Nuclear and cytoplasmic polyadenylated RNA-binding protein

Overview
NameNuclear and cytoplasmic polyadenylated RNA-binding protein
Smed IDSMED30008437
Length (bp)1639
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nuclear and cytoplasmic polyadenylated RNA-binding protein (SMED30008437) t-SNE clustered cells

Violin plots show distribution of expression levels for Nuclear and cytoplasmic polyadenylated RNA-binding protein (SMED30008437) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nuclear and cytoplasmic polyadenylated RNA-binding protein (SMED30008437) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nuclear and cytoplasmic polyadenylated RNA-binding protein (SMED30008437) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008437

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30008437SMESG000044649.1 SmedASXL_019130SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30008437SMESG000044649.1 SmedASXL_019130SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30008437SMESG000044649.1 dd_Smed_v4_3605_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30008437SMESG000044649.1 dd_Smed_v4_3605_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30008437SMESG000044649.1 dd_Smed_v4_3605_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008437SMESG000044649.1 dd_Smed_v4_3605_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Human
Match: TIA1 (TIA1 cytotoxic granule associated RNA binding protein [Source:HGNC Symbol;Acc:HGNC:11802])

HSP 1 Score: 155.221 bits (391), Expect = 1.334e-41
Identity = 109/347 (31.41%), Postives = 179/347 (51.59%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEF-DNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKK-----NAAAGGNM---NKPMGNQMNQYYDNSQANFDNXXXXXXXXXXPNFFQVPQF 1029
            ME +  KT+YV NL   ++E  +L +F   G C +C++ ++T+      ++EF ++  +A    AMN   +   ++ V  A       + P   +S+K D S    +FVG +  +I    +K  F+  G++ DA+VV+    G+ KG+ FVSF N+ +A  AIQ M       R+I+ NWAT+       PP  K  +  +TK L  +E+  ++  +N +VY   +   L+E ++R TF  FG+I  I+ FP+K ++FV +++H++AA+AI  +NG  I    +KC WGK+     N     N     +P G Q  Q+Y N+Q               PN +QVP +
Sbjct:    1 MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWA-------TTP---SSQKKDTSNHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRK------PPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPQPYG-QWGQWYGNAQ---------QIGQYMPNGWQVPAY 321          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Human
Match: TIA1 (TIA1 cytotoxic granule associated RNA binding protein [Source:HGNC Symbol;Acc:HGNC:11802])

HSP 1 Score: 151.754 bits (382), Expect = 3.085e-40
Identity = 105/349 (30.09%), Postives = 176/349 (50.43%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEF-DNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQ----NSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKK-----NAAAGGNMNKPMG-NQMNQYYDNSQANFDNXXXXXXXXXXPNFFQVPQF 1029
            ME +  KT+YV NL   ++E  +L +F   G C +C++ ++T+      ++EF ++  +A    AMN   +   ++ V  A     Q    +S+      +  D+     +FVG +  +I    +K  F+  G++ DA+VV+    G+ KG+ FVSF N+ +A  AIQ M       R+I+ NWAT+       PP  K  +  +TK L  +E+  ++  +N +VY   +   L+E ++R TF  FG+I  I+ FP+K ++FV +++H++AA+AI  +NG  I    +KC WGK+     N      +  P    Q  Q+Y N+Q               PN +QVP +
Sbjct:    1 MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDH---FHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRK------PPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQNQIGYPQPYGQWGQWYGNAQ---------QIGQYMPNGWQVPAY 331          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Human
Match: TIA1 (TIA1 cytotoxic granule associated RNA binding protein [Source:HGNC Symbol;Acc:HGNC:11802])

HSP 1 Score: 150.984 bits (380), Expect = 5.647e-40
Identity = 107/351 (30.48%), Postives = 178/351 (50.71%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEF-DNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQ----NSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKK-----NAAAGGNM---NKPMGNQMNQYYDNSQANFDNXXXXXXXXXXPNFFQVPQF 1029
            ME +  KT+YV NL   ++E  +L +F   G C +C++ ++T+      ++EF ++  +A    AMN   +   ++ V  A     Q    +S+      +  D+     +FVG +  +I    +K  F+  G++ DA+VV+    G+ KG+ FVSF N+ +A  AIQ M       R+I+ NWAT+       PP  K  +  +TK L  +E+  ++  +N +VY   +   L+E ++R TF  FG+I  I+ FP+K ++FV +++H++AA+AI  +NG  I    +KC WGK+     N     N     +P G Q  Q+Y N+Q               PN +QVP +
Sbjct:    1 MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDH---FHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRK------PPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPQPYG-QWGQWYGNAQ---------QIGQYMPNGWQVPAY 332          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Human
Match: TIAL1 (TIA1 cytotoxic granule associated RNA binding protein like 1 [Source:HGNC Symbol;Acc:HGNC:11804])

HSP 1 Score: 148.288 bits (373), Expect = 3.682e-39
Identity = 99/311 (31.83%), Postives = 156/311 (50.16%), Query Frame = 1
Query:   61 KTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEFDNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNK---PMGNQMNQYYDNSQ 957
            +T+YV NL   ++E  +L +F   G C SC++  E +S     ++EF             D       MN      +EV+ +     +S+K D S    +FVG +  +I    +K  F+  G++ DA+VV+    G+ KG+ FVSF N+ +A  AI  M       R+I+ NWAT+       PP  K     +TK L  E++  ++   N +VY   +A  L++ ++R TF  FG+I  I+ FPEK ++FV + TH++AA+AI  +NG  I    +KC WGK++     N  +       Q +Q Y N Q
Sbjct:    9 RTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTSNDPYCFVEF---------YEHRDAAAALAAMNGRKILGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRK------PPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQ 304          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Human
Match: TIAL1 (TIA1 cytotoxic granule associated RNA binding protein like 1 [Source:HGNC Symbol;Acc:HGNC:11804])

HSP 1 Score: 140.584 bits (353), Expect = 3.246e-36
Identity = 99/319 (31.03%), Postives = 155/319 (48.59%), Query Frame = 1
Query:   61 KTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLET-------SSAYIEFDNELSAE-----KALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNK---PMGNQMNQYYDNSQ 957
            +T+YV NL   ++E  +L +F   G C SC++  E        SS         S +     +     D       MN      +EV+ +     +S+K D S    +FVG +  +I    +K  F+  G++ DA+VV+    G+ KG+ FVSF N+ +A  AI  M       R+I+ NWAT+       PP  K     +TK L  E++  ++   N +VY   +A  L++ ++R TF  FG+I  I+ FPEK ++FV + TH++AA+AI  +NG  I    +KC WGK++     N  +       Q +Q Y N Q
Sbjct:    9 RTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEQPDSRRVNSSVGFSVLQHTSNDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRK------PPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQ 321          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Celegans
Match: tiar-1 (TIA-1/TIAL RNA binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q95QV8])

HSP 1 Score: 147.902 bits (372), Expect = 4.376e-39
Identity = 92/280 (32.86%), Postives = 149/280 (53.21%), Query Frame = 1
Query:   61 KTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS---AYIEFDNELSAEKAL-AMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDG-QHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVM-AENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGK 882
            +T+YV NL S ++E+ + ++F   G     ++  + S+   A++EF +   A +AL  MN   +   +M V  A VE  Q  +       K+D +    +FVG +  ++D  KL++ F   G V DAKV+R  +  + KG+ FVS+   +EA  AI+ MN      R I+ NWAT+       P +++     + K+ +EI  +    NTSVYV    +L+ED +R  F  FG+I  ++ F  + +AFV +D  DAAA AI Q+N   +    ++C+WGK
Sbjct:   46 RTLYVGNLDSTVTEDFIATLFNQIGSVTKTKVIFDGSNDPYAFVEFSDHGQASQALQTMNKRLLLDREMKVNWA-VEPGQQQS-------KIDTTRHFHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQWLGRRTIRTNWATRK------PGDQEKPSHYNEKSYDEIYNQTSGDNTSVYVGNIASLTEDEIRQGFASFGRITEVRIFKMQGYAFVKFDNKDAAAKAIVQMNNQDVGGQLVRCSWGK 311          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Celegans
Match: tiar-2 (TIA-1/TIAL RNA binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q9U2F5])

