTQYPLYKYLLLFQ--NSEDVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMT-GIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
            Q R + W  A     F + K   LR+VT +E P V  R +     C +   G++C         ++D           ++ L  + CC+G  ID++  L      SE+ +           E+ +V        +   W        + L+  +    A +AV S   I          T P+  T +G+L+  RD  + I AF++P HWSMW+GIF+ + + ++  T YEW SP+G TP GRN+++IFS+SSAL LC++ LF  T  +K+PKC + R LMN++A FC++ L+SYTA LAA MVG  T + + GIHD K+ +     + GT+  S  + +++ +   ++ Y+  F    + D +       ++AF+ D   L +   I       T+GKPF    Y +   +N   T + +++F+S+  SS       ++    W K +  G     +  + +M + +F+G  +++ +GF  S    ++E +VY   +PR R+    +  L  SQ+ +R L
Sbjct:  403 QSRIQQWEPAP--GGFARTK---LRVVTLVEHPFVFTREVDADGSCPA---GQMCLDPRTNNSAVLDVLFEELNSPNGSVPLEYKTCCYGYCIDLLEKL------SEDLRFDF--------ELYIVGDGKYGARKGDRW--------TGLVGDLLSGAAHMAVTS-FSINSARSTVIDFTSPFYSTSLGILVRMRDTASPIGAFMWPLHWSMWVGIFVALHITALFLTFYEWKSPFGMTPHGRNRTKIFSYSSALNLCYAILFGRTVSSKTPKCCTGRVLMNLWAIFCLLVLSSYTANLAAVMVGDKTFEALSGIHDPKLHHPSQGFRFGTVWESSAEQYIKKSFPEMHNYMRKFSVPATSDGVHLTDPPTLNAFIMDKALLDYEVSIDSDCKLLTIGKPFAIEGYGIGLPQNSPLT-SNISEFISRYKSSGFMDTLHDK----WYKMVPCGKRVYAVTETLQMGIYHFSGLFVLLCIGFCGSLLTSLMERVVYHLILPRIRRRRRFKYWLHTSQKIHRAL 887          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Xenopus
Match: GRIN2A (glutamate receptor, ionotropic, N-methyl D-aspartate 2A [Source:NCBI gene;Acc:100489006])

HSP 1 Score: 155.221 bits (391), Expect = 1.762e-37
Identity = 125/479 (26.10%), Postives = 221/479 (46.14%), Query Frame = 3
Query: 1443 HLRIVTYLESPHVMIRNLSR------KDECSSKIYGRICYLIDATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVS-VATTVYEWLSPYG--------KTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQ-----NGKLKLGTISGSGTDYHLRMTQYPLYKYLLLFQNS--EDVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWS--SDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVY---KFC 2798
            HL IVT  E+P V++ N+        ++    + Y R+         ++K  CC G  IDI+  L+    ++               ++ +V +       +  W          +I  +    A +AVGS + I +        + P++ T I +++ R +      AFL PF  S+W+ +F+ + +VS VA  V+E+ SP G        K P G +    F+   A+ L W  +F+++ P ++PK  +S+ +++I+A F VIFLASYTA LAA+M+ +  +  + G+ D K Q     +   + GT+    T+ ++R     +++Y++ F     +D LV+LK G++DAF+YD   L +           T+G   G +F T  +   L   G+     +   +        ME+  +LW   +TGI H++     S ++ + N AG   M+    +LS    V E + Y   ++C
Sbjct:  265 HLSIVTLEEAPFVIVENVDYLTGTCVRNTVPCRKYFRLNNSTTEGTSVKK--CCKGFCIDILKKLSKTVKFT--------------YDLYLVTNGKHGKKIKNVWNG--------MIGEVVYKRAVMAVGS-LTINEERSEAVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLLVSAVAVFVFEYFSPVGYNRNLADGKAPHGPS----FTIGKAVWLLWGLVFNNSVPVQNPKGTTSKIIVSIWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPDMHQYMVKFHQKGVQDALVSLKTGKLDAFIYDAAVLNYMAGRDEGCKLVTIGS--GYIFATTGYGIAL-QKGSRWKRPIDLALLQFVGDGEMEELEKLW---LTGICHTEKNEVMSSQLDIDNMAGVFYMLAAAMALSLITFVWEHLFYWKLRYC 708          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Xenopus
Match: GRIN2B (glutamate receptor, ionotropic, N-methyl D-aspartate 2B [Source:NCBI gene;Acc:100490580])

HSP 1 Score: 154.836 bits (390), Expect = 2.223e-37
Identity = 130/514 (25.29%), Postives = 235/514 (45.72%), Query Frame = 3
Query: 1344 KFKKVFQYQDAQMRTRN--WPEALMFKTFVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICYLIDATMKLRK----------EYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVS-VATTVYEWLSPYG--------KTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQ-----NGKLKLGTISGSGTDYHLRMTQYPLYKYLLLF--QNSEDVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETV--GKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWS--SDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVY 2789
            K+++V +Y+D  ++ +   WP   ++    + K  HL IVT  E+P V++ ++   D  S          +  T+  RK          + CC G  IDI+  +A    ++               ++ +V +          W          +I  +    A +AVGS + I +        + P++ T I +++ R +      AFL PF   +W+ +F+ + +VS VA  V+E+ SP G        + P G +    F+   A+ L W  +F+++ P ++PK  +S+ +++++A F VIFLASYTA LAA+M+ +  +  + G+ D K Q     +   + GT+    T+ ++R     ++ Y++ F  ++ +D L++LK G++DAF+YD   L +           T+  GK F    Y +A  K  DS      D     +  D     ME+   LW   +TGI H++     S ++ + N AG   M+    +LS    ++E + +
Sbjct:  367 KWERVGKYKDRSLKMKYYVWPVFELYPNSEEHKDEHLSIVTLEEAPFVIVEDV---DPLSGT-------CMRNTVPCRKNRTEEGGNYIKRCCKGFCIDILKKIAKTVKFT--------------YDLYLVTNGKHGKKINGTWNG--------MIGEVVTKRAYMAVGS-LTINEERSEVVDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPS----FTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYVDQVSGLSDKKFQRPNDFSPAFRFGTVPNGSTERNIRNNYLEMHSYMVKFNQRSVQDALLSLKTGKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGKVFATTGYGIAIQK--DSGWKRQVDLAILQLFGDG---EMEELEALW---LTGICHNEKNEVMSSQLDIDNMAGVFYMLAAAMALSLITFIMEHLFF 835          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Xenopus
Match: GRIN2B (glutamate receptor, ionotropic, N-methyl D-aspartate 2B [Source:NCBI gene;Acc:100490580])

HSP 1 Score: 154.451 bits (389), Expect = 2.803e-37
Identity = 131/514 (25.49%), Postives = 236/514 (45.91%), Query Frame = 3
Query: 1344 KFKKVFQYQDAQMRTRN--WPEALMFKTFVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICYLIDATMKLRK----------EYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVS-VATTVYEWLSPYG--------KTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQ-----NGKLKLGTISGSGTDYHLRMTQYPLYKYLLLF--QNSEDVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETV--GKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWS--SDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVY 2789
            K+++V +Y+D  ++ +   WP   ++    + K  HL IVT  E+P V++ ++   D  S       C  +  T+  RK          + CC G  IDI+  +A    ++               ++ +V +          W          +I  +    A +AVGS + I +        + P++ T I +++ R +      AFL PF   +W+ +F+ + +VS VA  V+E+ SP G        + P G +    F+   A+ L W  +F+++ P ++PK  +S+ +++++A F VIFLASYTA LAA+M+ +  +  + G+ D K Q     +   + GT+    T+ ++R     ++ Y++ F  ++ +D L++LK G++DAF+YD   L +           T+  GK F    Y +A  K  DS      D     +  D     ME+   LW   +TGI H++     S ++ + N AG   M+    +LS    ++E + +
Sbjct:  367 KWERVGKYKDRSLKMKYYVWPVFELYPNSEEHKDEHLSIVTLEEAPFVIVEDV---DPLSG-----TC--MRNTVPCRKNRTEEGGNYIKRCCKGFCIDILKKIAKTVKFT--------------YDLYLVTNGKHGKKINGTWNG--------MIGEVVTKRAYMAVGS-LTINEERSEVVDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPS----FTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYVDQVSGLSDKKFQRPNDFSPAFRFGTVPNGSTERNIRNNYLEMHSYMVKFNQRSVQDALLSLKTGKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGKVFATTGYGIAIQK--DSGWKRQVDLAILQLFGDG---EMEELEALW---LTGICHNEKNEVMSSQLDIDNMAGVFYMLAAAMALSLITFIMEHLFF 835          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Mouse
Match: Grin3a (glutamate receptor ionotropic, NMDA3A [Source:MGI Symbol;Acc:MGI:1933206])

HSP 1 Score: 256.144 bits (653), Expect = 7.576e-70
Identity = 166/549 (30.24%), Postives = 277/549 (50.46%), Query Frame = 3
Query: 1395 WPE-ALMFKT-FVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICY--------LIDA----------TMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGS-QIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGK--LKLGTISGSGTDYHLRMTQYPLYKYLLLFQ--NSEDVLVALKEG--RIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMT-GIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLLFCDLYYSKSSWSERHKFMKQDGLIGERLI 2957
            WPE A   KT F    K+HLR+VT +E P V  R +  +  C +   G++C         ++D+          T+ ++ + CC+G  ID++  LA   ++                     D   + D +   W+    GH + L+  +    A++AV S  I  A+  V     T P+  T +G+L+  RD    I AF++P HW+MW+GIF+ + + ++  T+YEW SP+G TP+GRN++++FSFSSAL +C++ LF  T   K PKCW+ RFLMN++A FC+  L++YTA LAA MVG+   + + GIHD K+ +     + GT+  S  + ++R +   +++Y+  +    + D +  LK    ++DAF+ D   L +   I       TVGKPF    Y +    N     + L   +S++IS       M+     W K +  G     +  + +M +++F+G  +++ +GF LS    + E IVY+  +PR +  +  Q  L  SQRF+R L       K   S+  +  K+  +  ++L+
Sbjct:  496 WPEQAQRHKTHFHHPNKLHLRVVTLIEHPFVFTREVDDEGLCPA---GQLCLDPMTNDSSILDSLFSSLHSSNDTVPIKFKKCCYGYCIDLLEQLAEDMNFD-------------------FDLYIVGDGKYGAWK---NGHWTGLVGDLLSGTANMAVTSFSINTARSQV--IDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAIFLTLYEWKSPFGMTPKGRNRNKVFSFSSALNVCYALLFGRTAAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVQYLKNDPEKLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPN-----SPLTSNISELISQYKSHGFMDVLHDKWYKVVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLLPRIKNKSKLQYWLHTSQRFHRALNTSFVEEKQPCSKTKRVEKRSNMGPQQLM 1012          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Mouse
Match: Grin3a (glutamate receptor ionotropic, NMDA3A [Source:MGI Symbol;Acc:MGI:1933206])

HSP 1 Score: 254.218 bits (648), Expect = 3.480e-69
Identity = 162/520 (31.15%), Postives = 266/520 (51.15%), Query Frame = 3
Query: 1395 WPE-ALMFKT-FVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICY--------LIDA----------TMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGS-QIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGK--LKLGTISGSGTDYHLRMTQYPLYKYLLLFQ--NSEDVLVALKEG--RIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMT-GIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
            WPE A   KT F    K+HLR+VT +E P V  R +  +  C +   G++C         ++D+          T+ ++ + CC+G  ID++  LA   ++                     D   + D +   W+    GH + L+  +    A++AV S  I  A+  V     T P+  T +G+L+  RD    I AF++P HW+MW+GIF+ + + ++  T+YEW SP+G TP+GRN++++FSFSSAL +C++ LF  T   K PKCW+ RFLMN++A FC+  L++YTA LAA MVG+   + + GIHD K+ +     + GT+  S  + ++R +   +++Y+  +    + D +  LK    ++DAF+ D   L +   I       TVGKPF    Y +    N     + L   +S++IS       M+     W K +  G     +  + +M +++F+G  +++ +GF LS    + E IVY+  +PR +  +  Q  L  SQRF+R L
Sbjct:  496 WPEQAQRHKTHFHHPNKLHLRVVTLIEHPFVFTREVDDEGLCPA---GQLCLDPMTNDSSILDSLFSSLHSSNDTVPIKFKKCCYGYCIDLLEQLAEDMNFD-------------------FDLYIVGDGKYGAWK---NGHWTGLVGDLLSGTANMAVTSFSINTARSQV--IDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAIFLTLYEWKSPFGMTPKGRNRNKVFSFSSALNVCYALLFGRTAAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVQYLKNDPEKLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPN-----SPLTSNISELISQYKSHGFMDVLHDKWYKVVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLLPRIKNKSKLQYWLHTSQRFHRAL 983          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Mouse
Match: Grin3b (glutamate receptor, ionotropic, NMDA3B [Source:MGI Symbol;Acc:MGI:2150393])

HSP 1 Score: 221.476 bits (563), Expect = 1.108e-61
Identity = 148/537 (27.56%), Postives = 253/537 (47.11%), Query Frame = 3
Query: 1332 FGVYKFKKVFQYQDAQMRTRNWPEALMFKTFVQVK-KIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICY----------------LIDATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGK--LKLGTISGSGTDYHLRMTQYPLYKYLLLFQNSED----VLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMT-GIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
             G   +  V  +QD Q+  +    AL   +    + +  LR+VT +E P V  R      +C +   G++C                 L + ++      CC+G  ID++  LA   ++                E+ +V        +   W        + L+  +    A +AV S   I          T P+  T +G+++  RD  + I AF++P HWSMW+G+F  + + ++  T+YEW SPYG TPRGRN+  +FS+SSAL LC++ LF  T  +K+PKC + RFLMN++A FC++ L+SYTA LAA MVG  T + + GIHD K+ +     + GT+  S  + +++ +   ++ ++             ++     +++AF+ D   L +   I       TVGKPF    Y +   +N   T + L++F+S+  SS    +  ++    W K +  G     +  + +M V + +G  +++ LG   +    + E + Y+  +PR R+ N  Q  L  SQ+ +R L
Sbjct:   20 LGAPAWATVGSWQDGQLDFQPGAAALRVPSPSGTQARPKLRVVTLVEHPFVFTRESDEDGQCPA---GQLCLDPGTNDSARLDALFTALENGSVPRTLRRCCYGYCIDLLERLAEDLAFD--------------FELYIVGDGKYGALRDGRW--------TGLVGDLLAGRAHMAVTS-FSINSARSQVVDFTSPFFSTSLGIMVRTRDTASPIGAFMWPLHWSMWVGVFAALHLTALFLTLYEWRSPYGLTPRGRNRGTVFSYSSALNLCYAILFGRTVSSKTPKCPTGRFLMNLWAIFCLLVLSSYTANLAAVMVGDKTFEELSGIHDPKLHHPSQGFRFGTVWESSAEAYIKASFPEMHAHMRRHSAPTTPHGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLT-SNLSEFISRYKSSGFIDLLHDK----WYKMVPCGKRVFAVTETLQMGVYHLSGLFVLLCLGLGSALLTSLGEHVFYRLVLPRIRRGNKLQYWLHTSQKIHRAL 525          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Mouse
Match: Grin3b (glutamate receptor, ionotropic, NMDA3B [Source:MGI Symbol;Acc:MGI:2150393])