HSP 1 Score: 137.887 bits (346), Expect = 2.342e-35
Identity = 97/310 (31.29%), Postives = 159/310 (51.29%), Query Frame = 1
Query:   49 SKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS---AYIEFDNELSAEKAL-AMNDTPMDSNQMNVVIAY--VEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPD-GQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMA------------FGQSTKTLEEISYEAPETNTSVYVM-AENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNKP 918
            S++ +T++V+NL   I++E L ++F   G  +  ++  E  +   A++EF +   A  AL + N   +   +M+V  A+   E  +N +       K + S    +FVG +  +ID  KL++ F   G+V +AK++R  +  + KG+ FVS+   ++A  AI  MN      R I+ NWAT+  + +G     +                QS KT +EI  +A   NTSVYV    NL ED +R  F+RFG I  ++ F  + +AFV ++T ++AA AI Q+N   I    ++C+WGK      G+  KP
Sbjct:   36 SEDPRTLFVANLDPAITDEFLATLFNQIGAVMKAKIIFEGLNDPYAFVEFSDHNQATLALQSHNGRELLEKEMHVTWAFEPREPGENRS-------KPETSRHFHVFVGDLCSEIDSTKLREAFVKFGEVSEAKIIRDNNTNKGKGYGFVSYPRREDAERAIDEMNGAWLGRRTIRTNWATRKPDEDGERGGDRGDRRGGGGGGRDRYHNQSEKTYDEIFNQAAADNTSVYVGNIANLGEDEIRRAFDRFGPINEVRTFKIQGYAFVKFETKESAARAIVQMNNADIGGQIVRCSWGKS-----GDSGKP 333          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Celegans
Match: tiar-1 (TIA-1/TIAL RNA binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q95QV8])

HSP 1 Score: 127.872 bits (320), Expect = 3.560e-32
Identity = 85/276 (30.80%), Postives = 135/276 (48.91%), Query Frame = 1
Query:   61 KTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSSAYIEFDNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDG-QHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVM-AENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGK 882
            +T+YV NL S ++E+ + ++F   G     +         + FD                   +M V  A VE  Q  +       K+D +    +FVG +  ++D  KL++ F   G V DAKV+R  +  + KG+ FVS+   +EA  AI+ MN      R I+ NWAT+       P +++     + K+ +EI  +    NTSVYV    +L+ED +R  F  FG+I  ++ F  + +AFV +D  DAAA AI Q+N   +    ++C+WGK
Sbjct:   46 RTLYVGNLDSTVTEDFIATLFNQIGSVTKTK---------VIFD-------------------EMKVNWA-VEPGQQQS-------KIDTTRHFHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQWLGRRTIRTNWATRK------PGDQEKPSHYNEKSYDEIYNQTSGDNTSVYVGNIASLTEDEIRQGFASFGRITEVRIFKMQGYAFVKFDNKDAAAKAIVQMNNQDVGGQLVRCSWGK 279          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Celegans
Match: tiar-1 (TIA-1/TIAL RNA binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q95QV8])

HSP 1 Score: 124.02 bits (310), Expect = 2.109e-31
Identity = 68/190 (35.79%), Postives = 106/190 (55.79%), Query Frame = 1
Query:  319 KVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDG-QHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVM-AENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGK 882
            K+D +    +FVG +  ++D  KL++ F   G V DAKV+R  +  + KG+ FVS+   +EA  AI+ MN      R I+ NWAT+       P +++     + K+ +EI  +    NTSVYV    +L+ED +R  F  FG+I  ++ F  + +AFV +D  DAAA AI Q+N   +    ++C+WGK
Sbjct:   25 KIDTTRHFHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQWLGRRTIRTNWATRK------PGDQEKPSHYNEKSYDEIYNQTSGDNTSVYVGNIASLTEDEIRQGFASFGRITEVRIFKMQGYAFVKFDNKDAAAKAIVQMNNQDVGGQLVRCSWGK 208          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Celegans
Match: tiar-1 (TIA-1/TIAL RNA binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q95QV8])

HSP 1 Score: 123.635 bits (309), Expect = 2.178e-31
Identity = 68/190 (35.79%), Postives = 106/190 (55.79%), Query Frame = 1
Query:  319 KVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDG-QHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVM-AENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGK 882
            K+D +    +FVG +  ++D  KL++ F   G V DAKV+R  +  + KG+ FVS+   +EA  AI+ MN      R I+ NWAT+       P +++     + K+ +EI  +    NTSVYV    +L+ED +R  F  FG+I  ++ F  + +AFV +D  DAAA AI Q+N   +    ++C+WGK
Sbjct:   15 KIDTTRHFHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQWLGRRTIRTNWATRK------PGDQEKPSHYNEKSYDEIYNQTSGDNTSVYVGNIASLTEDEIRQGFASFGRITEVRIFKMQGYAFVKFDNKDAAAKAIVQMNNQDVGGQLVRCSWGK 198          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Fly
Match: Rox8 (gene:FBgn0005649 transcript:FBtr0084592)

HSP 1 Score: 141.739 bits (356), Expect = 2.284e-36
Identity = 94/311 (30.23%), Postives = 159/311 (51.13%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS---AYIEFDNELSAEKAL-AMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDG-QHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKK-------------------MAFGQSTKTLEEISYEAPETNTSVYVMA---ENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAA 894
            M+    KT+YV NL S +SE+ L+++F + G   SC++  E  +   A+IE+ N  +A  AL AMN       ++ V  A     Q          K D S+   IFVG +  +I+   L++ F+  G++ + ++VR P   + KG+AFVSF  + EA  AIQ+MN     +R I+ NW+T+      +PP ++                      G    T EE+  ++  TNT+VY        +S+D++   F +FG I++++ F +K  +F+ + T +AAA+AI+  +  +++   +KC WGK+N  
Sbjct:    1 MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPGNDPYAFIEYSNYQAATTALTAMNKRLFLEKEIKVNWATSPGNQ---------PKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRK-----LPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQDVRVFKDKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWGKENGG 297          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Fly
Match: Rox8 (gene:FBgn0005649 transcript:FBtr0084594)

HSP 1 Score: 141.739 bits (356), Expect = 2.284e-36
Identity = 94/311 (30.23%), Postives = 159/311 (51.13%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS---AYIEFDNELSAEKAL-AMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDG-QHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKK-------------------MAFGQSTKTLEEISYEAPETNTSVYVMA---ENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAA 894
            M+    KT+YV NL S +SE+ L+++F + G   SC++  E  +   A+IE+ N  +A  AL AMN       ++ V  A     Q          K D S+   IFVG +  +I+   L++ F+  G++ + ++VR P   + KG+AFVSF  + EA  AIQ+MN     +R I+ NW+T+      +PP ++                      G    T EE+  ++  TNT+VY        +S+D++   F +FG I++++ F +K  +F+ + T +AAA+AI+  +  +++   +KC WGK+N  
Sbjct:    1 MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPGNDPYAFIEYSNYQAATTALTAMNKRLFLEKEIKVNWATSPGNQ---------PKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRK-----LPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQDVRVFKDKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWGKENGG 297          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Fly
Match: Rox8 (gene:FBgn0005649 transcript:FBtr0333200)

HSP 1 Score: 141.354 bits (355), Expect = 3.037e-36
Identity = 94/311 (30.23%), Postives = 159/311 (51.13%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS---AYIEFDNELSAEKAL-AMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDG-QHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKK-------------------MAFGQSTKTLEEISYEAPETNTSVYVMA---ENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAA 894
            M+    KT+YV NL S +SE+ L+++F + G   SC++  E  +   A+IE+ N  +A  AL AMN       ++ V  A     Q          K D S+   IFVG +  +I+   L++ F+  G++ + ++VR P   + KG+AFVSF  + EA  AIQ+MN     +R I+ NW+T+      +PP ++                      G    T EE+  ++  TNT+VY        +S+D++   F +FG I++++ F +K  +F+ + T +AAA+AI+  +  +++   +KC WGK+N  
Sbjct:    1 MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPGNDPYAFIEYSNYQAATTALTAMNKRLFLEKEIKVNWATSPGNQ---------PKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRK-----LPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQDVRVFKDKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWGKENGG 297          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Fly
Match: Rox8 (gene:FBgn0005649 transcript:FBtr0333202)

HSP 1 Score: 141.354 bits (355), Expect = 3.037e-36
Identity = 94/311 (30.23%), Postives = 159/311 (51.13%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS---AYIEFDNELSAEKAL-AMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDG-QHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKK-------------------MAFGQSTKTLEEISYEAPETNTSVYVMA---ENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAA 894
            M+    KT+YV NL S +SE+ L+++F + G   SC++  E  +   A+IE+ N  +A  AL AMN       ++ V  A     Q          K D S+   IFVG +  +I+   L++ F+  G++ + ++VR P   + KG+AFVSF  + EA  AIQ+MN     +R I+ NW+T+      +PP ++                      G    T EE+  ++  TNT+VY        +S+D++   F +FG I++++ F +K  +F+ + T +AAA+AI+  +  +++   +KC WGK+N  
Sbjct:    1 MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPGNDPYAFIEYSNYQAATTALTAMNKRLFLEKEIKVNWATSPGNQ---------PKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRK-----LPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQDVRVFKDKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWGKENGG 297          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Fly
Match: Rox8 (gene:FBgn0005649 transcript:FBtr0333201)

HSP 1 Score: 141.354 bits (355), Expect = 3.037e-36
Identity = 94/311 (30.23%), Postives = 159/311 (51.13%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS---AYIEFDNELSAEKAL-AMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDG-QHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKK-------------------MAFGQSTKTLEEISYEAPETNTSVYVMA---ENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAA 894
            M+    KT+YV NL S +SE+ L+++F + G   SC++  E  +   A+IE+ N  +A  AL AMN       ++ V  A     Q          K D S+   IFVG +  +I+   L++ F+  G++ + ++VR P   + KG+AFVSF  + EA  AIQ+MN     +R I+ NW+T+      +PP ++                      G    T EE+  ++  TNT+VY        +S+D++   F +FG I++++ F +K  +F+ + T +AAA+AI+  +  +++   +KC WGK+N  
Sbjct:    1 MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPGNDPYAFIEYSNYQAATTALTAMNKRLFLEKEIKVNWATSPGNQ---------PKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRK-----LPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQDVRVFKDKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWGKENGG 297          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Zebrafish
Match: tia1l (cytotoxic granule-associated RNA binding protein 1, like [Source:ZFIN;Acc:ZDB-GENE-030131-2167])

HSP 1 Score: 162.925 bits (411), Expect = 4.932e-45
Identity = 105/306 (34.31%), Postives = 163/306 (53.27%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEF-DNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNKPMGNQ 930
            M+    +T+YV NL   ++E  +L +F   G C SC++ L+T+      ++EF +N  +A    AMN   +    M V  A       S P   +S+K D S    +FVG +  +I    ++  F+  G++ DA+VVR    G+ KG+ F+SF N+ +A +AIQ MN      R+I+ NWAT+  +       K    G S+K L  EE+  ++  +N +VY   +A  LS+ ++R TF  FG+I  I+ FPEK ++FV +D+H+ AA+AI  +NG  I    +KC WGK+ A        PM  Q
Sbjct:    3 MDEDQPRTLYVGNLSRDVTEALILQVFSQIGPCKSCKMILDTTGNDPYCFVEFYENRHAAAALAAMNGRKILGKDMKVNWA-------STP---SSQKKDTSNHFHVFVGDLSPEISTDDVRAAFAPFGKISDARVVRDLATGKSKGYGFISFINKWDAESAIQQMNGQWLGGRQIRTNWATRKPSAP-----KSNNEGASSKHLSYEEVLNQSSPSNCTVYCGGIASGLSDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFDSHEGAAHAIVSVNGTCIEGHTVKCYWGKETADMRSMQQMPMPQQ 293          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Zebrafish
Match: tia1l (cytotoxic granule-associated RNA binding protein 1, like [Source:ZFIN;Acc:ZDB-GENE-030131-2167])

HSP 1 Score: 161.384 bits (407), Expect = 2.222e-44
Identity = 104/306 (33.99%), Postives = 163/306 (53.27%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEF-DNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNKPMGNQ 930
            M+    +T+YV NL   ++E  +L +F   G C SC++ L+T+      ++EF +N  +A    AMN   +    M V  A       S P   +S+K D S    +FVG +  +I    ++  F+  G++ DA+VV+    G+ KG+ F+SF N+ +A +AIQ MN      R+I+ NWAT+  +       K    G S+K L  EE+  ++  +N +VY   +A  LS+ ++R TF  FG+I  I+ FPEK ++FV +D+H+ AA+AI  +NG  I    +KC WGK+ A        PM  Q
Sbjct:    3 MDEDQPRTLYVGNLSRDVTEALILQVFSQIGPCKSCKMILDTTGNDPYCFVEFYENRHAAAALAAMNGRKILGKDMKVNWA-------STP---SSQKKDTSNHFHVFVGDLSPEISTDDVRAAFAPFGKISDARVVKDLATGKSKGYGFISFINKWDAESAIQQMNGQWLGGRQIRTNWATRKPSAP-----KSNNEGASSKHLSYEEVLNQSSPSNCTVYCGGIASGLSDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFDSHEGAAHAIVSVNGTCIEGHTVKCYWGKETADMRSMQQMPMPQQ 293          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Zebrafish
Match: tia1 (TIA1 cytotoxic granule-associated RNA binding protein [Source:ZFIN;Acc:ZDB-GENE-030131-1506])

HSP 1 Score: 159.844 bits (403), Expect = 2.308e-43
Identity = 106/353 (30.03%), Postives = 180/353 (50.99%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEFDNELSAEKALA-MNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNA--------------AAGGNMNKPMGNQMNQYYDNSQANFDNXXXXXXXXXXPNFFQVPQF 1029
            M+ +  KT+YV NL   ++E  ++ +FG  G C SC++ ++T+      ++EF     A  +LA MN   +   ++ V  A       ++P   +S+K D S    +FVG +  +I    ++  F+  G++ DA+VV+    G+ KG+ FVSF N+ +A  AIQ M       R+I+ NWAT+       PP  K  +  +TK L  +E+  ++  +N +VY   +   L+E ++R TF  FG+I  ++ FP+K ++FV +++H++AA+AI  +NG  +    +KC WGK+                +  G   +P G Q  Q+Y N+Q               PN +QVP +
Sbjct:    2 MDDEQPKTLYVGNLSRDVTEALIMQLFGQIGPCKSCKMIVDTAGNDPYCFVEFFEHRHAAASLAAMNGRKIMGKEVKVNWA-------TSP---SSQKKDTSNHFHVFVGDLSPEITTDDIRAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRK------PPAPKATYETNTKHLSFDEVVNQSSPSNCTVYCGGVTTGLTEQLMRQTFSPFGQIMEVRVFPDKGYSFVRFNSHESAAHAIVSVNGTSLEGHIVKCYWGKETTDMVSPMQQVQVPQQSKVGFAAQPYG-QWGQWYGNAQ---------QISQYVPNGWQVPTY 328          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Zebrafish
Match: tia1 (TIA1 cytotoxic granule-associated RNA binding protein [Source:ZFIN;Acc:ZDB-GENE-030131-1506])

HSP 1 Score: 153.68 bits (387), Expect = 3.397e-41
Identity = 104/347 (29.97%), Postives = 175/347 (50.43%), Query Frame = 1
Query:   61 KTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEFDNELSAEKALA-MNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNA--------------AAGGNMNKPMGNQMNQYYDNSQANFDNXXXXXXXXXXPNFFQVPQF 1029
            K  YV NL   ++E  ++ +FG  G C SC++ ++T+      ++EF     A  +LA MN   +   ++ V  A       ++P   +S+K D S    +FVG +  +I    ++  F+  G++ DA+VV+    G+ KG+ FVSF N+ +A  AIQ M       R+I+ NWAT+       PP  K  +  +TK L  +E+  ++  +N +VY   +   L+E ++R TF  FG+I  ++ FP+K ++FV +++H++AA+AI  +NG  +    +KC WGK+                +  G   +P G Q  Q+Y N+Q               PN +QVP +
Sbjct:    8 KCRYVGNLSRDVTEALIMQLFGQIGPCKSCKMIVDTAGNDPYCFVEFFEHRHAAASLAAMNGRKIMGKEVKVNWA-------TSP---SSQKKDTSNHFHVFVGDLSPEITTDDIRAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRK------PPAPKATYETNTKHLSFDEVVNQSSPSNCTVYCGGVTTGLTEQLMRQTFSPFGQIMEVRVFPDKGYSFVRFNSHESAAHAIVSVNGTSLEGHIVKCYWGKETTDMVSPMQQVQVPQQSKVGFAAQPYG-QWGQWYGNAQ---------QISQYVPNGWQVPTY 328          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Zebrafish
Match: tial1 (TIA1 cytotoxic granule-associated RNA binding protein-like 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1547])

HSP 1 Score: 149.828 bits (377), Expect = 6.832e-40
Identity = 102/319 (31.97%), Postives = 162/319 (50.78%), Query Frame = 1
Query:   43 MESKNN-KTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEFDNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNKPM----GNQMNQYYDNSQ 957
            ME +++ KT+YV NL   ++E  +L +F   G C SC++  E +S     ++EF             D       MN      +EV+ +     +S+K D S    +FVG +  +I    ++  F+  G++ DA+VV+    G+ KG+ FVSF N+ +A  AI  M       R+I+ NWAT+       PP  K     S K L  +E+  ++   N +VY   +   L+E ++R TF  FG+I  I+ FPEK ++F+ + +H++AA+AI  +NG  I    +KC WGK++     N+ +PM      Q NQ Y N Q
Sbjct:    1 MEDESHPKTLYVGNLSRDVTENLILQLFTQIGPCKSCKMITEHTSNDPYCFVEF---------FEHRDAAAALAAMNGRKILGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEITTDDIRAAFAPFGKISDARVVKDMTTGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRK------PPAPKSVQDNSAKQLRFDEVVNQSSPQNCTVYCGGIQSGLTEHLMRQTFSPFGQIMEIRVFPEKGYSFIRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMAKNV-QPMEYGQWGQWNQMYGNPQ 303          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Xenopus
Match: tia1 (TIA1 cytotoxic granule-associated RNA binding protein [Source:NCBI gene;Acc:394890])