HSP 1 Score: 221.09 bits (562), Expect = 1.148e-58
Identity = 148/537 (27.56%), Postives = 253/537 (47.11%), Query Frame = 3
Query: 1332 FGVYKFKKVFQYQDAQMRTRNWPEALMFKTFVQVK-KIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICY----------------LIDATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGK--LKLGTISGSGTDYHLRMTQYPLYKYLLLFQNSED----VLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMT-GIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
             G   +  V  +QD Q+  +    AL   +    + +  LR+VT +E P V  R      +C +   G++C                 L + ++      CC+G  ID++  LA   ++                E+ +V        +   W        + L+  +    A +AV S   I          T P+  T +G+++  RD  + I AF++P HWSMW+G+F  + + ++  T+YEW SPYG TPRGRN+  +FS+SSAL LC++ LF  T  +K+PKC + RFLMN++A FC++ L+SYTA LAA MVG  T + + GIHD K+ +     + GT+  S  + +++ +   ++ ++             ++     +++AF+ D   L +   I       TVGKPF    Y +   +N   T + L++F+S+  SS    +  ++    W K +  G     +  + +M V + +G  +++ LG   +    + E + Y+  +PR R+ N  Q  L  SQ+ +R L
Sbjct:  378 LGAPAWATVGSWQDGQLDFQPGAAALRVPSPSGTQARPKLRVVTLVEHPFVFTRESDEDGQCPA---GQLCLDPGTNDSARLDALFTALENGSVPRTLRRCCYGYCIDLLERLAEDLAFD--------------FELYIVGDGKYGALRDGRW--------TGLVGDLLAGRAHMAVTS-FSINSARSQVVDFTSPFFSTSLGIMVRTRDTASPIGAFMWPLHWSMWVGVFAALHLTALFLTLYEWRSPYGLTPRGRNRGTVFSYSSALNLCYAILFGRTVSSKTPKCPTGRFLMNLWAIFCLLVLSSYTANLAAVMVGDKTFEELSGIHDPKLHHPSQGFRFGTVWESSAEAYIKASFPEMHAHMRRHSAPTTPHGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLT-SNLSEFISRYKSSGFIDLLHDK----WYKMVPCGKRVFAVTETLQMGVYHLSGLFVLLCLGLGSALLTSLGEHVFYRLVLPRIRRGNKLQYWLHTSQKIHRAL 883          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Mouse
Match: Grin2a (glutamate receptor, ionotropic, NMDA2A (epsilon 1) [Source:MGI Symbol;Acc:MGI:95820])

HSP 1 Score: 155.992 bits (393), Expect = 7.697e-38
Identity = 132/517 (25.53%), Postives = 243/517 (47.00%), Query Frame = 3
Query: 1344 KFKKVFQYQDAQMRTRN--WPEALMFKTF--VQVKKIHLRIVTYLESPHVMIRNLSR------KDECSSKIYGRICYLIDATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVS-VATTVYEWLSPYG--------KTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQ-----NGKLKLGTISGSGTDYHLRMTQYP-LYKYLLLF--QNSEDVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWS--SDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVY---KFC 2798
            +++KV ++++  +  R+  WP    +K+F   +    HL IVT  E+P V++ ++        ++    + + +I    +  M ++K  CC G  IDI+  L+    ++               ++ +V +          W        + +I  +    A +AVGS + I +        + P++ T I +++ R +      AFL PF  S+W+ +F+ + +VS +A  V+E+ SP G        K P G +    F+   A+ L W  +F+++ P ++PK  +S+ +++++A F VIFLASYTA LAA+M+ +  +  + G+ D K Q     +   + GT+    T+ ++R   YP +++Y+  F  +  ED LV+LK G++DAF+YD   L +           T+G   G +F T  +   L   G+     +   +        ME+   LW   +TGI H++     S ++ + N AG   M+    +LS    + E + Y   +FC
Sbjct:  371 EWEKVGKWENQTLSLRHAVWPR---YKSFSDCEPDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKK--CCKGFCIDILKKLSRTVKFT--------------YDLYLVTNGKHGKKVNNVW--------NGMIGEVVYQRAVMAVGS-LTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPS----FTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIR-NNYPYMHQYMTKFNQRGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGS--GYIFATTGYGIAL-QKGSPWKRQIDLALLQFVGDGEMEELETLW---LTGICHNEKNEVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHLFYWKLRFC 848          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. UniProt/SwissProt
Match: sp|Q8TCU5|NMD3A_HUMAN (Glutamate receptor ionotropic, NMDA 3A OS=Homo sapiens OX=9606 GN=GRIN3A PE=1 SV=2)

HSP 1 Score: 252.677 bits (644), Expect = 7.081e-68
Identity = 160/520 (30.77%), Postives = 263/520 (50.58%), Query Frame = 3
Query: 1395 WPE-ALMFKT-FVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRIC------------------YLIDATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGS-QIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGK--LKLGTISGSGTDYHLRMTQYPLYKYLLLF--QNSEDVLVALKEG--RIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMT-GIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
            WPE A   KT F    K+HLR+VT +E P V  R +  +  C +   G++C                  +  + T+ ++ + CC+G  ID++  +A   ++                     D   + D +   W+    GH + L+  + R  A +AV S  I  A+  V     T P+  T +G+L+  RD    I AF++P HW+MW+GIF+ + + +V  T+YEW SP+G TP+GRN+S++FSFSSAL +C++ LF  T   K PKCW+ RFLMN++A FC+  L++YTA LAA MVG+   + + GIHD K+ +     + GT+  S  + ++R +   +++Y+  +    + D +  LK    ++DAF+ D   L +   I       TVGKPF    Y +    N     + L   +S++IS       M+     W + +  G     +  + +M +++F+G  +++ +GF LS    + E IVY+  +PR +  +  Q  L  SQR +R +
Sbjct:  496 WPEQAQRHKTHFQHPSKLHLRVVTLIEHPFVFTREVDDEGLCPA---GQLCLDPMTNDSSTLDSLFSSLHSSNDTVPIKFKKCCYGYCIDLLEKIAEDMNFD-------------------FDLYIVGDGKYGAWK---NGHWTGLVGDLLRGTAHMAVTSFSINTARSQV--IDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAVFLTLYEWKSPFGLTPKGRNRSKVFSFSSALNICYALLFGRTVAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVEYLKNDPEKLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPN-----SPLTANISELISQYKSHGFMDMLHDKWYRVVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLLPRIKNKSKLQYWLHTSQRLHRAI 983          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. UniProt/SwissProt
Match: sp|Q9R1M7|NMD3A_RAT (Glutamate receptor ionotropic, NMDA 3A OS=Rattus norvegicus OX=10116 GN=Grin3a PE=1 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 1.113e-67
Identity = 161/520 (30.96%), Postives = 265/520 (50.96%), Query Frame = 3
Query: 1395 WPE-ALMFKT-FVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICY--------LIDA----------TMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGS-QIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGK--LKLGTISGSGTDYHLRMTQYPLYKYLLLFQ--NSEDVLVALKEG--RIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMT-GIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
            WPE A   KT F    K+HLR+VT +E P V  R +  +  C +   G++C         ++D           T+ ++ + CC+G  ID++  LA   ++                     D   + D +   W+    GH + L+  +    A++AV S  I  A+  V     T P+  T +G+L+  RD    I AF++P HW+MW+GIF+ + + ++  T+YEW SP+G TP+GRN++++FSFSSAL +C++ LF  T   K PKCW+ RFLMN++A FC+  L++YTA LAA MVG+   + + GIHD K+ +     + GT+  S  + ++R +   +++Y+  +    + D +  LK    ++DAF+ D   L +   I       TVGKPF    Y +    N     + L   +S++IS       M+     W K +  G     +  + +M +++F+G  +++ +GF LS    + E IV++  +PR +  +  Q  L  SQRF+R L
Sbjct:  496 WPEQAQRHKTHFQHPNKLHLRVVTLIEHPFVFTREVDDEGLCPA---GQLCLDPMTNDSSMLDRLFSSLHSSNDTVPIKFKKCCYGYCIDLLEQLAEDMNFD-------------------FDLYIVGDGKYGAWK---NGHWTGLVGDLLSGTANMAVTSFSINTARSQV--IDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAIFLTLYEWKSPFGMTPKGRNRNKVFSFSSALNVCYALLFGRTAAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVQYLKNDPEKLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPN-----SPLTSNISELISQYKSHGFMDVLHDKWYKVVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVHRLLLPRIKNKSKLQYWLHTSQRFHRAL 983          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. UniProt/SwissProt
Match: sp|Q8VHN2|NMD3B_RAT (Glutamate receptor ionotropic, NMDA 3B OS=Rattus norvegicus OX=10116 GN=Grin3b PE=1 SV=2)

HSP 1 Score: 226.483 bits (576), Expect = 1.250e-59
Identity = 151/557 (27.11%), Postives = 262/557 (47.04%), Query Frame = 3
Query: 1332 FGVYKFKKVFQYQDAQMRTRNWPEALMFKTFVQVK-KIHLRIVTYLESPHVMIRNLSRKDEC-------------SSKIYGRICYLIDATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGK--LKLGTISGSGTDYHLRMTQYPLYKYLLLFQNSED----VLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMT-GIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLLFCDLYYSKSSWSERHKFMKQDGL 2939
             G   +  V  +QD Q+  +    AL   +    + +  LR+VT +E P V  R      +C             S+++      L++ ++      CC+G  ID++  LA   ++                E+ +V        +   W        + L+  +    A +AV S   I          T P+  T +G+++  RD  + I AF++P HWSMW+G+F  + + ++  T+YEW SPYG TPRGRN+  +FS+SSAL LC++ LF  T  +K+PKC + RFLMN++A FC++ L+SYTA LAA MVG  T + + GIHD K+ +     + GT+  S  + +++ +   ++ ++             ++     +++AF+ D   L +   I       TVGKPF    Y +   +N   T + L++F+S+  SS    +  ++    W K +  G     +  + +M V +F+G  +++ LG   +    + E + Y+  +PR R+ N  Q  L  SQ+ +R L       +   +E+ +   +D L
Sbjct:  378 LGAPAWATVGSWQDGQLDFQPGAAALRVPSPSGTQARPKLRVVTLVEHPFVFTRESDEDGQCPAGQLCLDPGTNDSARLDALFAALVNGSVPRTLRRCCYGYCIDLLERLAEDLAFD--------------FELYIVGDGKYGALRDGRW--------TGLVGDLLAGRAHMAVTS-FSINSARSQVVDFTSPFFSTSLGIMVRTRDTASPIGAFMWPLHWSMWVGVFAALHLTALFLTLYEWRSPYGLTPRGRNRGTVFSYSSALNLCYAILFGRTVSSKTPKCPTGRFLMNLWAIFCLLVLSSYTANLAAVMVGDKTFEELSGIHDPKLHHPSQGFRFGTVWESSAEAYIKASFPEMHAHMRRHSAPTTPHGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLT-SNLSEFISRYKSSGFIDLLHDK----WYKMVPCGKRVFAVTETLQMGVYHFSGLFVLLCLGLGSALLTSLGEHVFYRLVLPRIRRGNKLQYWLHTSQKIHRALNTGPPEGQQERAEQERSGPKDEL 906          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. UniProt/SwissProt
Match: sp|Q91ZU9|NMD3B_MOUSE (Glutamate receptor ionotropic, NMDA 3B OS=Mus musculus OX=10090 GN=Grin3b PE=1 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 8.030e-58
Identity = 148/537 (27.56%), Postives = 253/537 (47.11%), Query Frame = 3
Query: 1332 FGVYKFKKVFQYQDAQMRTRNWPEALMFKTFVQVK-KIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICY----------------LIDATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGK--LKLGTISGSGTDYHLRMTQYPLYKYLLLFQNSED----VLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMT-GIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
             G   +  V  +QD Q+  +    AL   +    + +  LR+VT +E P V  R      +C +   G++C                 L + ++      CC+G  ID++  LA   ++                E+ +V        +   W        + L+  +    A +AV S   I          T P+  T +G+++  RD  + I AF++P HWSMW+G+F  + + ++  T+YEW SPYG TPRGRN+  +FS+SSAL LC++ LF  T  +K+PKC + RFLMN++A FC++ L+SYTA LAA MVG  T + + GIHD K+ +     + GT+  S  + +++ +   ++ ++             ++     +++AF+ D   L +   I       TVGKPF    Y +   +N   T + L++F+S+  SS    +  ++    W K +  G     +  + +M V + +G  +++ LG   +    + E + Y+  +PR R+ N  Q  L  SQ+ +R L
Sbjct:  378 LGAPAWATVGSWQDGQLDFQPGAAALRVPSPSGTQARPKLRVVTLVEHPFVFTRESDEDGQCPA---GQLCLDPGTNDSARLDALFTALENGSVPRTLRRCCYGYCIDLLERLAEDLAFD--------------FELYIVGDGKYGALRDGRW--------TGLVGDLLAGRAHMAVTS-FSINSARSQVVDFTSPFFSTSLGIMVRTRDTASPIGAFMWPLHWSMWVGVFAALHLTALFLTLYEWRSPYGLTPRGRNRGTVFSYSSALNLCYAILFGRTVSSKTPKCPTGRFLMNLWAIFCLLVLSSYTANLAAVMVGDKTFEELSGIHDPKLHHPSQGFRFGTVWESSAEAYIKASFPEMHAHMRRHSAPTTPHGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLT-SNLSEFISRYKSSGFIDLLHDK----WYKMVPCGKRVFAVTETLQMGVYHLSGLFVLLCLGLGSALLTSLGEHVFYRLVLPRIRRGNKLQYWLHTSQKIHRAL 883          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. UniProt/SwissProt
Match: sp|O60391|NMD3B_HUMAN (Glutamate receptor ionotropic, NMDA 3B OS=Homo sapiens OX=9606 GN=GRIN3B PE=2 SV=2)