HSP 1 Score: 155.606 bits (392), Expect = 8.101e-42
Identity = 107/349 (30.66%), Postives = 176/349 (50.43%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEFDNELSAEKALA-MNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTK--TLEEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNKPMGNQMNQYYDNSQANFDNXXXXXXXXXXPNFFQVPQFYNNS-QMGSY 1056
            ME    +T+YV NL   ++E  +L +F   G C SC++ ++T+      ++EF     A  +LA MN   +   ++ V  A       + P   +S+K D +    +FVG +  +I    +K  F+  G++ DA+VV+    G+ KG+ FVSF N+ +A  AI  M       R+I+ NWAT+       PP  K  +  +TK  T EE+  ++  +N +VY   +   L+E ++R TF  FG+I  ++ FP+K ++FV + +H++AA+AI  +NG  I    +KC WGK+           M N + Q  + SQ +F            P + Q  Q+Y  + Q+G Y
Sbjct:    1 MEEDLPRTLYVGNLSRDVTEPLILQVFSQLGPCKSCKMIMDTAGNDPYCFVEFFEHRHAAASLAAMNGRKIMGKEVKVNWA-------TTP---SSQKKDANNHFHVFVGDLSPEITTDDIKAAFAPFGRISDARVVKDMTTGKSKGYGFVSFFNKWDAENAIAQMGGQWLGGRQIRTNWATRK------PPAPKSTYESNTKQLTYEEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEVRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKETPD--------MLNPVQQVSEASQISFP-----------PPYGQWGQWYGGAQQIGQY 314          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Xenopus
Match: tia1 (TIA1 cytotoxic granule-associated RNA binding protein [Source:NCBI gene;Acc:394890])

HSP 1 Score: 154.066 bits (388), Expect = 3.407e-41
Identity = 107/353 (30.31%), Postives = 175/353 (49.58%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEFDNELSAEKALA-MNDTPMDSNQMNVVIAYVEEVQ----NSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTK--TLEEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNKPMGNQMNQYYDNSQANFDNXXXXXXXXXXPNFFQVPQFYNNS-QMGSY 1056
            ME    +T+YV NL   ++E  +L +F   G C SC++ ++T+      ++EF     A  +LA MN   +   ++ V  A     Q    NS+      +  D+     +FVG +  +I    +K  F+  G++ DA+VV+    G+ KG+ FVSF N+ +A  AI  M       R+I+ NWAT+       PP  K  +  +TK  T EE+  ++  +N +VY   +   L+E ++R TF  FG+I  ++ FP+K ++FV + +H++AA+AI  +NG  I    +KC WGK+           M N + Q  + SQ +F            P + Q  Q+Y  + Q+G Y
Sbjct:    1 MEEDLPRTLYVGNLSRDVTEPLILQVFSQLGPCKSCKMIMDTAGNDPYCFVEFFEHRHAAASLAAMNGRKIMGKEVKVNWATTPSSQKKDANSSSVVSTLRSQDH---FHVFVGDLSPEITTDDIKAAFAPFGRISDARVVKDMTTGKSKGYGFVSFFNKWDAENAIAQMGGQWLGGRQIRTNWATRK------PPAPKSTYESNTKQLTYEEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEVRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKETPD--------MLNPVQQVSEASQISFP-----------PPYGQWGQWYGGAQQIGQY 325          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Xenopus
Match: tia1 (TIA1 cytotoxic granule-associated RNA binding protein [Source:NCBI gene;Acc:394890])

HSP 1 Score: 150.984 bits (380), Expect = 4.852e-40
Identity = 107/347 (30.84%), Postives = 175/347 (50.43%), Query Frame = 1
Query:   55 NNKTI--YVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEFDNELSAEKALA-MNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTK--TLEEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNKPMGNQMNQYYDNSQANFDNXXXXXXXXXXPNFFQVPQFYNNS-QMGSY 1056
            + KTI  YV NL   ++E  +L +F   G C SC++ ++T+      ++EF     A  +LA MN   +   ++ V  A       + P   +S+K D +    +FVG +  +I    +K  F+  G++ DA+VV+    G+ KG+ FVSF N+ +A  AI  M       R+I+ NWAT+       PP  K  +  +TK  T EE+  ++  +N +VY   +   L+E ++R TF  FG+I  ++ FP+K ++FV + +H++AA+AI  +NG  I    +KC WGK+           M N + Q  + SQ +F            P + Q  Q+Y  + Q+G Y
Sbjct:    5 DTKTILLYVGNLSRDVTEPLILQVFSQLGPCKSCKMIMDTAGNDPYCFVEFFEHRHAAASLAAMNGRKIMGKEVKVNWA-------TTP---SSQKKDANNHFHVFVGDLSPEITTDDIKAAFAPFGRISDARVVKDMTTGKSKGYGFVSFFNKWDAENAIAQMGGQWLGGRQIRTNWATRK------PPAPKSTYESNTKQLTYEEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEVRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKETPD--------MLNPVQQVSEASQISFP-----------PPYGQWGQWYGGAQQIGQY 316          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Xenopus
Match: tia1 (TIA1 cytotoxic granule-associated RNA binding protein [Source:NCBI gene;Acc:394890])

HSP 1 Score: 148.288 bits (373), Expect = 6.170e-39
Identity = 104/344 (30.23%), Postives = 170/344 (49.42%), Query Frame = 1
Query:   70 YVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEFDNELSAEKALA-MNDTPMDSNQMNVVIAYVEEVQ----NSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTK--TLEEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNKPMGNQMNQYYDNSQANFDNXXXXXXXXXXPNFFQVPQFYNNS-QMGSY 1056
            YV NL   ++E  +L +F   G C SC++ ++T+      ++EF     A  +LA MN   +   ++ V  A     Q    NS+      +  D+     +FVG +  +I    +K  F+  G++ DA+VV+    G+ KG+ FVSF N+ +A  AI  M       R+I+ NWAT+       PP  K  +  +TK  T EE+  ++  +N +VY   +   L+E ++R TF  FG+I  ++ FP+K ++FV + +H++AA+AI  +NG  I    +KC WGK+           M N + Q  + SQ +F            P + Q  Q+Y  + Q+G Y
Sbjct:   19 YVGNLSRDVTEPLILQVFSQLGPCKSCKMIMDTAGNDPYCFVEFFEHRHAAASLAAMNGRKIMGKEVKVNWATTPSSQKKDANSSSVVSTLRSQDH---FHVFVGDLSPEITTDDIKAAFAPFGRISDARVVKDMTTGKSKGYGFVSFFNKWDAENAIAQMGGQWLGGRQIRTNWATRK------PPAPKSTYESNTKQLTYEEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEVRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKETPD--------MLNPVQQVSEASQISFP-----------PPYGQWGQWYGGAQQIGQY 334          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Xenopus
Match: tial1 (Xenopus tropicalis TIA1 cytotoxic granule-associated RNA binding protein-like 1 (tial1), mRNA. [Source:RefSeq mRNA;Acc:NM_001369612])

HSP 1 Score: 142.124 bits (357), Expect = 8.023e-37
Identity = 95/311 (30.55%), Postives = 153/311 (49.20%), Query Frame = 1
Query:   61 KTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETS-----SAYIEF-------DNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNKPMGNQMNQY 942
            +T+YV NL   ++E  +L +F   G C SC++  E +      A + F       ++     +     D       MN      +EV+ +     +S+K D S    +FVG +  +I    +K  F+  G++ DA+VV+    G+ KG+ FVSF N+ +A  AI  M       R+I+ NWAT+       PP  K     +TK L  E++  ++   N +VY   +   L+E ++R TF  FG+I  I+ FPEK ++F+ + THD+AA+AI  +NG  I    +KC WGK+      N  +   +Q  Q+
Sbjct:    8 RTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEQTDSRRVGASVSFPVLPNTNNDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRK------PPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIGSGLTEQLMRQTFGVFGQILEIRVFPEKGYSFIRFSTHDSAAHAIVSVNGTTIEGHVVKCYWGKETPDMTKNFQQVDYSQWGQW 312          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Mouse
Match: Tia1 (cytotoxic granule-associated RNA binding protein 1 [Source:MGI Symbol;Acc:MGI:107914])

HSP 1 Score: 155.606 bits (392), Expect = 5.987e-42
Identity = 106/346 (30.64%), Postives = 175/346 (50.58%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEF-DNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNK-------PMGNQMNQYYDNSQANFDNXXXXXXXXXXPNFFQVPQF 1029
            ME +  KT+YV NL   ++E  +L +F   G C +C++ ++T+      ++EF ++  +A    AMN   +   ++ V  A       + P   +S+K D S    +FVG +  +I    +K  F+  G++ DA+VV+    G+ KG+ FVSF N+ +A  AIQ M       R+I+ NWAT+       PP  K  +  +TK L  +E+  ++   N +VY   +   L+E ++R TF  FG+I  I+ FP+K ++FV + +H++AA+AI  +NG  I    +KC WGK+       + +       P   Q  Q+Y N+Q               PN +QVP +
Sbjct:    1 MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWA-------TTP---SSQKKDTSNHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRK------PPAPKSTYESNTKQLSYDEVVSQSSPNNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPPTYGQWGQWYGNAQ---------QIGQYVPNGWQVPAY 321          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Mouse
Match: Tia1 (cytotoxic granule-associated RNA binding protein 1 [Source:MGI Symbol;Acc:MGI:107914])

HSP 1 Score: 154.836 bits (390), Expect = 1.377e-41
Identity = 106/348 (30.46%), Postives = 175/348 (50.29%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSSA------YIEF-DNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNK-------PMGNQMNQYYDNSQANFDNXXXXXXXXXXPNFFQVPQF 1029
            ME +  KT+YV NL   ++E  +L +F   G C +C++ ++  +A      ++EF ++  +A    AMN   +   ++ V  A       + P   +S+K D S    +FVG +  +I    +K  F+  G++ DA+VV+    G+ KG+ FVSF N+ +A  AIQ M       R+I+ NWAT+       PP  K  +  +TK L  +E+  ++   N +VY   +   L+E ++R TF  FG+I  I+ FP+K ++FV + +H++AA+AI  +NG  I    +KC WGK+       + +       P   Q  Q+Y N+Q               PN +QVP +
Sbjct:    1 MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDVRTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWA-------TTP---SSQKKDTSNHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRK------PPAPKSTYESNTKQLSYDEVVSQSSPNNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPPTYGQWGQWYGNAQ---------QIGQYVPNGWQVPAY 323          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Mouse
Match: Tia1 (cytotoxic granule-associated RNA binding protein 1 [Source:MGI Symbol;Acc:MGI:107914])

HSP 1 Score: 151.754 bits (382), Expect = 1.715e-40
Identity = 104/350 (29.71%), Postives = 174/350 (49.71%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEF-DNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQ----NSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNK-------PMGNQMNQYYDNSQANFDNXXXXXXXXXXPNFFQVPQF 1029
            ME +  KT+YV NL   ++E  +L +F   G C +C++ ++T+      ++EF ++  +A    AMN   +   ++ V  A     Q    +S+      +  D+     +FVG +  +I    +K  F+  G++ DA+VV+    G+ KG+ FVSF N+ +A  AIQ M       R+I+ NWAT+       PP  K  +  +TK L  +E+  ++   N +VY   +   L+E ++R TF  FG+I  I+ FP+K ++FV + +H++AA+AI  +NG  I    +KC WGK+       + +       P   Q  Q+Y N+Q               PN +QVP +
Sbjct:    1 MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDH---FHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRK------PPAPKSTYESNTKQLSYDEVVSQSSPNNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPPTYGQWGQWYGNAQ---------QIGQYVPNGWQVPAY 332          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Mouse
Match: Tia1 (cytotoxic granule-associated RNA binding protein 1 [Source:MGI Symbol;Acc:MGI:107914])

HSP 1 Score: 151.754 bits (382), Expect = 1.974e-40
Identity = 104/350 (29.71%), Postives = 174/350 (49.71%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEF-DNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQ----NSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNK-------PMGNQMNQYYDNSQANFDNXXXXXXXXXXPNFFQVPQF 1029
            ME +  KT+YV NL   ++E  +L +F   G C +C++ ++T+      ++EF ++  +A    AMN   +   ++ V  A     Q    +S+      +  D+     +FVG +  +I    +K  F+  G++ DA+VV+    G+ KG+ FVSF N+ +A  AIQ M       R+I+ NWAT+       PP  K  +  +TK L  +E+  ++   N +VY   +   L+E ++R TF  FG+I  I+ FP+K ++FV + +H++AA+AI  +NG  I    +KC WGK+       + +       P   Q  Q+Y N+Q               PN +QVP +
Sbjct:    1 MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDH---FHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRK------PPAPKSTYESNTKQLSYDEVVSQSSPNNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPPTYGQWGQWYGNAQ---------QIGQYVPNGWQVPAY 332          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Mouse
Match: Tial1 (Tia1 cytotoxic granule-associated RNA binding protein-like 1 [Source:MGI Symbol;Acc:MGI:107913])

HSP 1 Score: 148.673 bits (374), Expect = 2.286e-39
Identity = 99/311 (31.83%), Postives = 156/311 (50.16%), Query Frame = 1
Query:   61 KTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEFDNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNK---PMGNQMNQYYDNSQ 957
            +T+YV NL   ++E  +L +F   G C SC++  E +S     ++EF             D       MN      +EV+ +     +S+K D S    +FVG +  +I    +K  F+  G++ DA+VV+    G+ KG+ FVSF N+ +A  AI  M       R+I+ NWAT+       PP  K     +TK L  E++  ++   N +VY   +A  L++ ++R TF  FG+I  I+ FPEK ++FV + TH++AA+AI  +NG  I    +KC WGK++     N  +       Q +Q Y N Q
Sbjct:    9 RTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTSNDPYCFVEF---------YEHRDAAAALAAMNGRKILGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRK------PPAPKSTQETNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQ 304          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. UniProt/SwissProt
Match: sp|P52912|TIA1_MOUSE (Nucleolysin TIA-1 OS=Mus musculus OX=10090 GN=Tia1 PE=1 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 1.200e-39
Identity = 104/350 (29.71%), Postives = 174/350 (49.71%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEF-DNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQ----NSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNK-------PMGNQMNQYYDNSQANFDNXXXXXXXXXXPNFFQVPQF 1029
            ME +  KT+YV NL   ++E  +L +F   G C +C++ ++T+      ++EF ++  +A    AMN   +   ++ V  A     Q    +S+      +  D+     +FVG +  +I    +K  F+  G++ DA+VV+    G+ KG+ FVSF N+ +A  AIQ M       R+I+ NWAT+       PP  K  +  +TK L  +E+  ++   N +VY   +   L+E ++R TF  FG+I  I+ FP+K ++FV + +H++AA+AI  +NG  I    +KC WGK+       + +       P   Q  Q+Y N+Q               PN +QVP +
Sbjct:    1 MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDH---FHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRK------PPAPKSTYESNTKQLSYDEVVSQSSPNNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPPTYGQWGQWYGNAQ---------QIGQYVPNGWQVPAY 332          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. UniProt/SwissProt
Match: sp|P31483|TIA1_HUMAN (Nucleolysin TIA-1 isoform p40 OS=Homo sapiens OX=9606 GN=TIA1 PE=1 SV=3)