HSP 1 Score: 215.698 bits (548), Expect = 5.000e-56
Identity = 147/500 (29.40%), Postives = 246/500 (49.20%), Query Frame = 3
Query: 1446 LRIVTYLESPHVMIRNLSRKDECSSKIYGRICY--------LIDA----------TMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGK--LKLGTISGSGTDYHLRMTQYPLYKYLLLFQNSED----VLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMT-GIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
            LR+VT LE P V  R+     +C +   G++C          +DA             LRK  CC+G  ID++  LA    +  + ++ L+G  +           ++ D +  G           L+  +    A +AV S   I          T P+  T +G+++  RD  + I AF++P HWS W+G+F  + + ++  TVYEW SPYG TPRGRN+S +FS+SSAL LC++ LF  T  +K+PKC + R LMN++A FC++ L+SYTA LAA MVG  T + + GIHD K+ +     + GT+  S  + +++ +   ++ ++             ++     +++AF+ D   L +   I       TVGKPF    Y +   +N   T + L++F+S+  SS    +  ++    W K +  G     +  + +M + +FAG  +++ LG   +  + + E   ++  +PR RK +  Q  L  SQ+ +R L
Sbjct:  417 LRVVTLLEHPFVFARDPDEDGQCPA---GQLCLDPGTNDSATLDALFAALANGSAPRALRK--CCYGYCIDLLERLAEDTPF--DFELYLVGDGKY---------GALRDGRWTG-----------LVGDLLAGRAHMAVTS-FSINSARSQVVDFTSPFFSTSLGIMVRARDTASPIGAFMWPLHWSTWLGVFAALHLTALFLTVYEWRSPYGLTPRGRNRSTVFSYSSALNLCYAILFRRTVSSKTPKCPTGRLLMNLWAIFCLLVLSSYTANLAAVMVGDKTFEELSGIHDPKLHHPAQGFRFGTVWESSAEAYIKKSFPDMHAHMRRHSAPTTPRGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLT-SNLSEFISRYKSSGFIDLLHDK----WYKMVPCGKRVFAVTETLQMSIYHFAGLFVLLCLGLGSALLSSLGEHAFFRLALPRIRKGSRLQYWLHTSQKIHRAL 883          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. TrEMBL
Match: A0A1I8GVV7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 7.073e-87
Identity = 174/483 (36.02%), Postives = 270/483 (55.90%), Query Frame = 3
Query: 1425 VQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKI-----YGRICYL--IDATMKLRKEYCCFGIAIDIV------------NDLASLNSYSENN---KVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGI---VAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGKLKLGTISGSGTDYHLRMTQYPLYKYLLLFQNSEDVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFC 2798
            V  + + L I+   E P + ++  SR    S        +GR+C+L   + T+  R   CCFGI ID +              + S  S S+     K     IS   L +   D+  I       W   S    + ++  +    +++A+GS+++ +K   +  L+T PYL T + +++ + ++++G    + FLYPF  + W+ IF T+Q+ +VA  +YEW+SP+G+TPRGRN+ R+F F SALTL WS LFSHT  TKSPKCWSSRFL+N+YA FC++F+ASYTA LAA+MV  +   +I+GI D +IQ G + LGT++GSGT+  L  T   L K++  F  +++ + AL  G I AF+Y+ E L +  + +   + E VGKPFG++ Y  A S  L + G EL   ++ ++S+++F  +M Q+I LW+K + G +        R+   NFAGP  ++L      FC  VL  +V   C
Sbjct:  540 VDHRNLDLEILLNEEDPLLRVKEFSRDSANSDDFSWECKHGRLCHLEHRNGTLDARPR-CCFGIVIDFLFLSVEFPLMLQCEKILSQESLSQQRTACKEMPNNISTRKLRVFAKDACRIGRRAHPRWPNSSVATTNCMMEGLRSGRSNMAIGSKVISSKDWRDEFLVTDPYLETSVSIVVNKTEKLSGRATRLGFLYPFDATTWLCIFATVQLAAVAAAIYEWMSPFGQTPRGRNRDRVFGFPSALTLTWSVLFSHTVQTKSPKCWSSRFLLNVYAVFCLVFIASYTANLAAFMVDDSESSDIVGIQDARIQRGDILLGTVAGSGTEVELNRTHPNLLKFMKFFVTADEAIAALSRGEIGAFLYETELLSYLLKTNQMTSIEIVGKPFGRVGYIAAISPLLLTPGRELAAALTSLLSTNDFTDQMRQKIDLWSKIVPGKEPRSQGKKIRLTPTNFAGPGPLLL------FCCGVLLGLVTMCC 1015          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. TrEMBL
Match: G3TUX4 (Glutamate ionotropic receptor NMDA type subunit 3A OS=Loxodonta africana OX=9785 GN=GRIN3A PE=3 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 1.329e-67
Identity = 161/520 (30.96%), Postives = 266/520 (51.15%), Query Frame = 3
Query: 1395 WPE-ALMFKTFVQ-VKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRIC--------YLIDA----------TMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGS-QIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGK--LKLGTISGSGTDYHLRMTQYPLYKYLLLFQ--NSEDVLVALKEG--RIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMT-GIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
            WPE A   KT +Q   K+HLR+VT +E P V  R +  +  C +   G++C        +++D+          T+  R + CC+G  ID++  LA   ++                     D   + D +   W+    GH + L+  +    A +AV S  I  A+  V     T P+  T +G+L+  RD    I AF++P HW+MW+GIF+ + + ++  T+YEW SP+G TP+GRN+S++FSFSSAL +C++ LF  T   K PKCW+ RFLMN++A FC+  L++YTA LAA MVG+   + + GIHD K+ +     + GT+  S  + ++R +   +++Y+  +    +   +  LK    ++DAF+ D   L +   I       TVGKPF    Y +    N   T + ++D +S+  S     V  ++    W K +  G     +  + +M +++F+G  +++ +GF LS    + E IVY+  +PR +  +  +  L  SQR +R L
Sbjct:  147 WPEQAKRHKTHLQHPSKLHLRVVTLIEHPFVFTREVDDEGLCPA---GQLCLNPMTNDSFVLDSLFSSLHSSNDTVPTRFKKCCYGYCIDLLEKLAEDMNFD-------------------FDLYIVGDGKYGAWK---NGHWTGLVGDLLSGTAHMAVTSFSINTARSQV--IDFTSPFFSTSLGILVRTRDTTAPIGAFMWPLHWTMWLGIFVALHITAIFLTLYEWKSPFGMTPKGRNRSKVFSFSSALNVCYALLFGRTVAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPTTPHGVENLKNDAEKLDAFIMDKALLDYEVSIDADCKLLTVGKPFAMEGYGIGLPPNSPLT-SNISDLISQYKSHGFMDVLHDK----WYKVVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLLPRIKNKSKLKYWLHTSQRLHRAL 634          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. TrEMBL
Match: A0A091SEB9 (Glutamate receptor ionotropic, NMDA 3A (Fragment) OS=Pelecanus crispus OX=36300 GN=N334_11773 PE=3 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 1.880e-67
Identity = 160/520 (30.77%), Postives = 264/520 (50.77%), Query Frame = 3
Query: 1395 WPE-ALMFKTFVQ-VKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICY--------LID----------ATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGS-QIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGK--LKLGTISGSGTDYHLRMTQYPLYKYLLLFQ--NSEDVLVALKEG--RIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMT-GIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
            WPE A   K  +Q   ++HLR+VT +E P V  R++  +  C +   G++C         ++D           T+ +  + CC+G  ID++  LA   ++                     D   + D +   W+    GH + L+  +    A +AV S  I  A+  V     T P+  T +G+L+  RD    I AF++P HW+MW+GIF+ + + ++  T+YEW SP+G TP+GRN++++FSFSSAL +C++ LF  T   K PKCW+ RFLMN++A FC+  L++YTA LAA MVG+   + + GIHD K+ +     + GT+  S  + ++R +   +++Y+  +    + D +  LK    ++DAF+ D   L +   I       TVGKPF    Y +    N     + L   +S++IS       M+     W K +  G     +  + +M +++F+G  +M+ +GF LS    + E IVY+  +PR +K +  +  L  SQR +R L
Sbjct:   63 WPEQAQRHKNHMQHPTRLHLRVVTLIEHPFVFTRDVDDEGLCPA---GQLCLDPLTNDSAVLDNLFETLQGGNDTVPIELKKCCYGYCIDLLEKLAEDMNFD-------------------FDLYIVGDGKYGAWK---NGHWTGLVGDLLAGTAHMAVTSFSINTARSQV--IDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAIFLTLYEWKSPFGMTPKGRNRNKVFSFSSALNVCYAILFGRTAAIKPPKCWTGRFLMNLWAIFCLFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGIAYLKHDPEKLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPN-----SLLTSNISELISQYKSHGFMDVLHDKWYKVVPCGKRSFAVTETLQMGIKHFSGLFVMLCIGFGLSILTTIGEHIVYRLVLPRIKKKSKMKYWLHTSQRLHRAL 550          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. TrEMBL
Match: A0A091I666 (Glutamate receptor ionotropic, NMDA 3A (Fragment) OS=Calypte anna OX=9244 GN=N300_14654 PE=3 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 2.600e-67
Identity = 162/520 (31.15%), Postives = 265/520 (50.96%), Query Frame = 3
Query: 1395 WPE-ALMFKTFVQ-VKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICY--------LID----------ATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGS-QIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGK--LKLGTISGSGTDYHLRMTQYPLYKYLLLFQ--NSEDVLVALKEG--RIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMT-GIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
            WPE A   K  +Q   ++HLR+VT +E P V  R++  +  C +   G++C         ++D           T+ +  + CC+G  ID++  LA   ++                     D   + D +   W+    GH + L+  +    A +AV S  I  A+  V     T P+  T +G+L+  RD    I AF++P HW+MW+GIF+++ + ++  T+YEW SP+G TP+GRN++++FSFSSAL +C+S LF  T   K PKCW+ RFLMN++A FC+  L++YTA LAA MVG+   + + GIHD K+ +     + GT+  S  + ++R +   +++Y+  +    + D +  LK    ++DAF+ D   L +   I       TVGKPF    Y +    N     + L   +S++IS       M+     W K +  G     +  + +M +++F+G  +M+ +GF LS    + E IVY+  +PR RK +  +  L  SQR +R L
Sbjct:  263 WPEQAQRHKNHMQHPTRLHLRVVTLIEHPFVFTRDVDDEGLCPA---GQLCLDPLTNDSAMLDNLFETLQGGNDTIPIELKKCCYGYCIDLLEKLAEDMNFD-------------------FDLYIVGDGKYGAWK---NGHWTGLVGDLLAGTAHMAVTSFSINTARSQV--IDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVSLHITAIFLTLYEWKSPFGLTPKGRNRNKVFSFSSALNVCYSILFGRTAAIKPPKCWTGRFLMNLWAIFCLFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATTDGVAYLKHDPEKLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPN-----SPLTSNISELISQYKSNGFMDVLHDKWYKVVPCGKRSFAVTETLQMGIKHFSGLFVMLCVGFGLSILTTIGEHIVYRLVLPRIRKKSKMKYWLHTSQRLHRAL 750          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. TrEMBL
Match: A0A093NPK0 (Glutamate receptor ionotropic, NMDA 3A (Fragment) OS=Pygoscelis adeliae OX=9238 GN=AS28_12966 PE=3 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 3.489e-67
Identity = 161/520 (30.96%), Postives = 267/520 (51.35%), Query Frame = 3
Query: 1395 WPE-ALMFKTFVQ-VKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICY--------LID----------ATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGS-QIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGK--LKLGTISGSGTDYHLRMTQYPLYKYLLLFQ--NSEDVLVALKEG--RIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMT-GIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
            WPE A   K  +Q   ++HLR+VT +E P V  R++  +  C +   G++C         ++D           T+ +  + CC+G  ID++  LA   ++                     D   + D +   W+    GH + L+  +    A +AV S  I  A+  V     T P+  T +G+L+  RD    I AF++P HW+MW+GIF+ + + ++  T+YEW SP+G TP+GRN++++FSFSSAL +C++ LF  T   K+PKCW+ RFLMN++A FC+  L++YTA LAA MVG+   + + GIHD K+ +     + GT+  S  + ++R +   +++Y+  +    + D +  LK    ++DAF+ D   L +   I       TVGKPF    Y +    N   T + ++D +S+  S     V  ++    W K +  G     +  + +M +++F+G  +M+ +GF LS    + E IVY+  +PR RK +  +  L  SQR +R L
Sbjct:  263 WPEQAQRHKNHMQHPTRLHLRVVTLIEHPFVFTRDVDDEGLCPA---GQLCLDPLTNDSAVLDNLFETLQGGNDTVPIELKKCCYGYCIDLLEKLAEDMNFD-------------------FDLYIVGDGKYGAWK---NGHWTGLVGDLLAGTAHMAVTSFSINTARSQV--IDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAIFLTLYEWKSPFGMTPKGRNRNKVFSFSSALNVCYAILFGRTAAIKTPKCWTGRFLMNLWAIFCLFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVAYLKHDPEKLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLT-SNISDLISQYKSHGFMDVLHDK----WYKVVPCGKRSFAVTETLQMGIKHFSGLFVMLCIGFGLSILTTIGEHIVYRLVLPRIRKKSKMKYWLHTSQRLHRAL 750          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Cavefish
Match: GRIN3A (glutamate ionotropic receptor NMDA type subunit 3A [Source:NCBI gene;Acc:103022487])

HSP 1 Score: 242.662 bits (618), Expect = 1.346e-65
Identity = 153/506 (30.24%), Postives = 255/506 (50.40%), Query Frame = 3
Query: 1437 KIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICY--------LIDA----------TMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGK--LKLGTISGSGTDYHLRMTQYPLYKYLLLFQ--NSEDVLVALKEG--RIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIIS---SDNFKVRMEQRIQLWTKEMT-GIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
            ++HLR+VT +E P V  R +    +C +   G++C         L+++          T+ +  + CC+G  ID++  LA    +                ++ +V        +   W        + L+  +    A +AV S   I          T P+  T +G+L+  RD    I AF++P HWSMW+GIF+++ V +V  T+YEW SP+G TP+GRN+ R+FSFSSAL +C++ LF  T   K PKCW+ RFLMN++A FC+  L++YTA LAA MVG+ T + + GIHD K+ +     + GT+  S  + +++ +   +++Y+  +    + D +  LK    ++DAF+ D   L +   I       TVGKPF    Y +   +N     + L   +S+++S   SD F   M+     W K +  G     +  + +M +++F+G  +M+ +G +LS    + E IV+++ +PR +     Q  L  SQR +R L
Sbjct:  521 RLHLRVVTLVEHPFVFTREVDDDGQCPA---GQLCLDPLTNNTALLESLFQGLQGGNDTVPMEFKKCCYGYCIDLLEKLAEDMGFD--------------FDLYIVGDGKYGAYKNGRW--------TGLVGDLMSGAAHLAVTS-FSINSARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWSMWLGIFVSLHVTAVFLTLYEWKSPFGMTPKGRNRDRVFSFSSALNVCYAILFGRTAAIKPPKCWTGRFLMNLWAIFCLFCLSTYTANLAAVMVGEKTYEQLSGIHDPKLHHPSQGFRFGTVRESSAEDYVKKSFPEMHEYMRRYNVPTTPDGIDHLKADPQKLDAFIMDKALLDYEVSIDADCKTLTVGKPFAIEGYGIGLKQN-----SPLTSNISELVSQYKSDGF---MDMLHDKWYKVVPCGKRSFAVTETLQMGIKHFSGLFVMLCVGVALSLLTTIAEHIVHRWVIPRMQNKPQYQYWLHTSQRLHRAL 992          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Cavefish
Match: GRIN3A (glutamate ionotropic receptor NMDA type subunit 3A [Source:NCBI gene;Acc:103022487])