HSP 1 Score: 150.984 bits (380), Expect = 2.712e-39
Identity = 107/351 (30.48%), Postives = 178/351 (50.71%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEF-DNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQ----NSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKK-----NAAAGGNM---NKPMGNQMNQYYDNSQANFDNXXXXXXXXXXPNFFQVPQF 1029
            ME +  KT+YV NL   ++E  +L +F   G C +C++ ++T+      ++EF ++  +A    AMN   +   ++ V  A     Q    +S+      +  D+     +FVG +  +I    +K  F+  G++ DA+VV+    G+ KG+ FVSF N+ +A  AIQ M       R+I+ NWAT+       PP  K  +  +TK L  +E+  ++  +N +VY   +   L+E ++R TF  FG+I  I+ FP+K ++FV +++H++AA+AI  +NG  I    +KC WGK+     N     N     +P G Q  Q+Y N+Q               PN +QVP +
Sbjct:    1 MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDH---FHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRK------PPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPQPYG-QWGQWYGNAQ---------QIGQYMPNGWQVPAY 332          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. UniProt/SwissProt
Match: sp|Q01085|TIAR_HUMAN (Nucleolysin TIAR OS=Homo sapiens OX=9606 GN=TIAL1 PE=1 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 1.768e-38
Identity = 99/311 (31.83%), Postives = 156/311 (50.16%), Query Frame = 1
Query:   61 KTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEFDNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNK---PMGNQMNQYYDNSQ 957
            +T+YV NL   ++E  +L +F   G C SC++  E +S     ++EF             D       MN      +EV+ +     +S+K D S    +FVG +  +I    +K  F+  G++ DA+VV+    G+ KG+ FVSF N+ +A  AI  M       R+I+ NWAT+       PP  K     +TK L  E++  ++   N +VY   +A  L++ ++R TF  FG+I  I+ FPEK ++FV + TH++AA+AI  +NG  I    +KC WGK++     N  +       Q +Q Y N Q
Sbjct:    9 RTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTSNDPYCFVEF---------YEHRDAAAALAAMNGRKILGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRK------PPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQ 304          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. UniProt/SwissProt
Match: sp|P70318|TIAR_MOUSE (Nucleolysin TIAR OS=Mus musculus OX=10090 GN=Tial1 PE=1 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 1.469e-35
Identity = 99/319 (31.03%), Postives = 155/319 (48.59%), Query Frame = 1
Query:   61 KTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLET-------SSAYIEFDNELSAE-----KALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNK---PMGNQMNQYYDNSQ 957
            +T+YV NL   ++E  +L +F   G C SC++  E        SS         S +     +     D       MN      +EV+ +     +S+K D S    +FVG +  +I    +K  F+  G++ DA+VV+    G+ KG+ FVSF N+ +A  AI  M       R+I+ NWAT+       PP  K     +TK L  E++  ++   N +VY   +A  L++ ++R TF  FG+I  I+ FPEK ++FV + TH++AA+AI  +NG  I    +KC WGK++     N  +       Q +Q Y N Q
Sbjct:    9 RTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEQPDSRRVNSSVGFSVLQHTSNDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRK------PPAPKSTQETNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQ 321          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. UniProt/SwissProt
Match: sp|Q9SYG4|UBP1A_ARATH (Oligouridylate-binding protein 1A OS=Arabidopsis thaliana OX=3702 GN=UBP1A PE=1 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 4.297e-29
Identity = 96/303 (31.68%), Postives = 146/303 (48.18%), Query Frame = 1
Query:   61 KTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSSAY---IEFDNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTL--------EEISYE-APETN---TSVYVMAENLSEDILRPTFERF------GKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYK-INSIELKCNWGKKNAAAG 900
            +++Y  N+ + ++E  L  IF S G   SC+L  +  S+Y     FD   ++   + +N   +    M V  AY              ++ D S+   IFVG +  ++ +A L D FS      DA+V+     G+ +GF FVSF N+ +A  AI  MN     +R+I+CNWATK   G     +K  + G+S   L         E+S E APE N   T+VYV   NLS ++ +    R       G I+ ++   +K   FV Y+THD AA AIQ  N    + S +++C+WG K   +G
Sbjct:   63 RSVYAGNIHTQVTEILLQEIFASTGPIESCKLIRKDKSSYGFVHYFDRRCASMAIMTLNGRHIFGQPMKVNWAYA-----------TGQREDTSSHFNIFVGDLSPEVTDAALFDSFSAFNSCSDARVMWDQKTGRSRGFGFVSFRNQQDAQTAINEMNGKWVSSRQIRCNWATK---GATFGEDKHSSDGKSVVELTNGSSEDGRELSNEDAPENNPQFTTVYV--GNLSPEVTQLDLHRLFYTLGAGVIEEVRVQRDKGFGFVRYNTHDEAALAIQMGNAQPFLFSRQIRCSWGNKPTPSG 349          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. TrEMBL
Match: D5JG75 (TIA1-like protein (Fragment) OS=Dugesia japonica OX=6161 GN=TIAL-1 PE=2 SV=1)

HSP 1 Score: 580.096 bits (1494), Expect = 0.000e+0
Identity = 315/438 (71.92%), Postives = 352/438 (80.37%), Query Frame = 1
Query:   61 KTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSSAYIEFDNELSAEKALAMNDTPMDSNQMNVVIAYVEEV-QNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVMAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNKPM----GNQMNQYYDNSQANFDNXXXXXXXXXXPNFFQVPQFYNNSQMGSYYNSAPNXXXXXXXXXXXXXNSNANFSNP---------QGNFIAQPNLLGQPKVSYGGQLKSNLKAIPKAPISSQTKPRMNRAPHPYNKPKVNNANQFNTYQ 1332
            KTIY+SNLPSPISEEDLLSIFGSFG C+SC+LNLET +AYIEFDNE SAEKALAMN+TPM+SNQM+V IAYV+ V QN   Y +ASKKVDYS  VQIFVGGIGFDIDEA LK+GF+HCGQV+D KVVR  DGQHKGFAFVSFSNE +A +AIQ MNNTMFHNRKIQCNWATK+KN NG P N K    +  KTLE+ISYEAPE+NTSVYV+ E+L+E++LRP FERFGKIKN+KAFPEKNHAFVNYDTHDAAAYAIQQLNGYKIN+IELKCNWGKKNAA G   N+ M    GNQMN YYDN+QANF NYQQQ+DQY Q   +QVPQ++NN+QMGS+YN  PN      P FQ       NF NP         QGNF+AQPNLLGQPK SYG Q K+N KA PK     + KPRMNRAPHPYNKPK N  NQ+NTYQ
Sbjct:    1 KTIYISNLPSPISEEDLLSIFGSFGACVSCELNLETLTAYIEFDNESSAEKALAMNNTPMESNQMSVEIAYVDNVVQNVTSYTLASKKVDYSQSVQIFVGGIGFDIDEAILKEGFAHCGQVLDTKVVRSNDGQHKGFAFVSFSNESDANSAIQKMNNTMFHNRKIQCNWATKNKNSNGAPFNPKFNPTKFNKTLEDISYEAPESNTSVYVLGESLTEELLRPIFERFGKIKNVKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINNIELKCNWGKKNAALGNANNQSMGNQYGNQMNPYYDNTQANFYNYQQQFDQYYQAG-YQVPQYFNNTQMGSFYNPMPN-----YPQFQNPYGGQQNFINPNQNNYPAPNQGNFVAQPNLLGQPKGSYGAQPKNNFKAGPKG-FPGEPKPRMNRAPHPYNKPKPN--NQYNTYQ 429          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. TrEMBL
Match: D5JG76 (TIA1-like protein (Fragment) OS=Dugesia japonica OX=6161 GN=TIAL-2 PE=2 SV=1)

HSP 1 Score: 290.812 bits (743), Expect = 5.465e-89
Identity = 177/447 (39.60%), Postives = 261/447 (58.39%), Query Frame = 1
Query:   40 KMESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSSAYIEFDNELSAEKALAMNDTPMDSNQMNVVIAY------VEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVMAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGN-----------MNKPMGNQMNQYYDNSQANFDNXXXXXXXXXXPNFFQVPQFYNNSQMGSYYNSAP--NXXXXXXXXXXXXXNSNANFSNPQGNFIAQPNLLGQPKVSYGGQLKSNLKAIPKAPISSQTKPRMNR-APHPYNKPKVNNANQF 1320
            KME++N KTIY+S LP+ ++EEDLLSIF ++G+C+SC+LN E  +AY+EFDNE SA  AL+MN   M + ++ ++IAY       +E Q ++  F+   K D STP QIFVG IG ++DEA L+ GF H G++ID KV+R PDG+ KG+ FV+FS+E EA  AI  MN T FH+ KI+C+W  K+K    V  NK      + ++L++I  E P++ T+V+V  EN+++++L P F +FG IKNIKAFP+ N +F+NY +H+AAA AI Q+NG+ +N++ELKC+W  K+   G             + KP  + + + + N       Y+ +YD         + QF     + + Y   P   Y    +   + Q + N NFS  + +FI               Q KS     P   I +Q KP +NR A +PY KP +N   +F
Sbjct:   17 KMENRNTKTIYISCLPNSVTEEDLLSIFENYGLCVSCELNSEECTAYVEFDNETSARNALSMNGIEMGATRIQIIIAYDYTSAFEQEYQMNSKNFLG--KTDDSTPTQIFVGNIGSNVDEAILEGGFEHLGKIIDTKVIRDPDGKPKGYGFVTFSSEFEAKNAIDRMNETFFHDEKIKCSWG-KNKTNVTVTLNK-----NAVRSLQDILSETPKSYTNVFVTGENVTQEMLEPHFVKFGTIKNIKAFPKNNQSFINYYSHEAAANAIHQMNGFLLNNVELKCSWAIKSEKPGKKIKFTRQQQQPPIKKPRKHLLPKTFSNVTTTRQAYESKYDSGYGGIGGGLSQF--QQSLTNPYQEQPFHPYSLPAVYPNEYQYDDNYNFSTARSHFI---------------QSKSVPNVQPLMGILAQPKPALNRVATNPYRKPILNKPGKF 438          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. TrEMBL
Match: D5JG77 (TIA1-like protein OS=Dugesia japonica OX=6161 GN=TIAL-3 PE=2 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 4.288e-86
Identity = 149/288 (51.74%), Postives = 195/288 (67.71%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS-----AYIEFDNELSAEKAL-AMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVMAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKN 888
            M  KNN+TIYV NLP  ++++ L+ IFG+FG CISC +  + S      A+IE+ +  SA  AL AM+   M +NQ+ V  +         P  VAS K+DYS  VQIFVG IG D+DE  LK+GFS  GQ+IDAKVVR PDGQ +GFAFVSFSN DEA  AIQSM+ T FHNR I+CNWAT+    NG+   + + +  + +  E +  EAP TNT+VYV  ENL+E++L   F+ FG+I ++K +PEK HAF+N+ TH+AAA AI Q +GYKIN   +KCNWGK+N
Sbjct:    1 MSFKNNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHSSASLALSAMDGIYMWNNQIKVNWSSGPSAV-PGPAAVASAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATR----NGLDGEQFIKY--TPRPYELVYKEAPLTNTNVYVAGENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKEN 281          