HSP 1 Score: 242.662 bits (618), Expect = 1.891e-65
Identity = 153/506 (30.24%), Postives = 255/506 (50.40%), Query Frame = 3
Query: 1437 KIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICY--------LIDA----------TMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGK--LKLGTISGSGTDYHLRMTQYPLYKYLLLFQ--NSEDVLVALKEG--RIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIIS---SDNFKVRMEQRIQLWTKEMT-GIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
            ++HLR+VT +E P V  R +    +C +   G++C         L+++          T+ +  + CC+G  ID++  LA    +                ++ +V        +   W        + L+  +    A +AV S   I          T P+  T +G+L+  RD    I AF++P HWSMW+GIF+++ V +V  T+YEW SP+G TP+GRN+ R+FSFSSAL +C++ LF  T   K PKCW+ RFLMN++A FC+  L++YTA LAA MVG+ T + + GIHD K+ +     + GT+  S  + +++ +   +++Y+  +    + D +  LK    ++DAF+ D   L +   I       TVGKPF    Y +   +N     + L   +S+++S   SD F   M+     W K +  G     +  + +M +++F+G  +M+ +G +LS    + E IV+++ +PR +     Q  L  SQR +R L
Sbjct:  542 RLHLRVVTLVEHPFVFTREVDDDGQCPA---GQLCLDPLTNNTALLESLFQGLQGGNDTVPMEFKKCCYGYCIDLLEKLAEDMGFD--------------FDLYIVGDGKYGAYKNGRW--------TGLVGDLMSGAAHLAVTS-FSINSARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWSMWLGIFVSLHVTAVFLTLYEWKSPFGMTPKGRNRDRVFSFSSALNVCYAILFGRTAAIKPPKCWTGRFLMNLWAIFCLFCLSTYTANLAAVMVGEKTYEQLSGIHDPKLHHPSQGFRFGTVRESSAEDYVKKSFPEMHEYMRRYNVPTTPDGIDHLKADPQKLDAFIMDKALLDYEVSIDADCKTLTVGKPFAIEGYGIGLKQN-----SPLTSNISELVSQYKSDGF---MDMLHDKWYKVVPCGKRSFAVTETLQMGIKHFSGLFVMLCVGVALSLLTTIAEHIVHRWVIPRMQNKPQYQYWLHTSQRLHRAL 1013          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Cavefish
Match: grin3bb (glutamate receptor, ionotropic, N-methyl-D-aspartate 3Bb [Source:ZFIN;Acc:ZDB-GENE-131122-77])

HSP 1 Score: 234.187 bits (596), Expect = 5.186e-63
Identity = 152/518 (29.34%), Postives = 254/518 (49.03%), Query Frame = 3
Query: 1401 EALMFKTFVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICYLIDAT---------------------MKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGK--LKLGTISGSGTDYHLRMTQYPLYKYLLLFQ--NSEDVLVALK--EGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMT-GIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
            E   ++    V    +R+VT +E P V  R +     C +   G+ C  +DA                      + L    CC+G  ID++  L+    +            E  L I+        D +   W+   GG  + L+  +    AD+AV S   I          T P+  T +G+L+  +D    I AF++P HWSMW+GIF+ + + ++  T+YEW SP+G TP GRN+ R+FS+SSAL LC++ LF  T  +K+PKCW+ RFLMN++A FC++ L+SYTA LAA MVG+ T + + GIHD K+ +     + GT+  S  + +++ +   +++Y+  F    + D +  LK    ++DAF+ D   L +   I       TVGKPF    Y +   +N   T + +++F+S+   SD +   M+     W K +  G     +  + +M +++F+G  +++ +G + +   L  E   Y+  +P  R+    +  L  SQ+ +R L
Sbjct:  351 EGSRWRAGFPVTGSRVRVVTLVEHPFVFTREVDEDGNCPA---GQYC--LDAGTNNSDTLDRFFTSRAQGNNTFLPLDYSKCCYGYCIDLLEKLSEDMDF------------EFDLYIV-------GDGKYGAWK---GGRWTGLVGDLLNGVADMAVTS-FSINSARSKVMDFTSPFFSTSLGILVRSKDTAAPIGAFMWPLHWSMWVGIFVALHITALFLTLYEWKSPFGMTPHGRNRVRVFSYSSALNLCYAILFGRTVSSKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVGEKTFEELSGIHDAKLHHPSHGFRFGTVRESSAEDYMKKSFPEMHEYMRRFNEPTTPDGVATLKTDPPQLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLT-SNISEFISR-YKSDGY---MDMLHDKWYKVVPCGKRVFAVTETLQMGIRHFSGLFVLLCVGVTGALLTLAGEHAFYRLVLPHIRRRQKFKYWLHTSQKIHRAL 835          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Cavefish
Match: grin3bb (glutamate receptor, ionotropic, N-methyl-D-aspartate 3Bb [Source:ZFIN;Acc:ZDB-GENE-131122-77])

HSP 1 Score: 218.779 bits (556), Expect = 4.254e-58
Identity = 132/424 (31.13%), Postives = 212/424 (50.00%), Query Frame = 3
Query: 1401 EALMFKTFVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICYLIDAT---------------------MKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGK--LKLGTISGSGTDYHLRMTQYPLYKYLLLFQ--NSEDVLVALK--EGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSK 2591
            E   ++    V    +R+VT +E P V  R +     C +   G+ C  +DA                      + L    CC+G  ID++  L+    +            E  L I+        D +   W+   GG  + L+  +    AD+AV S   I          T P+  T +G+L+  +D    I AF++P HWSMW+GIF+ + + ++  T+YEW SP+G TP GRN+ R+FS+SSAL LC++ LF  T  +K+PKCW+ RFLMN++A FC++ L+SYTA LAA MVG+ T + + GIHD K+ +     + GT+  S  + +++ +   +++Y+  F    + D +  LK    ++DAF+ D   L +   I       TVGKPF    Y +   +N   T + +++F+S+
Sbjct:  351 EGSRWRAGFPVTGSRVRVVTLVEHPFVFTREVDEDGNCPA---GQYC--LDAGTNNSDTLDRFFTSRAQGNNTFLPLDYSKCCYGYCIDLLEKLSEDMDF------------EFDLYIV-------GDGKYGAWK---GGRWTGLVGDLLNGVADMAVTS-FSINSARSKVMDFTSPFFSTSLGILVRSKDTAAPIGAFMWPLHWSMWVGIFVALHITALFLTLYEWKSPFGMTPHGRNRVRVFSYSSALNLCYAILFGRTVSSKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVGEKTFEELSGIHDAKLHHPSHGFRFGTVRESSAEDYMKKSFPEMHEYMRRFNEPTTPDGVATLKTDPPQLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLT-SNISEFISR 745          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Cavefish
Match: grin3ba (glutamate receptor, ionotropic, N-methyl-D-aspartate 3Ba [Source:ZFIN;Acc:ZDB-GENE-070912-354])

HSP 1 Score: 215.698 bits (548), Expect = 1.244e-57
Identity = 158/570 (27.72%), Postives = 271/570 (47.54%), Query Frame = 3
Query: 1260 SILQRYLLNHIQGNIQNTLQPMYIFGVYKFKKVFQYQDAQMRTRN---WPEALMFKTFVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICY-------------LIDATM------KLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGKL--KLGTISGSGTDYHLRMTQYPLYKYLLLFQ--NSEDVLVALK--EGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMT-GIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLLFCDL 2882
            S  QR+ +  +Q +     QP ++        V  YQ  ++       WP           +++ LR+VT +E P V  R +  + +C +   G++C                D +       ++RK  CC+G  ID++  LA    +            E  L I+        D +   W+   GG  + L+  + R  AD+AV S   I          T P+  T +G+L+  +D    I AF++P HWSMW+GIF+ + + ++  T+YEW SP+           +FS+SSAL LC++ LF  T  +K+PKCW+ RFLMN++A FC++ L+SYTA LAA MVG+ T + + GIHD K+ +  L  + GT+  S  + +++ +   +++Y+  F    + + +  LK    ++DAF+ D   L +   I       TVGKPF    Y +   +N   T   +++++S+   SD +   M+     W K +  G     +  + +M +Q+F+G  +++ +G + +   L+ E   Y+F +P  R  +  +  L  SQ   +  +C L
Sbjct:  313 STTQRFHIWSLQRDAMG--QPSWV-------TVAGYQAGRLEVEEQGLWPGV--------TQRVRLRVVTLVEHPFVFTREVDDEGQCPA---GQLCLDPHTNSSDVLNQLFRDGSSGSSIPSEIRK--CCYGYCIDLLEKLAEDMQF------------EFDLYIV-------GDGKYGAWK---GGEWTGLVGDLLRGAADMAVTS-FSINSARSRVIDFTSPFFSTSLGILVRSKDTAAPIGAFMWPLHWSMWVGIFVALHITALFLTLYEWNSPF-----------VFSYSSALNLCYAILFGRTVASKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVGEKTFEEVSGIHDAKLHHPSLGFRFGTVRESSAEDYMKKSFPEMHEYMRRFNKPTTPEGVSTLKTDPAQLDAFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLT-RNVSEYVSR-YKSDGY---MDMLHDKWYKVVPCGKRVFAVTETLQMGIQHFSGLFVLLCVGVAGALLTLLGEHAFYRFILPHLRHQHRLRYWLHTSQGEKKEFYCAL 821          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010716.1 (pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1 gene:ENSPMAG00000009705.1 transcript:ENSPMAT00000010716.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.887 bits (346), Expect = 2.019e-33
Identity = 99/364 (27.20%), Postives = 182/364 (50.00%), Query Frame = 3
Query: 1770 LISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVS-VATTVYEWLSPYG---KTPRGRN-QSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQ-----NGKLKLGTISGSGTDYHLRMTQYPLYKYLLLF--QNSEDVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTG---TELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWS--SDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVY---KFCV 2801
            +I  +    A +AVGS + I +        + P++ T I +++ R +      AFL PF   +W+ +FI   +VS +A  ++E+ SP G   +   G+      F+   ++ L W+ +F+++ P ++P+  +S+F+++++A F VIFLASYTA LAA+M+ ++ I  + G+ D K Q     +   + GT+    T+ ++R     ++ Y+  F  ++ ED L++LK G++DAF+YD   L +           T+G   G++F    +   L  +      ++  + + I        M++   +W   +TGI H +     S ++ + N AG   M+L+   LSF   V E   Y   + CV
Sbjct:  436 MIGEVVNMRAHMAVGS-LTINEERSEVVDFSVPFVETGISVMVPRSNGTVSPSAFLEPFSADVWVMMFILCLLVSGIAVFIFEYFSPVGYNRQLSAGKEFGGPAFTIGKSIWLLWAIVFNNSVPVENPRGTTSKFMVSVWAFFAVIFLASYTANLAAFMIQEDYIDQVSGLSDKKFQSPLEHSPPFRFGTVPNGSTERNIRNNYLQMHGYMSKFHQKSVEDALMSLKAGKLDAFIYDAAVLNYMAGKDEGCRLVTIGS--GKVFVATGYGIALQKSSRWKRAIDLALLQFIGDG----EMDELEMIW---LTGICHGERNDVMSSQLDIDNMAGVFYMLLVAMGLSFIVFVCEHFFYHVGRHCV 789          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000779.1 (pep scaffold:Pmarinus_7.0:GL482437:4504:14157:1 gene:ENSPMAG00000000712.1 transcript:ENSPMAT00000000779.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 109.383 bits (272), Expect = 4.974e-25
Identity = 56/190 (29.47%), Postives = 98/190 (51.58%), Query Frame = 3
Query: 1773 ISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRR-DRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRI-------------------FSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKI 2282
            +S ++   AD+AV +              T P+L + + + + RR +    + AF  P HW++W+G+F+ +  +++  T++E      +TPR   ++ +                   FS ++AL LC+S LF       +P+CWSSRFL+ ++A FC++    YTA LAA +VG  +   ++GIHD K+
Sbjct:  322 LSELSSGAADLAVTALGAGGPHAAPPLEFTAPFLSSSLSIAVARRQEGRHPLGAFALPLHWTVWVGVFVALHAIALFLTLFE-----CRTPRADGEAPVGTSGSAAAAAGTPAKARGSFSLAAALGLCYSVLFGRNVARGAPRCWSSRFLVGLWAMFCLLCFCIYTANLAAMLVGGRSRDELMGIHDPKV 506          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005084.1 (pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 gene:ENSPMAG00000004612.1 transcript:ENSPMAT00000005084.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 5.694e-8
Identity = 49/205 (23.90%), Postives = 91/205 (44.39%), Query Frame = 3
Query: 1815 SQIVIAKINVNYAL-----LTKPYLITQIGLLIYRRDRMT--GIVAFLYPFHWSMWIGIFITIQVVSVATTV------YEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGKLKLGTISGSGTDYHLRMTQYPLYKYLLLFQNS 2390
            + + +A + +NY        +KP++   I +L YR+   T  GI +FL P    +W+ I +    VS    V      YEW +P+   P        F+  ++      AL         PK  S+R +  I+  F +I ++SYTA LAA++  +  +++ I   D   +  +++ G +    T    + ++   Y+ +  F +S
Sbjct:   10 ADLAVAPLTINYMREKAIDFSKPFMTLGISIL-YRKPNGTNPGIFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTMLNSFWFGVGALMQQGSELM-PKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVER-MESPISSADDLAKQTRIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSS 211          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Nematostella
Match: EDO37551 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFF8])