HSP 2 Score: 68.5514 bits (166), Expect = 7.520e-9
Identity = 47/192 (24.48%), Postives = 91/192 (47.40%), Query Frame = 1
Query:  346 IFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKA--FPE---KNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAG 900
            I+VG +   +++  L   F + GQ I   ++R    Q   +AF+ +++   A  A+ +M+     N +I+ NW   S   + VP       G +     +I Y     +  ++V  +  ++ E +L+  F +FG++ + K   +P+   +  AFV++   D A  AIQ ++    ++  +KCNW  +N   G
Sbjct:    9 IYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHSSASLALSAMDGIYMWNNQIKVNW---SSGPSAVP-------GPAAVASAKIDYS---NSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDG 187          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. TrEMBL
Match: D5JG78 (TIA1-like protein (Fragment) OS=Dugesia japonica OX=6161 GN=TIAL-4 PE=2 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 4.604e-77
Identity = 137/289 (47.40%), Postives = 191/289 (66.09%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS-----AYIEFDNELSAEKALA-MNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKK 885
            M+ +NN+TIYV NLP  I++  LL IFG+FG C+ C +  + S      A+IE+ N  +A  ALA M+   M +NQ+ V  +    V   A    +S K+DYS  +QIFVG IG D+DEA LK+GFS  G V+DAKVVR  DGQ +GFAFV+FS  D+A  AI+ M+ T FHNR I+CNWAT+    NG+  ++ + +  + +  E +  EAP TNT+VY+  + E L+E+++R  FE FG+I  +K +PEK HAF+N+ TH++AA AI Q +GYKIN   +KCNWGK+
Sbjct:    1 MDIRNNRTIYVGNLPDAITDHLLLRIFGNFGQCVGCHIIRDFSCQTNPYAFIEYTNHSAASLALAAMDGIFMWNNQIKVNWSSGNSVNTVASSLPSSNKIDYSNTIQIFVGDIGLDVDEAMLKEGFSEFGPVVDAKVVRYQDGQSRGFAFVAFSKRDDAEKAIEKMHKTWFHNRTIKCNWATR----NGLDGDQFIKY--TPRPYELVYKEAPLTNTNVYIAGIPEGLTEELIRVHFEEFGRIDAVKVYPEKAHAFINFVTHESAARAISQRHGYKINDNVIKCNWGKE 283          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. TrEMBL
Match: A4V6J5 (Polyadenylate-binding protein (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 7.168e-57
Identity = 99/195 (50.77%), Postives = 136/195 (69.74%), Query Frame = 1
Query:   40 KMESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSSAYIEFDNELSAEKALAMNDTPMDSNQMNVVIAY------VEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNK 606
            KME++N KTIY+S LP+ ++EEDLLSIF ++G+C+SC+LN E  +AY+EFDNE SA  AL+MN   M + ++ ++IAY       +E Q ++  F+   K D STP QIFVG IG ++DEA L+ GF H G++ID KV+R PDG+ KG+ FV+FS+E EA  AI  MN T FH+ KI+C+W  K+K    V  NK
Sbjct:    7 KMENRNTKTIYISCLPNSVTEEDLLSIFENYGLCVSCELNSEECTAYVEFDNETSARNALSMNGIEMGATRIQIIIAYDYTSAFEQEYQMNSKNFLG--KTDDSTPTQIFVGNIGSNVDEAILEGGFEHLGKIIDTKVIRDPDGKPKGYGFVTFSSEFEAKNAIDRMNETFFHDEKIKCSWG-KNKTNVTVTLNK 198          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Cavefish
Match: tia1l (TIA1 cytotoxic granule associated RNA binding protein [Source:NCBI gene;Acc:103030565])

HSP 1 Score: 161.77 bits (408), Expect = 1.167e-44
Identity = 103/304 (33.88%), Postives = 160/304 (52.63%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEFDNELSAEKAL-AMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQS-TKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNKPM 921
            M+    KT+YV NL   ++E  +L +F   G C SC++ ++T+      ++EF   + A  AL AMN   +    M V  A       S P   +S+K D S    +FVG +  +I    +K  F+  G++ DA+VV+    G+ KG+ F+SF N+ +A  AIQ MN      R+I+ NWAT+       PP  K  +    TK L  EE+  ++  +N +VY   +   L++ ++R TF  FG+I  I+ FP+K ++FV +D+H+ AA+AI  +NG  I    +KC WGK+ A        PM
Sbjct:    2 MDDDQPKTLYVGNLSRDVTEALILQVFTQIGPCKSCKMIIDTAGNDPYCFVEFYEHMHAAAALGAMNGRKILGKDMKVNWA-------SMP---SSQKKDTSNHFHVFVGDLSPEISTDDVKAAFAPFGKISDARVVKDLATGKSKGYGFISFINKWDAENAIQQMNGQWLGGRQIRTNWATRK------PPAPKSNYETGNTKHLSYEEVLSQSSPSNCTVYCGGVTSGLTDQLMRQTFSPFGQIMEIRVFPDKGYSFVRFDSHEGAAHAIVSVNGTCIEGHTVKCYWGKETADMRAMQQMPM 289          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Cavefish
Match: tia1l (TIA1 cytotoxic granule associated RNA binding protein [Source:NCBI gene;Acc:103030565])

HSP 1 Score: 161.77 bits (408), Expect = 1.167e-44
Identity = 103/304 (33.88%), Postives = 160/304 (52.63%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEFDNELSAEKAL-AMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQS-TKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNKPM 921
            M+    KT+YV NL   ++E  +L +F   G C SC++ ++T+      ++EF   + A  AL AMN   +    M V  A       S P   +S+K D S    +FVG +  +I    +K  F+  G++ DA+VV+    G+ KG+ F+SF N+ +A  AIQ MN      R+I+ NWAT+       PP  K  +    TK L  EE+  ++  +N +VY   +   L++ ++R TF  FG+I  I+ FP+K ++FV +D+H+ AA+AI  +NG  I    +KC WGK+ A        PM
Sbjct:    2 MDDDQPKTLYVGNLSRDVTEALILQVFTQIGPCKSCKMIIDTAGNDPYCFVEFYEHMHAAAALGAMNGRKILGKDMKVNWA-------SMP---SSQKKDTSNHFHVFVGDLSPEISTDDVKAAFAPFGKISDARVVKDLATGKSKGYGFISFINKWDAENAIQQMNGQWLGGRQIRTNWATRK------PPAPKSNYETGNTKHLSYEEVLSQSSPSNCTVYCGGVTSGLTDQLMRQTFSPFGQIMEIRVFPDKGYSFVRFDSHEGAAHAIVSVNGTCIEGHTVKCYWGKETADMRAMQQMPM 289          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Cavefish
Match: tial1 (TIA1 cytotoxic granule associated RNA binding protein like 1 [Source:NCBI gene;Acc:103030475])

HSP 1 Score: 145.976 bits (367), Expect = 1.721e-38
Identity = 93/286 (32.52%), Postives = 151/286 (52.80%), Query Frame = 1
Query:   61 KTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEFDNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNG-NGVPPNKKMAFGQSTKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKN 888
            KT+YV NL   ++E  +L +F   G C SC++  E +S     ++EF             D       MN      +EV+ +     +S+K D S    +FVG +  +I    ++  F+  G++ DA+VV+    G+ KG+ FVSF N+ +A  AI  M       R+I+ NWAT+       V  +K++A   S+K L  E++  ++   N +VY   +   LSE ++R TF  FG+I  I+ FPEK ++F+ + +H++AA+AI  +NG  I S  +KC WGK++
Sbjct:    8 KTLYVGNLSRDVTENLILQLFTQIGPCKSCKMITEHTSNDPYCFVEF---------FEHRDAAAALAAMNGRKILGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEITTDDIRAAFAPFGKISDARVVKDMTTGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSVQDSKQIAHLGSSKQLRFEDVVNQSSPQNCTVYCGGIQSGLSEHLIRQTFSPFGQIMEIRVFPEKGYSFIRFSSHESAAHAIVSVNGTTIESHIVKCYWGKES 284          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Cavefish
Match: tia1l (TIA1 cytotoxic granule associated RNA binding protein [Source:NCBI gene;Acc:103030565])