HSP 1 Score: 115.161 bits (287), Expect = 6.160e-26
Identity = 88/345 (25.51%), Postives = 153/345 (44.35%), Query Frame = 3
Query: 1575 EYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGK---TPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKI--QNGKLKLGTISGSGTDYHLRMTQYPLYKYLL--------LFQNSEDVLVALKEGRIDAFVYDFESLQFFKRIHFREN-----FETVG--KPFGQLFYTVAFSKN 2549
            +YCC+G+AID++N + +                E+  E  V            G +  + G  + ++  + R +AD+++      A+ +V    L   +    + +L+  ++      AF  PF W +W+GI  T+ V  VA  + + LSPYG      R  +  R F    ++  CW   F + F  + P  +SSR +    A F ++ L SYTA L A++V  +T   + GI D K   ++ ++  G +  S  D +  + Q P+ + L         L  N  D +  +K G +D F+ +  SL +   +  ++N      + VG  KPF    Y+ +F KN
Sbjct:  447 KYCCYGLAIDVLNYVKT----------------ELEFEPFVY----FVRDGNYGAKNLTSGEWNGVVRDLIRGEADISIDLMTNEARSDVVDFSLRWTHAGLALLVLVGEKNVEPIDFAFFDPFTWQLWVGIIATVNVYLVALWIADRLSPYGYHQINKRSVDNKRHFELDGSMWYCWGVCFDNQFVEQRPAAYSSRAMSVCLAMFALLCLTSYTANLTAHLVSDDTKPYVTGIRDKKFTAKDSQISSGVVKSSYVDSYFELNQDPVMQMLFRRMRDNGHLVDNFTDGVRRVKSGELDIFISEILSLDY--EVAKQKNTGYPRLQVVGASKPFADTGYSYSFRKN 769          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Nematostella
Match: EDO35545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL56])

HSP 1 Score: 96.6709 bits (239), Expect = 2.979e-20
Identity = 100/462 (21.65%), Postives = 194/462 (41.99%), Query Frame = 3
Query: 1443 HLRIVTYLESPHVMIRNLSRKDECSSKIYGRICYLIDATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYG--KTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGKLKL--GTISGSGTDYHLR--MTQYPLYKYLLLF--QNSEDVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKM----WSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYK 2792
            HLR+VT +  P V ++ +     CS           D      K   C G   D  +            KV+      +S +        +  S  + W          ++  + +  AD+ V + + I      +   +KP+    + +L+ + ++   + +FL PF   +W+ + +++ +V+V   + +  SP+G  K  R   +    + SSA+   W  L +      +P+ +S+R L  ++A F +I +ASYTA LAA++V       + GI D  ++N   +    T++ S  D + R  +    +Y ++  +  + +++ +  +K G + AF++D  S   +          T G+ FG+  Y +   K     G+  ++ +S  I + +    ME+       E T ID SK      S   + +Q+  G  IM+  G       ++LE + +K
Sbjct:  395 HLRVVTLVGEPFVYVKPIPTSGRCS-----------DLDTNTAKHVLCTGTVSDTDSGFCMDLLIRLGEKVNFTYSVSLSEDGSYGSLRRVNGSDTKQWNG--------MVGEVIQGKADLIVAA-LTINNERAEWIEFSKPFKYQGLTILVKKNEQSNSLDSFLRPFQIHLWLLVLLSVHIVAVILYLLDRFSPFGRFKLARKEKEETALNLSSAMWFSWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPKAVVSGIDDPNLRNPSKQFIYATVANSSVDAYFRRQVELSSMYTFMEGYNVKTAKEGIEKVKNGELKAFIWD--SPVLYYEASKDCTLTTAGELFGRSGYGIGMPK-----GSPWSNAISLAILNFHESGVMEEL------ETTWIDASKCNTENTSPATLGLQHMLGVFIMVAAGIGAGIVIIILEILYHK 823          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Nematostella
Match: EDO44842 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUE9])

HSP 1 Score: 92.0485 bits (227), Expect = 6.178e-20
Identity = 92/350 (26.29%), Postives = 163/350 (46.57%), Query Frame = 3
Query: 1581 CCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQN---GKLKLGTISGSGTDYHLRMTQYPLYKYL--LLFQNSEDVLVALKEGR---IDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSD 2606
            CC+G+ ID++  L+             IG   V   I    + S  + +  G           LI  +   +AD+A+ S I I      +   ++P++ T   +L+ +R        FL PF  S W+ IF  + +V+V   ++E  +P  +  + RN    F    ++ L +S  FS       P+  SSR +++ ++   ++  A YTA LAA+MV ++    I GI+D++IQN     LK  TI  +  + + ++    +Y ++    F +S + + A+KEG    IDAF+++  +++ +     R +  TVGK F    +  AF K    T   ++DF+ K   +D
Sbjct:    2 CCYGLCIDLIKLLSRD-----------IGFIPVIETIQGGRAGSFKNGKWTG-----------LIGEVVAGNADMAM-SSISITSQRSKFVDFSEPFIHTGSTILVAKRHGSFKGDGFLKPFKVSAWLLIFAVLYLVAVVVLLFESHNPGLQRQKHRNYRGEFDIHQSVWLMFSRFFSGILNAPIPRFVSSRVVLSSWSFATLMIDALYTANLAAFMVLQDQAHYIDGINDSRIQNPLASVLKFTTIRDTSVEKYFKINFPHVYSFMRNYRFNHSSEGVRAVKEGYVIVIDAFIWESATMERYVANDTRCSLLTVGKLFDTSGFAAAFPKGSPWT-RNISDFILKYQQTD 327          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Nematostella
Match: EDO34363 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPJ5])

HSP 1 Score: 75.0998 bits (183), Expect = 4.310e-14
Identity = 87/349 (24.93%), Postives = 144/349 (41.26%), Query Frame = 3
Query: 1770 LISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVA---FLYPFHWSMWIGIFITIQVVSVATTV---YEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGK--LKLGTISGSGTDYHLRMTQYP----LYKYLLL--FQNSEDVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVL 2774
            ++  I   +AD+A+ +  + A         + PY    IG+L  R D   G V    F+ P    +W  I  TI  V +   V   +EW    G++    +  R  S   ++T  WS        T  P   S+R +   +A   +I   SYTA+LAA+ V +  +  I GI D K+QN     K  T+  S T+ + R ++      +Y+++     +  ED +  L  G    ++ D   L+             +G+PFG   Y +A +KN   T        + II  ++ K  +E     W K           S   + ++N  G  +++  GF++  CAL L
Sbjct:   44 MVGDIITGEADMALATLTITAS-RSRVIDFSSPYGEVGIGILA-RTDTTLGSVVNMDFMIPLSSQLWTVILATILFVIIVLWVLGDWEWYLK-GRSHFIPDYKRRVSLLESMTYSWSTFVHVQAGTGLPMSTSARLVALFFALAMLIVNTSYTAELAAFKVKEQFVPPISGIEDPKMQNPPPDFKFATLRDSSTEAYFRFSKDEKLRRIYEHMKDNNVEMVEDGVAKLISGEFKLYIDDQPYLEHLVSSSGNCMLRMIGRPFGISGYGIALAKNSPWT----RPISNAIIKLNDMKA-LENLWSKWLKRKCVTQDEFGKSPSGLSIENVNGLFVVVCAGFAM--CALFL 382          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Nematostella
Match: EDO41291 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J5])

HSP 1 Score: 71.2478 bits (173), Expect = 8.250e-13
Identity = 81/359 (22.56%), Postives = 150/359 (41.78%), Query Frame = 3
Query: 1755 GHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYR-RDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYG----KTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGKLKLGTISGSGTDYHLRMTQYPLYKYLLLFQNSEDVLV-----ALKEGRIDAFVY--DFESLQFFKRIHFRE--NFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQ-RIQLWTKEM---TGIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLE 2777
            G    LI  + R +AD+A+G  I I          +KP+L  +I +++ +       + AFL PF   +W+     + +VS+     +  SP G        G  +   FS S++L    +++        +P+  S R L   +  F +I +++YTA LAAY  G+  I++ I   +  +    +K G   G         ++  +Y  +     S++  V      + + R   F Y  D  SL ++   + R+  N   V        Y +A  +N     +E  + +S  I     +  +E+ R++ W       TG       S  R+++ + AG  I++  G ++S   L++E
Sbjct:   62 GQWQGLIGELVREEADIALGP-ITITAEREEVIDFSKPFLDFRIAMILQQPTGEEVNLFAFLLPFDEKLWLTTLGVVGLVSLIVWFLDRFSPQGYKTQAEKSGEGEGDEFSLSNSLWFAVASILQQG-GDNTPRSTSGRVLAAAFWLFTLILISTYTANLAAYFTGERGIRSKINSLEDLVSQSTVKYGVQEGGSLFTFFSESKVDIYATMFQQMKSQETFVNGTQYGVLKARTQPFAYLTDQPSLDYY---NMRKPCNTMLVKNLLDAKSYALAMRRN-----SEWTNLISVAILELREEGEIEKSRLRWWDDSSECPTGPSTDS--SPQRLELHSLAGVFIILGGGATISLVLLLVE 408          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Medaka
Match: GRIN3A (glutamate receptor ionotropic, NMDA 3A [Source:NCBI gene;Acc:101161818])

HSP 1 Score: 233.802 bits (595), Expect = 1.628e-62
Identity = 158/547 (28.88%), Postives = 267/547 (48.81%), Query Frame = 3
Query: 1317 QPMYI-FGVYKFKKVFQYQDAQMRTRNWPEALMFKTFVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICYLI------------------DATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGK--LKLGTISGSGTDYHLRMTQYPLYKYLLLFQ--NSEDVLVALKEG--RIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIIS---SDNFKVRMEQRIQLWTKEMT-GIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
            QP +   G ++  +V   Q      ++ P + +   + +  K+H+R+VT +E P V  R +     C +   G++C                     + ++    + CC+G  ID++  L     ++                    D   + D +  G++    G  + L+  +    A +AV S   I          T P+  T +G+L+  RD    I AF++P HWSMW+GIF+++ V ++  T+YEW SP+G TPRGRN++R+FSFSSAL +C++ LF  T   K PKCW+ R LMN++A FC+  L++YTA LAA MVG+ T + + GIHD K+ +     +  T+  S  + +++ +   +++Y+  +    + D +  LK    ++DAF+ D   L +   I       TVGKPF    Y +   +N     + L    S+++S   SD F   M+     W K +  G     +  + +M +++F+G  +M+ +G +LS    + E IVYK  +PR ++   S+  L  SQR +R L
Sbjct:  508 QPTWTRLGRWRRGRVLMDQGGW---QSHPGSRIGGDWRRYAKLHMRVVTLVEHPFVFTREVDGDGLCPA---GQLCLDPLTNESSVLEGLFQNLGRRNGSVPTHLKKCCYGYCIDLLEKLGEDMGFT-------------------FDLYIVGDGKYGGFK---NGRWTGLVGDLLSGAAHLAVTS-FSINSARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWSMWLGIFVSLHVTAIFLTLYEWHSPFGMTPRGRNRNRVFSFSSALNVCYAILFGRTVAIKPPKCWTGRLLMNLWAIFCLFCLSTYTANLAAVMVGEKTYEQLSGIHDPKLHHPSQGFRFATVRESSAEDYVKKSFPEMHEYMRRYNVPATPDGIHNLKADPQKLDAFIMDKALLDYEVSIDADCKTLTVGKPFAIEGYGIGLPQN-----SPLTSNFSELVSQYKSDGF---MDMLHDKWYKVVPCGKRSFAVTETLQMGIKHFSGLFVMLCVGVALSLLTTLAEHIVYKLVIPRVKEPR-SKYWLHTSQRLHRAL 1016          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Medaka
Match: grin3ba (glutamate ionotropic receptor NMDA type subunit 3B [Source:NCBI gene;Acc:101155155])

HSP 1 Score: 232.261 bits (591), Expect = 6.776e-62
Identity = 157/525 (29.90%), Postives = 251/525 (47.81%), Query Frame = 3
Query: 1413 FKTFVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICY----------------------------LIDATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESG-GHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGKL--KLGTISGSGTDYHLRMTQYPLYKYLLLFQ---NSEDV-LVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIIS---SDNFKVRMEQRIQLWTKEMT-GIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLL 2870
            ++  + V+   LR+VT +E P V  R +     C +   G++C                              +D    LRK  CC+G  ID++  LA    ++               ++ +V            +   SG G  + L+  +    AD+AV S   I          T P+  T +G+L+   D    I AF++P HWSMW GIF+T+ + ++  T+YEW SP+G TP GRN+ R+FS+SSAL LC++ LF  T  TK+PKCW+ RFLMN++A FC++ L+SYTA LAA MVG+ T + + GIHD K+ +  +  + GT+  S  + +++ +   ++ Y+  F      E V ++      +DAF+ D   L F   I       TVGKPF    Y +   +     G+ L   +S+ +S   SD F   M+     W K +  G     +  + +M +Q+F+G  +++ +G   +   L  E   Y   +PR R+++  Q  L  SQ+ +R L
Sbjct:  507 WRPGLSVEGHRLRVVTLVEHPFVFTREVDEDGMCPA---GQLCLDPKTNRSEIIQGLYNQLHNPNSTVVDLEGVDLPDDLRK--CCYGYCIDLLEKLAEDMGFT--------------FDLYIVGDGK--------YGALSGTGRWTGLVGDLLSGAADMAVTS-FSINSARSRVIDFTSPFYSTSLGILVRSHDTAAPIGAFMWPLHWSMWAGIFVTLHLTALFLTLYEWNSPFGMTPHGRNRLRVFSYSSALNLCYAILFGRTVATKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVGEKTFEQVSGIHDEKLHHPSMGFRFGTVRESSAEDYMKKSFPEMHDYMRRFNQPTTPEGVHMLKTDPPALDAFIMDKALLDFEVSIDADCKLLTVGKPFAIEGYGIGLPQ-----GSPLTRNVSEFVSRYKSDGF---MDMLHDKWYKVVPCGKRVFAVTETLQMGIQHFSGLFVLLCIGVGGALLTLAGEHTFYHLVIPRLRRSHTLQYWLHTSQKIHRAL 995          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Medaka
Match: GRIN3A (glutamate receptor ionotropic, NMDA 3A [Source:NCBI gene;Acc:101161818])

HSP 1 Score: 228.794 bits (582), Expect = 4.291e-61
Identity = 151/529 (28.54%), Postives = 258/529 (48.77%), Query Frame = 3
Query: 1317 QPMYI-FGVYKFKKVFQYQDAQMRTRNWPEALMFKTFVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICYLI------------------DATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGK--LKLGTISGSGTDYHLRMTQYPLYKYLLLFQ--NSEDVLVALKEG--RIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIIS---SDNFKVRMEQRIQLWTKEMT-GIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRK 2816
            QP +   G ++  +V   Q      ++ P + +   + +  K+H+R+VT +E P V  R +     C +   G++C                     + ++    + CC+G  ID++  L     ++                    D   + D +  G++    G  + L+  +    A +AV S   I          T P+  T +G+L+  RD    I AF++P HWSMW+GIF+++ V ++  T+YEW SP+G TPRGRN++R+FSFSSAL +C++ LF  T   K PKCW+ R LMN++A FC+  L++YTA LAA MVG+ T + + GIHD K+ +     +  T+  S  + +++ +   +++Y+  +    + D +  LK    ++DAF+ D   L +   I       TVGKPF    Y +   +N     + L    S+++S   SD F   M+     W K +  G     +  + +M +++F+G  +M+ +G +LS    + E IVYK  +PR ++
Sbjct:  449 QPTWTRLGRWRRGRVLMDQGGW---QSHPGSRIGGDWRRYAKLHMRVVTLVEHPFVFTREVDGDGLCPA---GQLCLDPLTNESSVLEGLFQNLGRRNGSVPTHLKKCCYGYCIDLLEKLGEDMGFT-------------------FDLYIVGDGKYGGFK---NGRWTGLVGDLLSGAAHLAVTS-FSINSARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWSMWLGIFVSLHVTAIFLTLYEWHSPFGMTPRGRNRNRVFSFSSALNVCYAILFGRTVAIKPPKCWTGRLLMNLWAIFCLFCLSTYTANLAAVMVGEKTYEQLSGIHDPKLHHPSQGFRFATVRESSAEDYVKKSFPEMHEYMRRYNVPATPDGIHNLKADPQKLDAFIMDKALLDYEVSIDADCKTLTVGKPFAIEGYGIGLPQN-----SPLTSNFSELVSQYKSDGF---MDMLHDKWYKVVPCGKRSFAVTETLQMGIKHFSGLFVMLCVGVALSLLTTLAEHIVYKLVIPRVKE 940          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Medaka
Match: grin2aa (glutamate ionotropic receptor NMDA type subunit 2A [Source:NCBI gene;Acc:101161811])

HSP 1 Score: 150.214 bits (378), Expect = 4.084e-36
Identity = 128/497 (25.75%), Postives = 224/497 (45.07%), Query Frame = 3
Query: 1395 WPEALMFKTF--VQVKKIHLRIVTYLESPHVMIRNLSR-KDECSSKIYGRICYLIDATMKLRKEY---CCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVV-SVATTVYEWLSPYG--------KTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQN-----GKLKLGTISGSGTDYHLRMTQYPLYKYLLLFQNSE--DVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLD--STGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWS--SDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVY---KFC 2798
            WP    F +F   ++   HL IVT  E P V++ ++ R    C         ++ D T +    Y   CC G  IDI+  +A    ++               ++ +V +          W          ++  +    A +AVGS + I +        + P++ T I +++ R +      AFL PF  S+W+ +F+ + +V ++A  ++E++SP G        K P G +    F+   A+ L W  +F+++ P ++PK  +S+F+++++A F VIFLASYTA LAA+M+ +  +  + G+ D K QN        + GT+    T+ ++R     +++Y++ +  +   D LV+LK G++DAF+YD   L +           T+G   G +F T  +   L   S      D     I  D     ME+    W   +TGI H++     S ++ V N AG   M+     LS    + E + Y   ++C
Sbjct:  409 WPR---FNSFGDAELDDNHLSIVTLEEKPFVIVEDVERLTGTCMRNSVPCRKHIKDNTTEAGGTYIKKCCKGFCIDILKKIAKYVKFT--------------YDLYLVTNGKHGKKINNVWNG--------MVGEVVYKKAVMAVGS-LTINEERSEVIDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLLVTAMAVFMFEYISPLGFNRNLAQGKDPHGPS----FTMGKAVWLLWGLVFNNSVPVQNPKGTTSKFIVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDNKFQNPHAYSPPFRFGTVPNGSTERNIRKNYPAMHQYMVKYHQTGVVDALVSLKTGKLDAFIYDAAVLNYMAGRDEGCKLVTIGS--GYIFATTGYGIALQKGSYWKRQVDLAILAIIGDG---EMEELEAQW---LTGICHNEKNEVMSSQLDVDNMAGVFYMLATAMGLSLITFISEHLFYWRLRYC 867          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Medaka
Match: grin2bb (glutamate receptor ionotropic, NMDA 2B-like [Source:NCBI gene;Acc:101163953])

HSP 1 Score: 146.747 bits (369), Expect = 3.949e-35
Identity = 130/509 (25.54%), Postives = 228/509 (44.79%), Query Frame = 3
Query: 1380 MRTRNWPEALMFKTFVQVKKIHLRIVTYLESPHVMIRNLS-------------RKDECSSKIYGRICYLIDATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVS-VATTVYEWLSPYG--------KTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQ-----NGKLKLGTISGSGTDYHLRMTQYPLYKYLLLF--QNSEDVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETV--GKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWS--SDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVY---KFC 2798
            MR   WP   ++ +  + +  HL IVT  E+P V++ ++              RK    S + G      D+ + +++  CC G  IDI+  +A    ++               ++ +V +          W          ++  +    A +AVGS + I +        + P++ T I +++ R +      AFL PF   +W+ +F+ + +VS VA  V+E+ SP G        + P G +    F+   A+ L W  +F+++ P ++PK  +S+ +++++A F VIFLASYTA LAA+M+ +  +  + G+ D K Q     +   + GT+    T+ ++R     ++ Y+  F  +N ++ L +LK G++DAF+YD   L +           T+  GK F    Y +A  K  DS      D    ++  D     ME+   LW   +TGI H++     S ++ V N AG   M+     LS    + E   Y   +FC
Sbjct:  386 MRYHVWPRFELY-SGAEERDDHLSIVTLEEAPFVIVEDVDPLSGTCMRNTVPCRKQLKLSNMTG------DSGIYIKR--CCKGFCIDILKKIAKAVKFT--------------YDLYLVTNGKHGKKVNGTWNG--------MVGEVVLKKAHMAVGS-LTINEERSEVIDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPS----FTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYVDQVSGLSDKKFQKPNEFSPPFRFGTVPNGSTERNIRNNYRDMHTYMTSFHQKNVDEALYSLKTGKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGKVFASTGYGIAIQK--DSGWKRAVDLAILMLFGDG---EMEELEALW---LTGICHNEKNEVMSSQLDVDNMAGVFYMLGAAMILSLITFICEHWFYWQLRFC 850          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Planmine SMEST
Match: SMESG000034930.1 (SMESG000034930.1)

HSP 1 Score: 1771.13 bits (4586), Expect = 0.000e+0
Identity = 860/873 (98.51%), Postives = 863/873 (98.85%), Query Frame = 3
Query:  612 LLCTQQNIFIK---GITQPIWISPSKFQQYEALKSFIIKRGHSGCVVFLVLRDFKVAFYNILSETLDNNTIRLINNKTDLENLVKDETFQFRKVYIFLIVEPEYRKTKVWDFNEFLVESLLKVQHHRRNKAVVLMSSDIFDTIKIHGTRQLIDILSDSETYMVNTVDKMSPFELVSGCVQRSIKILSDTLVSSNIEISKRCQNVTNGCLSSRDFFTFKRSILQRYLLNHIQGNIQNTLQPMYIFGVYKFKKVFQYQDAQMRTRNWPEALMFKTFVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICYLIDATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGKLKLGTISGSGTDYHLRMTQYPLYKYLLLFQNSEDVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLLFCDLYYSKSSWSERHKFMKQDGLIGERLINHRRLSETLNIDFKQTLNKILKSDYDKKNSEKNCRTFPMENILLNNTKKNPNFQDYKRQISDKESQTDSTIEEIQIKYIEELKSKISN 3221
            L+   QN+ I    GITQPIWISPSKFQQYEALKSFIIKRGHSGCVVFLVLRDFKVAFYNILSETLDNNTIRLINNKTDLENLVKDETFQFRKVYIFLIVEPEYRKTKVWDFNEFLVESLLKVQHHRRNKAVVLMSSDIFDTIKIHGTRQLIDILSDSETYMVNTVDKMSPFELVSGCVQRSIKILSDTLVSSNIEISKRCQNVTNGCLSSRDFFTFKRSILQRYLLNHIQGNIQNTLQPMYIFGVYKFKKVFQYQDAQMRTRNWPEALMFKTFVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICYLIDATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGKLKLGTISGSGTDYHLRMTQYPLYKYLLLFQNSEDVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLLFCDLYYSKSSWSERHKFMKQDGLIGERLINHRRLSETLNIDFKQTLNKILKSDYDKKNSEKNCRTFPMENILLNNTKKNPNFQDYKRQISDKESQTDSTIEEIQIKYIEELK K+ N
Sbjct:  138 LIGCSQNVQIPTGLGITQPIWISPSKFQQYEALKSFIIKRGHSGCVVFLVLRDFKVAFYNILSETLDNNTIRLINNKTDLENLVKDETFQFRKVYIFLIVEPEYRKTKVWDFNEFLVESLLKVQHHRRNKAVVLMSSDIFDTIKIHGTRQLIDILSDSETYMVNTVDKMSPFELVSGCVQRSIKILSDTLVSSNIEISKRCQNVTNGCLSSRDFFTFKRSILQRYLLNHIQGNIQNTLQPMYIFGVYKFKKVFQYQDAQMRTRNWPEALMFKTFVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICYLIDATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGKLKLGTISGSGTDYHLRMTQYPLYKYLLLFQNSEDVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLLFCDLYYSKSSWSERHKFMKQDGLIGERLINHRRLSETLNIDFKQTLNKILKSDYDKKNSEKNCRTFPMENILLNNTKKNPNFQDYKRQISDKESQTDSTIEEIQIKYIEELKHKLEN 1010          

HSP 2 Score: 286.96 bits (733), Expect = 2.117e-80
Identity = 141/142 (99.30%), Postives = 141/142 (99.30%), Query Frame = 1
Query:    1 IYYCLNISFVVTQNFSVVSESPKPVVRIYIIVIFGDPRLKIKEDKTWNIVRLSYSKDLPSQNLIINIHLTRIRLPTIRGNKPIGRPTMLHEKIKMYTKLYKKEVAFIISDGISQDMALVASELKIPLIGCSQNVQIPTGLII 426
            IYYCLNISFVVTQNFSVVSESPKPVVRIYIIVIFGDPRLKIKEDKTWNIVRLSYSKDLPSQNLIINIHLTRIRLPTIRGNKPIGRPTMLHEKIKMYTKLYKKEVAFIISDGISQDMALVASELKIPLIGCSQNVQIPTGL I
Sbjct:   12 IYYCLNISFVVTQNFSVVSESPKPVVRIYIIVIFGDPRLKIKEDKTWNIVRLSYSKDLPSQNLIINIHLTRIRLPTIRGNKPIGRPTMLHEKIKMYTKLYKKEVAFIISDGISQDMALVASELKIPLIGCSQNVQIPTGLGI 153          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Planmine SMEST
Match: SMESG000071734.1 (SMESG000071734.1)

HSP 1 Score: 588.186 bits (1515), Expect = 0.000e+0
Identity = 331/823 (40.22%), Postives = 495/823 (60.15%), Query Frame = 3
Query:  645 GITQPIWISPSKFQQYEALKSFIIKRGHSGCVVFLV----LRDFKVAFYNILSETLDNNTIRLINNKTDLENLVKDETFQFRKVYIFLIVEPEYRKTKVWDFNEFLVESLLKVQHHRRNKAVVLMSSDIFDTIKIHGTRQLIDILSDSETYMVNTVD-----KMSPFELVSGCVQRSIKILSDTLVSSNIEISKR---CQNVTNG---CLSSRDFFTFKRSILQRYLLNHIQGNIQNTLQPMYIFGVYKFKKVFQYQDAQMRTRNWPEALMFKTFVQVKKIHLRIVTYLESPHVMIRNLSRKDECSSKIYGRICYLIDATMK------LRKEYCCFGIAIDIVNDLASLNSYSENNKVSL-----IGISEVSLEIIVVDSASITDSQR-RGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRD---RMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGKLKLGTISGSGTDYHLRMTQYPLYKYLLLFQNSEDVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLLFCDLYYSKSSWSERHKFMKQDGLIGERLINHRRLSETLNIDFKQTLNKILK 3023
            GI QPIWI+P    +Y +L+ FI KRGH GC VF +    +      F N  S++L    I      + + NL+     + +++YI +    E          E +++ +  ++  R++  V+LM   I++ I+    + L   L+ +E+Y+  T+D     K     +   C  R+I+++ D L +++++++ +   C N T     CL+   F+  KR IL  Y+    +  IQN     Y +G Y +K +  +       R  P A M  T + VK  HL+ V++L+SP+VM+RNLS  D C+   YG  C+L+  +++       +++ CCFG++ID+++ ++ L  Y++  KV+      + I+   +EI V +    TDS   +G         + L+  +    AD+ +GS IV++K N N + LTKPYL   I L+I ++    R + +  FL PF WSMW+GIF+TIQ+ ++A+ +YEW SPYG TPRGRN++RIFSFSSALTLCWS LFSH   TKSPKCWSSRFL+N+YACFCVIFLASYTA LAAYMVG+ +++ I G HD +I+NG ++LGTI GSGT+++LR  Q   YKY+ LF N ED + AL+ G IDAF+YD E+LQ++KR  + + FE VGKPF Q+ Y +A SKNL+S G +L++F+S++IS+D F+  M+ R++LWT+E+TG+D   + SSD M+ +NF GPL++  +G  LS   L+ E IVY F +P  +K + ++ CL ISQR  R L  D  Y KSS+S RH +   D  I  RL NHRRLS  + I+    L   +K
Sbjct:  143 GIDQPIWIAPPPITEYYSLQKFIEKRGHGGCAVFFIETRLISVITSLFRNQFSDSL---VIEFSQFNSTVLNLINR---RIKRIYIGISFIEE----------EMILKLIKAIELKRKSSIVLLMPYLIYEQIQQLNYKHLKRYLNKTESYVSATLDHSYHYKFPNLIIRDDCFSRAIQLIIDAL-NADLKLNNKTSLCANYTKSPTKCLTDPKFYKKKRKILNDYVKMDKEA-IQNNFALRYTYGFYSYKDIASFPRLSYY-RQKPIAAMTDTSMLVKTAHLKTVSFLQSPYVMVRNLSANDNCNDDGYGLECFLLSMSVENSSKVTEKQKMCCFGLSIDVLSVISRLERYTKEFKVATSNNDELLITNYGIEIEVYNR---TDSNNGKGVFLAQAQLNNQLLDKLLDFSADLTLGSHIVVSKSNHNVSYLTKPYLSASIALMISKKGNLARYSALTGFLDPFAWSMWLGIFLTIQISAIASVIYEWHSPYGLTPRGRNRNRIFSFSSALTLCWSILFSHNVATKSPKCWSSRFLINVYACFCVIFLASYTANLAAYMVGEKSLREITGFHDKQIKNGNIRLGTILGSGTEFYLRTAQTDQYKYIRLFINPEDAIKALRNGDIDAFLYDIEALQYYKRTFYFDKFEIVGKPFAQVSYAIALSKNLESFGEDLSNFLSRVISADGFQKFMDLRVKLWTRELTGVDKMSLLSSDSMETRNFTGPLLLFCVGILLSCLTLIFEYIVYYFLMPYLKKYHNNEWCLSISQRLYRHLNSDNDYCKSSYSVRH-YKNSDITIVNRLHNHRRLSGDMWINESYLLKHFMK 942          

HSP 2 Score: 63.5438 bits (153), Expect = 9.676e-10
Identity = 31/76 (40.79%), Postives = 51/76 (67.11%), Query Frame = 1
Query:  199 IHLTRIRLPTIRGNKPIGRPTMLHEKIKMYTKLYKKEVAFIISDGISQDMALVASELKIPLIGCSQNVQIPTGLII 426
            I++ R++LP I    PIG   ++  KI+ Y K+     AFI+++ I+Q+M+++A+E+ IPLIGCS+   +P GL I
Sbjct:   69 INIARMQLPYIGDFNPIGGLQLILLKIEKYQKILNHIPAFIVTNSINQEMSILATEMGIPLIGCSKEFGVPDGLGI 144          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Planmine SMEST
Match: SMESG000023742.1 (SMESG000023742.1)

HSP 1 Score: 585.874 bits (1509), Expect = 0.000e+0
Identity = 297/616 (48.21%), Postives = 409/616 (66.40%), Query Frame = 3
Query: 1482 MIRNLSRKDECSSKIYGRICYLIDATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASI---------TDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGKLKLGTISGSGTDYHLRMTQYPLYKYLLLFQNSEDVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLLFCDLYYSKSSWSERHKFMKQDGLIGERLINHRRLSETLNIDFKQTLNKILKSDYDKKNSEKNCRTFPMENILLNNTKK---NPNFQD------YKRQISDKESQTDSTIEE------IQIKYIEELKSKISNLTTENLYLSNKL 3257
            MIRN++  D C++K+YG  CY+ID   + +++YCCFGI+IDI+N++  L  Y+  ++ SL GI   ++EIIV+   S+          D + + ++P         +  +  S+AD+ VGS I+I KIN++ A+                 D++ GI+ FLYPFHWSMW+GIFITIQ V++A+T+YEWLSPYG+TPRGRNQ RIFSFSS LTLCWSALFSHT PTKSPKCWSSRFLMN+YACFC+IFLASYTAKLAAYMVGKN  ++I GIHD KI +G  KLGTIS SG  YHL+  Q  L+KY+  F NS++ + ALK+G+ID F+YDFE+LQ+FKR+HFRE FE VGKPFGQL YT+A SK+LD T T+L  ++SKIIS++ F   M QRI+LWTK++TGID S  WSS R+++QNF+GPLI+      + F +L+LE + +++ +P  R+   +  CLP+SQRF+R + CD  Y K++++ERH   +    IGERLINHR+ S T  +DF   + K + S Y      +N     +EN+  +++ K   N N+ D      Y+ Q  +  +QTD  I +            ++L++ I  L  EN  LS +L
Sbjct:    1 MIRNITNDDGCNTKLYGSECYVIDNHTQTKQKYCCFGISIDIINEIQKLQVYTNEHRESLSGIKHATVEIIVMKPDSVHKRSKYKEMVDEKLKPYEP---------LQYLVNSEADLIVGSHIIINKINLHAAVT----------------DKLRGIMTFLYPFHWSMWVGIFITIQTVAIASTIYEWLSPYGQTPRGRNQKRIFSFSSGLTLCWSALFSHTVPTKSPKCWSSRFLMNVYACFCLIFLASYTAKLAAYMVGKNATRDISGIHDPKITSGLYKLGTISDSGAHYHLQSAQQHLHKYMNYFSNSDECMEALKKGKIDVFIYDFEALQYFKRVHFREQFEVVGKPFGQLLYTIAISKHLDKTATDLGKYISKIISNEEFPRSMVQRIRLWTKQITGIDSSAQWSSVRLQIQNFSGPLIIFSFAIVIGFLSLILEHMAFRYLLPWVRERYSTPWCLPLSQRFHRHISCDQDYRKATFTERHLPKEYSKCIGERLINHRKYSGT--VDFDMCILKNIVSFY------RNMENHVIENVTTDSSNKGSANGNYSDGVDSNKYQVQYKEASTQTDDFIYDETFVNNNNQTNTKQLQNMIYILIHENTLLSQRL 583          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Planmine SMEST
Match: SMESG000023742.1 (SMESG000023742.1)

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 289/595 (48.57%), Postives = 395/595 (66.39%), Query Frame = 3
Query: 1482 MIRNLSRKDECSSKIYGRICYLIDATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASI---------TDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGKLKLGTISGSGTDYHLRMTQYPLYKYLLLFQNSEDVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQ--------------RFNRLLFCDLYYSKSSWSERHKFMKQDGLIGERLINHRRLSETLNIDFKQTLNKILKSDYDKKNSEKNCRTFPMENILLNNTKK---NPNFQD------YKRQISDKESQTDSTI 3170
            MIRN++  D C++K+YG  CY+ID   + +++YCCFGI+IDI+N++  L  Y+  ++ SL GI   ++EIIV+   S+          D + + ++P         +  +  S+AD+ VGS I+I KIN++ A+                 D++ GI+ FLYPFHWSMW+GIFITIQ V++A+T+YEWLSPYG+TPRGRNQ RIFSFSS LTLCWSALFSHT PTKSPKCWSSRFLMN+YACFC+IFLASYTAKLAAYMVGKN  ++I GIHD KI +G  KLGTIS SG  YHL+  Q  L+KY+  F NS++ + ALK+G+ID F+YDFE+LQ+FKR+HFRE FE VGKPFGQL YT+A SK+LD T T+L  ++SKIIS++ F   M QRI+LWTK++TGID S  WSS R+++QNF+GPLI+      + F +L+LE + +++ +P  R+   +  CLP+SQ              RF+R + CD  Y K++++ERH   +    IGERLINHR+ S T  +DF   + K + S Y      +N     +EN+  +++ K   N N+ D      Y+ Q  +  +QTD  I
Sbjct:    1 MIRNITNDDGCNTKLYGSECYVIDNHTQTKQKYCCFGISIDIINEIQKLQVYTNEHRESLSGIKHATVEIIVMKPDSVHKRSKYKEMVDEKLKPYEP---------LQYLVNSEADLIVGSHIIINKINLHAAVT----------------DKLRGIMTFLYPFHWSMWVGIFITIQTVAIASTIYEWLSPYGQTPRGRNQKRIFSFSSGLTLCWSALFSHTVPTKSPKCWSSRFLMNVYACFCLIFLASYTAKLAAYMVGKNATRDISGIHDPKITSGLYKLGTISDSGAHYHLQSAQQHLHKYMNYFSNSDECMEALKKGKIDVFIYDFEALQYFKRVHFREQFEVVGKPFGQLLYTIAISKHLDKTATDLGKYISKIISNEEFPRSMVQRIRLWTKQITGIDSSAQWSSVRLQIQNFSGPLIIFSFAIVIGFLSLILEHMAFRYLLPWVRERYSTPWCLPLSQEEVTDHCHHEMEIKRFHRHISCDQDYRKATFTERHLPKEYSKCIGERLINHRKYSGT--VDFDMCILKNIVSFY------RNMENHVIENVTTDSSNKGSANGNYSDGVDSNKYQVQYKEASTQTDDFI 562          
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Planmine SMEST
Match: SMESG000023742.1 (SMESG000023742.1)

HSP 1 Score: 570.081 bits (1468), Expect = 0.000e+0
Identity = 290/607 (47.78%), Postives = 392/607 (64.58%), Query Frame = 3
Query: 1482 MIRNLSRKDECSSKIYGRICYLIDATMKLRKEYCCFGIAIDIVNDLASLNSYSENNKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSDADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPFHWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLCWSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNTIQNIIGIHDTKIQNGKLKLGTISGSGTDYHLRMTQYPLYKYLLLFQNSEDVLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSKNLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWSSDRMKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPISQRFNRLLFCDLYYSKSSWSERHKFMKQDGLIGERLINHRRLSETLNIDFKQTLNKILKSDYDKKNSEKNCRTFPMENILLNNTKK---NPNFQD------YKRQISDKESQTDSTIEE------IQIKYIEELKSKISNLTTENLYLSNKL 3257
            MIRN++  D C++K+YG  CY+ID   + +++YCCFGI+IDI+N++  L  Y+  ++ SL GI   ++EIIV+   S+   +R  W                                                 GL+IYR D++ GI+ FLYPFHWSMW+GIFITIQ V++A+T+YEWLSPYG+TPRGRNQ RIFSFSS LTLCWSALFSHT PTKSPKCWSSRFLMN+YACFC+IFLASYTAKLAAYMVGKN  ++I GIHD KI +G  KLGTIS SG  YHL+  Q  L+KY+  F NS++ + ALK+G+ID F+YDFE+LQ+FKR+HFRE FE VGKPFGQL YT+A SK+LD T T+L  ++SKIIS++ F   M QRI+LWTK++TGID S  WSS R+++QNF+GPLI+      + F +L+LE + +++ +P  R+   +  CLP+SQRF+R + CD  Y K++++ERH   +    IGERLINHR+ S T  +DF   + K + S Y      +N     +EN+  +++ K   N N+ D      Y+ Q  +  +QTD  I +            ++L++ I  L  EN  LS +L
Sbjct:    1 MIRNITNDDGCNTKLYGSECYVIDNHTQTKQKYCCFGISIDIINEIQKLQVYTNEHRESLSGIKHATVEIIVMKPDSV--HKRSNW-------------------------------------------------GLMIYRTDKLRGIMTFLYPFHWSMWVGIFITIQTVAIASTIYEWLSPYGQTPRGRNQKRIFSFSSGLTLCWSALFSHTVPTKSPKCWSSRFLMNVYACFCLIFLASYTAKLAAYMVGKNATRDISGIHDPKITSGLYKLGTISDSGAHYHLQSAQQHLHKYMNYFSNSDECMEALKKGKIDVFIYDFEALQYFKRVHFREQFEVVGKPFGQLLYTIAISKHLDKTATDLGKYISKIISNEEFPRSMVQRIRLWTKQITGIDSSAQWSSVRLQIQNFSGPLIIFSFAIVIGFLSLILEHMAFRYLLPWVRERYSTPWCLPLSQRFHRHISCDQDYRKATFTERHLPKEYSKCIGERLINHRKYSGT--VDFDMCILKNIVSFY------RNMENHVIENVTTDSSNKGSANGNYSDGVDSNKYQVQYKEASTQTDDFIYDETFVNNNNQTNTKQLQNMIYILIHENTLLSQRL 548          
The following BLAST results are available for this feature:
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIN3A1.475e-6830.77glutamate ionotropic receptor NMDA type subunit 3A... [more]
GRIN3B1.041e-5629.40glutamate ionotropic receptor NMDA type subunit 3B... [more]
GRIN2A8.423e-3825.53glutamate ionotropic receptor NMDA type subunit 2A... [more]
GRIN2A1.388e-3725.53glutamate ionotropic receptor NMDA type subunit 2A... [more]
GRIN2A1.388e-3725.53glutamate ionotropic receptor NMDA type subunit 2A... [more]
back to top
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nmr-22.054e-3424.96NMDA class glutamate Receptor [Source:UniProtKB/T... [more]
nmr-27.289e-2926.33NMDA class glutamate Receptor [Source:UniProtKB/T... [more]
nmr-12.312e-2423.65NMDA class glutamate Receptor; NMDA-type ionotropi... [more]
nmr-12.312e-2423.65NMDA class glutamate Receptor; NMDA-type ionotropi... [more]
glr-34.661e-1323.71GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
back to top
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nmdar11.656e-3223.94gene:FBgn0010399 transcript:FBtr0078763[more]
Nmdar21.744e-2924.11gene:FBgn0053513 transcript:FBtr0091453[more]
Nmdar21.744e-2924.11gene:FBgn0053513 transcript:FBtr0301842[more]
Nmdar21.744e-2924.11gene:FBgn0053513 transcript:FBtr0091454[more]
Nmdar22.462e-2924.11gene:FBgn0053513 transcript:FBtr0301844[more]
back to top
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grin3ba1.842e-6329.59glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
grin3bb2.798e-6228.89glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
grin3bb1.205e-6129.00glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
grin3a3.013e-5927.83glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
grin3a3.557e-5927.94glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
back to top
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nup1558.682e-6730.00nucleoporin 155kDa [Source:Xenbase;Acc:XB-GENE-973... [more]
GRIN3B1.603e-5628.79glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
GRIN2A1.762e-3726.10glutamate receptor, ionotropic, N-methyl D-asparta... [more]
GRIN2B2.223e-3725.29glutamate receptor, ionotropic, N-methyl D-asparta... [more]
GRIN2B2.803e-3725.49glutamate receptor, ionotropic, N-methyl D-asparta... [more]
back to top
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grin3a7.576e-7030.24glutamate receptor ionotropic, NMDA3A [Source:MGI ... [more]
Grin3a3.480e-6931.15glutamate receptor ionotropic, NMDA3A [Source:MGI ... [more]
Grin3b1.108e-6127.56glutamate receptor, ionotropic, NMDA3B [Source:MGI... [more]
Grin3b1.148e-5827.56glutamate receptor, ionotropic, NMDA3B [Source:MGI... [more]
Grin2a7.697e-3825.53glutamate receptor, ionotropic, NMDA2A (epsilon 1)... [more]
back to top
BLAST of glutamate receptor ionotropic, NMDA 3A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8TCU5|NMD3A_HUMAN7.081e-6830.77Glutamate receptor ionotropic, NMDA 3A OS=Homo sap... [more]
sp|Q9R1M7|NMD3A_RAT1.113e-6730.96Glutamate receptor ionotropic, NMDA 3A OS=Rattus n... [more]
sp|Q8VHN2|NMD3B_RAT1.250e-5927.11Glutamate receptor ionotropic, NMDA 3B OS=Rattus n... [more]
sp|Q91ZU9|NMD3B_MOUSE8.030e-5827.56Glutamate receptor ionotropic, NMDA 3B OS=Mus musc... [more]
sp|O60391|NMD3B_HUMAN5.000e-5629.40Glutamate receptor ionotropic, NMDA 3B OS=Homo sap... [more]
back to top
BLAST of glutamate receptor ionotropic, NMDA 3A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GVV77.073e-8736.02Uncharacterized protein OS=Macrostomum lignano OX=... [more]
G3TUX41.329e-6730.96Glutamate ionotropic receptor NMDA type subunit 3A... [more]
A0A091SEB91.880e-6730.77Glutamate receptor ionotropic, NMDA 3A (Fragment) ... [more]
A0A091I6662.600e-6731.15Glutamate receptor ionotropic, NMDA 3A (Fragment) ... [more]
A0A093NPK03.489e-6730.96Glutamate receptor ionotropic, NMDA 3A (Fragment) ... [more]
back to top
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIN3A1.346e-6530.24glutamate ionotropic receptor NMDA type subunit 3A... [more]
GRIN3A1.891e-6530.24glutamate ionotropic receptor NMDA type subunit 3A... [more]
grin3bb5.186e-6329.34glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
grin3bb4.254e-5831.13glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
grin3ba1.244e-5727.72glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
back to top
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000010716.12.019e-3327.20pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1... [more]
ENSPMAT00000000779.14.974e-2529.47pep scaffold:Pmarinus_7.0:GL482437:4504:14157:1 ge... [more]
ENSPMAT00000005084.15.694e-823.90pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 ... [more]
back to top
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO375516.160e-2625.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355452.979e-2021.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448426.178e-2026.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343634.310e-1424.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412918.250e-1322.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIN3A1.628e-6228.88glutamate receptor ionotropic, NMDA 3A [Source:NCB... [more]
grin3ba6.776e-6229.90glutamate ionotropic receptor NMDA type subunit 3B... [more]
GRIN3A4.291e-6128.54glutamate receptor ionotropic, NMDA 3A [Source:NCB... [more]
grin2aa4.084e-3625.75glutamate ionotropic receptor NMDA type subunit 2A... [more]
grin2bb3.949e-3525.54glutamate receptor ionotropic, NMDA 2B-like [Sourc... [more]
back to top
BLAST of glutamate receptor ionotropic, NMDA 3A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000034930.12.117e-8098.51SMESG000034930.1[more]
SMESG000071734.19.676e-1040.22SMESG000071734.1[more]
SMESG000023742.10.000e+048.21SMESG000023742.1[more]
SMESG000023742.10.000e+048.57SMESG000023742.1[more]
SMESG000023742.10.000e+047.78SMESG000023742.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008439 ID=SMED30008439|Name=glutamate receptor ionotropic, NMDA 3A|organism=Schmidtea mediterranea sexual|type=transcript|length=3359bp
ATTTACTATTGTTTGAACATCAGTTTTGTTGTCACGCAAAACTTCTCTGT
CGTTTCCGAATCTCCAAAACCTGTTGTTCGAATCTACATTATTGTGATAT
TTGGCGATCCAAGATTGAAAATAAAAGAGGATAAGACTTGGAATATAGTC
CGTCTTTCGTATTCGAAAGATTTACCATCACAAAATCTCATCATTAACAT
CCATTTAACTCGGATTCGACTGCCAACAATTCGCGGAAATAAACCGATCG
GAAGACCAACAATGTTACATGAGAAGATCAAAATGTACACCAAACTTTAT
AAGAAAGAGGTGGCATTTATTATTTCAGATGGAATTAGTCAGGATATGGC
GTTGGTTGCTTCTGAATTGAAAATCCCACTAATTGGTTGCAGTCAAAATG
TCCAAATTCCAACTGGATTGATAATCCATTAACAGCACTGTTCGTTTATT
TGAAAGTAAAGCTTTAAGAAGACGTAAACCAAAGAAGACAAACATATTAA
TTGGACATAACATTAACTACAAAAGTGTTGATTTTAGTTCTGATCACAAG
ATTTTTTAACCCAAAAGCAGTACAAAGGATAGAAAGAATAGAAAAGATGG
AAATGTGTGGGCTGTTATGCACTCAACAAAATATTTTTATTAAGGGAATT
ACACAACCTATTTGGATATCACCGTCAAAGTTTCAACAATATGAAGCCCT
TAAAAGCTTTATTATTAAAAGAGGTCACAGTGGATGTGTTGTATTTCTCG
TTCTCCGAGACTTTAAGGTGGCATTTTACAATATCTTATCCGAAACATTA
GACAACAACACAATTCGTTTGATAAATAACAAAACCGATCTCGAAAATCT
GGTGAAAGATGAAACCTTTCAATTTCGGAAGGTTTATATATTTTTAATCG
TTGAGCCAGAGTATAGAAAGACGAAAGTGTGGGATTTTAATGAATTTTTA
GTGGAATCTCTTCTCAAGGTTCAACATCACCGTCGGAATAAAGCTGTCGT
TTTAATGTCATCTGATATATTTGATACAATCAAAATTCATGGTACTAGGC
AACTGATAGACATTCTGTCAGACAGTGAGACCTACATGGTGAATACCGTT
GATAAAATGAGTCCATTCGAACTTGTTAGTGGTTGTGTTCAGCGTTCCAT
TAAAATTCTCAGTGACACTCTAGTTAGTTCAAACATAGAAATTAGCAAAA
GATGTCAAAATGTCACAAATGGCTGCCTATCATCTCGAGATTTTTTCACA
TTCAAGAGAAGTATTCTCCAGAGATATTTACTGAACCACATACAAGGCAA
TATACAAAACACCCTTCAACCGATGTATATCTTTGGTGTTTACAAATTCA
AAAAAGTTTTTCAATATCAAGACGCTCAAATGAGAACGAGAAATTGGCCC
GAAGCGTTAATGTTTAAGACATTTGTTCAAGTGAAAAAGATTCATCTTCG
TATTGTGACATATTTAGAGAGCCCTCATGTGATGATCAGAAACCTCTCTC
GAAAGGATGAGTGTAGCAGTAAGATATACGGACGAATTTGCTATTTGATC
GACGCAACGATGAAATTACGAAAGGAATATTGTTGTTTTGGAATCGCAAT
TGACATTGTTAATGATTTGGCCAGCTTGAATTCATACTCAGAAAATAACA
AAGTCAGTTTAATAGGCATAAGTGAAGTCAGCTTGGAGATAATTGTTGTC
GACAGTGCCTCAATAACCGATTCACAGAGGAGAGGTTGGCAACCAGAAAG
CGGGGGTCATCAAAGCATATTAATCAGTTCTATCAACAGATCAGACGCAG
ACGTTGCTGTGGGATCACAGATTGTTATAGCAAAAATAAATGTAAATTAC
GCTCTCTTAACCAAGCCGTATTTAATTACCCAAATTGGATTGTTAATATA
TCGGAGAGATAGAATGACAGGAATCGTCGCATTTCTTTATCCTTTCCACT
GGTCTATGTGGATTGGAATATTTATTACTATTCAGGTTGTTTCAGTCGCT
ACGACAGTTTATGAATGGTTAAGTCCATACGGTAAGACTCCGCGTGGCCG
CAACCAATCACGGATATTCAGTTTTTCATCCGCTCTCACACTATGTTGGT
CAGCTCTATTTTCTCATACGTTTCCAACAAAATCCCCTAAATGTTGGAGC
TCGAGATTTCTGATGAACATCTACGCTTGTTTTTGTGTGATATTTCTAGC
GAGTTATACGGCAAAACTAGCCGCTTATATGGTTGGAAAGAACACTATCC
AGAACATCATCGGTATTCATGACACAAAAATTCAAAATGGAAAGTTGAAA
CTAGGCACAATATCCGGAAGTGGAACGGATTATCATTTACGCATGACTCA
ATATCCGCTGTATAAATATTTGTTACTTTTTCAGAATTCGGAGGATGTTT
TAGTAGCTCTTAAAGAAGGTCGAATTGATGCATTTGTCTACGACTTCGAG
TCGTTGCAGTTTTTCAAACGCATTCACTTTCGAGAAAACTTTGAAACTGT
GGGAAAACCCTTTGGCCAGCTGTTTTATACTGTTGCTTTCAGTAAGAATT
TGGACAGCACCGGAACTGAACTCAATGATTTTATGTCAAAAATTATTTCC
AGTGACAATTTTAAAGTACGAATGGAACAAAGAATCCAACTATGGACAAA
GGAAATGACTGGAATAGATCACAGTAAAATGTGGTCTTCCGATCGTATGA
AAGTTCAAAATTTCGCTGGACCTTTAATAATGATGTTGCTTGGATTTAGT
TTGTCATTTTGCGCTTTGGTTTTGGAATGTATTGTATACAAATTTTGTGT
TCCTCGATTCAGGAAAAACAATTTCAGTCAGTCCTGCTTACCAATTAGTC
AGAGATTCAATCGCTTGTTATTTTGTGATTTATACTACTCGAAATCATCA
TGGAGTGAAAGACACAAATTTATGAAGCAAGATGGATTGATTGGTGAAAG
ATTAATCAATCACCGTAGGTTGAGTGAAACACTAAATATAGATTTTAAGC
AAACATTGAACAAAATCCTAAAATCAGATTATGATAAGAAAAACAGTGAG
AAAAACTGTCGGACATTTCCCATGGAAAATATTCTCTTGAATAATACGAA
GAAAAATCCAAATTTCCAGGACTATAAGAGACAGATCTCCGACAAAGAAT
CACAGACCGATTCGACAATTGAAGAGATCCAAATCAAATATATTGAAGAG
TTGAAAAGTAAAATTTCCAATCTGACAACGGAAAATTTATATTTATCTAA
CAAACTGTTGAAATTTAATGCTCGAATTTATGATGGATAGAAATGTGTAA
AAACTGTTTTTTTTGGGTTTTAGAATATTTTCTCTGTGGATCTTTATTTT
CAGTAAATG
back to top

protein sequence of SMED30008439-orf-1

>SMED30008439-orf-1 ID=SMED30008439-orf-1|Name=SMED30008439-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=898bp
MEMCGLLCTQQNIFIKGITQPIWISPSKFQQYEALKSFIIKRGHSGCVVF
LVLRDFKVAFYNILSETLDNNTIRLINNKTDLENLVKDETFQFRKVYIFL
IVEPEYRKTKVWDFNEFLVESLLKVQHHRRNKAVVLMSSDIFDTIKIHGT
RQLIDILSDSETYMVNTVDKMSPFELVSGCVQRSIKILSDTLVSSNIEIS
KRCQNVTNGCLSSRDFFTFKRSILQRYLLNHIQGNIQNTLQPMYIFGVYK
FKKVFQYQDAQMRTRNWPEALMFKTFVQVKKIHLRIVTYLESPHVMIRNL
SRKDECSSKIYGRICYLIDATMKLRKEYCCFGIAIDIVNDLASLNSYSEN
NKVSLIGISEVSLEIIVVDSASITDSQRRGWQPESGGHQSILISSINRSD
ADVAVGSQIVIAKINVNYALLTKPYLITQIGLLIYRRDRMTGIVAFLYPF
HWSMWIGIFITIQVVSVATTVYEWLSPYGKTPRGRNQSRIFSFSSALTLC
WSALFSHTFPTKSPKCWSSRFLMNIYACFCVIFLASYTAKLAAYMVGKNT
IQNIIGIHDTKIQNGKLKLGTISGSGTDYHLRMTQYPLYKYLLLFQNSED
VLVALKEGRIDAFVYDFESLQFFKRIHFRENFETVGKPFGQLFYTVAFSK
NLDSTGTELNDFMSKIISSDNFKVRMEQRIQLWTKEMTGIDHSKMWSSDR
MKVQNFAGPLIMMLLGFSLSFCALVLECIVYKFCVPRFRKNNFSQSCLPI
SQRFNRLLFCDLYYSKSSWSERHKFMKQDGLIGERLINHRRLSETLNIDF
KQTLNKILKSDYDKKNSEKNCRTFPMENILLNNTKKNPNFQDYKRQISDK
ESQTDSTIEEIQIKYIEELKSKISNLTTENLYLSNKLLKFNARIYDG*
back to top

protein sequence of SMED30008439-orf-2

>SMED30008439-orf-2 ID=SMED30008439-orf-2|Name=SMED30008439-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=144bp
IYYCLNISFVVTQNFSVVSESPKPVVRIYIIVIFGDPRLKIKEDKTWNIV
RLSYSKDLPSQNLIINIHLTRIRLPTIRGNKPIGRPTMLHEKIKMYTKLY
KKEVAFIISDGISQDMALVASELKIPLIGCSQNVQIPTGLIIH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015276ligand-gated ion channel activity
GO:0038023signaling receptor activity
GO:0004872receptor activity
GO:0005216ion channel activity
GO:0004970ionotropic glutamate receptor activity
GO:0051721protein phosphatase 2A binding
GO:0004972NMDA glutamate receptor activity
GO:0005234extracellular-glutamate-gated ion channel activity
GO:0005262calcium channel activity
GO:0005515protein binding
GO:0016594glycine binding
GO:0042802identical protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR001508Iono_rcpt_met
IPR001638Solute-binding_3/MltF_N
IPR001320Iontro_rcpt
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0043025neuronal cell body
GO:0045202synapse
GO:0045211postsynaptic membrane
GO:0005886plasma membrane
GO:0014069postsynaptic density
GO:0016021integral component of membrane
GO:0017146NMDA selective glutamate receptor complex
GO:0030054cell junction
GO:0043005neuron projection
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0045471response to ethanol
GO:0060079excitatory postsynaptic potential
GO:0060134prepulse inhibition
GO:0070588calcium ion transmembrane transport
GO:0006810transport
GO:0006816calcium ion transport
GO:0016358dendrite development
GO:0034220ion transmembrane transport
GO:0034765regulation of ion transmembrane transport
GO:0035235ionotropic glutamate receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 866..886
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 385..699
e-value: 7.0E-39
score: 135.6
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 429..644
e-value: 7.0E-39
score: 135.6
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 439..727
e-value: 7.0E-39
score: 135.6
NoneNo IPR availablePANTHERPTHR18966IONOTROPIC GLUTAMATE RECEPTORcoord: 421..768
NoneNo IPR availablePANTHERPTHR18966:SF397GLUTAMATE RECEPTOR IONOTROPIC, NMDA 3Acoord: 421..768
NoneNo IPR availableSUPERFAMILYSSF53850Periplasmic binding protein-like IIcoord: 386..672
NoneNo IPR availableTMHMMTMhelixcoord: 709..731
NoneNo IPR availableTMHMMTMhelixcoord: 454..476
NoneNo IPR availableTMHMMTMhelixcoord: 521..543
NoneNo IPR availableTMHMMTMhelixcoord: 489..511
IPR001508Ionotropic glutamate receptor, metazoaPRINTSPR00177NMDARECEPTORcoord: 521..548
score: 46.43
coord: 454..479
score: 26.92
IPR001320Ionotropic glutamate receptorPFAMPF00060Lig_chancoord: 672..716
e-value: 7.8E-23
score: 81.8
IPR001638Solute-binding protein family 3/N-terminal domain of MltFPFAMPF00497SBP_bac_3coord: 417..671
e-value: 5.3E-8
score: 32.6