HSP 1 Score: 129.413 bits (324), Expect = 2.758e-33
Identity = 86/260 (33.08%), Postives = 137/260 (52.69%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEFDNELSAEKAL-AMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVN 792
            M+    KT+YV NL   ++E  +L +F   G C SC++ ++T+      ++EF   + A  AL AMN   +    M V  A       S P   +S+K D S    +FVG +  +I    +K  F+  G++ DA+VV+    G+ KG+ F+SF N+ +A  AIQ MN      R+I+ NWAT+       PP  K  +  +TK L  EE+  ++  +N +VY   +   L++ ++R TF  FG+I  I+ FP+K ++FV 
Sbjct:    1 MDDDQPKTLYVGNLSRDVTEALILQVFTQIGPCKSCKMIIDTAGNDPYCFVEFYEHMHAAAALGAMNGRKILGKDMKVNWA-------SMP---SSQKKDTSNHFHVFVGDLSPEISTDDVKAAFAPFGKISDARVVKDLATGKSKGYGFISFINKWDAENAIQQMNGQWLGGRQIRTNWATRK------PPAPKSNYESNTKHLSYEEVLSQSSPSNCTVYCGGVTSGLTDQLMRQTFSPFGQIMEIRVFPDKGYSFVR 244          

HSP 2 Score: 57.7658 bits (138), Expect = 1.033e-8
Identity = 47/202 (23.27%), Postives = 86/202 (42.57%), Query Frame = 1
Query:  322 VDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVMAENLSEDI----LRPTFERFGKI------KNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAA 897
            +D   P  ++VG +  D+ EA +   F+  G     K++    G +  + FV F     A AA+ +MN      + ++ NWA+       +P ++K                  +T+   +V   +LS +I    ++  F  FGKI      K++     K + F+++     A  AIQQ+NG  +   +++ NW  +   A
Sbjct:    1 MDDDQPKTLYVGNLSRDVTEALILQVFTQIGPCKSCKMIIDTAG-NDPYCFVEFYEHMHAAAALGAMNGRKILGKDMKVNWAS-------MPSSQKK-----------------DTSNHFHVFVGDLSPEISTDDVKAAFAPFGKISDARVVKDLATGKSKGYGFISFINKWDAENAIQQMNGQWLGGRQIRTNWATRKPPA 177          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Cavefish
Match: ENSAMXT00000035946.1 (polyadenylate-binding protein 1-like [Source:NCBI gene;Acc:103030422])

HSP 1 Score: 80.1073 bits (196), Expect = 1.945e-15
Identity = 66/282 (23.40%), Postives = 120/282 (42.55%), Query Frame = 1
Query:   67 IYVSNLPSPISEEDLLSIFGSFGVCISCQL----NLETSSAYIEFDNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVMAENLSEDILRPTFERFGKIKNIKAFPE----KNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKN 888
            I++ NL   I  + L   F +FG  +SC++    N      ++ F+   +AE+A+   +  + +++   V  +    +  A     +K+        +++   G D+D+ KLKD F   G  +  +V+    G+ KGF FVSF   ++A  A+  MN    + +++    A K           K  F Q  K      Y+    N  V  + + L ++ LR  F  FG I + K   E    K   FV + + + A  A+ ++NG  + +  L     ++ 
Sbjct:  101 IFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAEMGARAKEF-----TNVYIKNFGEDMDDEKLKDVFGKYGPALSIRVMTDESGKSKGFGFVSFERHEDAQRAVDEMNGKELNGKQVYVGRAQKKGERQT---ELKRKFEQ-MKQDRMTRYQG--VNLYVKNLDDGLDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRK 371          

HSP 2 Score: 63.5438 bits (153), Expect = 3.402e-10
Identity = 44/174 (25.29%), Postives = 82/174 (47.13%), Query Frame = 1
Query:  346 IFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHK-GFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVMAENLSEDILRPTFERFGKIKNIKAFPEKN----HAFVNYDTHDAAAYAIQQLNGYKIN 852
            ++VG +  D+ EA L + FS  G ++  +V R    +   G+A+V+F    +A  A+ +MN  +   R ++  W+ +       P  +K   G                N  +  + +++    L  TF  FG I + K   ++N    + FV+++TH+AA  AI+++NG  +N
Sbjct:   13 LYVGDLHQDVTEAMLYEKFSPAGPILSIRVCRDMMTRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPVRIMWSQRD------PSLRKSGVG----------------NIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETHEAAERAIEKMNGMLLN 164          

HSP 3 Score: 61.6178 bits (148), Expect = 1.273e-9
Identity = 47/188 (25.00%), Postives = 86/188 (45.74%), Query Frame = 1
Query:   46 ESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS-----AYIEFDNELSAEKAL-AMNDTPMDSNQMNVVIAYVE-EVQNSAPYFVASKKVDYSTPVQ---IFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSK 579
             +K    +Y+ N    + +E L  +FG +G  +S ++  + S       ++ F+    A++A+  MN   ++  Q+ V  A  + E Q          K D  T  Q   ++V  +   +D+ +L+  FS  G +  AKV+    G+ KGF FV FS+ +EA  A+  MN  +   + +    A + +
Sbjct:  186 RAKEFTNVYIKNFGEDMDDEKLKDVFGKYGPALSIRVMTDESGKSKGFGFVSFERHEDAQRAVDEMNGKELNGKQVYVGRAQKKGERQTELKRKFEQMKQDRMTRYQGVNLYVKNLDDGLDDERLRKEFSPFGTITSAKVMME-GGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKE 372          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Sea Lamprey
Match: tia1l (cytotoxic granule-associated RNA binding protein 1, like [Source:ZFIN;Acc:ZDB-GENE-030131-2167])

HSP 1 Score: 120.939 bits (302), Expect = 2.121e-31
Identity = 67/185 (36.22%), Postives = 106/185 (57.30%), Query Frame = 1
Query:  346 IFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKK 885
            +FVG +  +I    L+  F+  G++ DA+VV+    G+ KG+ FVSF  + +A  AIQ M       R+I+ NWAT+       PP  K +     K L  EE+  ++  TN +VY   + + L+E ++R TF  FG+I  I+ FP+K ++F+ + TH++AA+AI  +NG  I    +KC WGK+
Sbjct:    5 VFVGDLSPEISTDDLRAAFAPFGKISDARVVKDLATGKSKGYGFVSFFQKLDAENAIQQMGGQWLGGRQIRTNWATRK------PPAPKGSQDTDPKHLSFEEVLNQSSPTNCTVYCGGITQGLTEQLMRQTFLLFGQILEIRVFPDKGYSFIRFATHESAAHAIVSVNGSTIEGFSVKCFWGKE 183          

HSP 2 Score: 55.8398 bits (133), Expect = 5.677e-9
Identity = 45/187 (24.06%), Postives = 90/187 (48.13%), Query Frame = 1
Query:   67 IYVSNLPSPISEEDLLSIFGSFGVCISCQL--NLETSSA----YIEFDNELSAEKALA-MNDTPMDSNQMNVVIAYVEE-----VQNSAPYFVASKKV-DYSTPV--QIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKN 582
            ++V +L   IS +DL + F  FG     ++  +L T  +    ++ F  +L AE A+  M    +   Q+    A  +       Q++ P  ++ ++V + S+P    ++ GGI   + E  ++  F   GQ+++ +V   PD   KG++F+ F+  + A  AI S+N +      ++C W  ++ +
Sbjct:    5 VFVGDLSPEISTDDLRAAFAPFGKISDARVVKDLATGKSKGYGFVSFFQKLDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKGSQDTDPKHLSFEEVLNQSSPTNCTVYCGGITQGLTEQLMRQTFLLFGQILEIRVF--PD---KGYSFIRFATHESAAHAIVSVNGSTIEGFSVKCFWGKEASD 186          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Sea Lamprey
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 73.9442 bits (180), Expect = 3.144e-14
Identity = 62/276 (22.46%), Postives = 120/276 (43.48%), Query Frame = 1
Query:   67 IYVSNLPSPISEEDLLSIFGSFGVCISCQL----NLETSSAYIEFDNELSAEKAL-AMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEIS-YEAPETNTSVYVMAENLSEDILRPTFERFGKIKNIKAFPE----KNHAFVNYDTHDAAAYAIQQLNGYKINSIEL 864
            +++ NL   I  + +   F +FG  +SC++    N      ++ F+ + +A++A+  MN   ++            + +      + ++  +++    +++   G D+DE KL++ F   G+ +   V+    G+ +GF FVSF   ++A  A+  MN    + R +    A K          K     Q     E IS Y+    N  V  + +N+ ++ LR  F  +G I + K   E    K   FV + + + A  A+ ++NG  + S  L
Sbjct:  101 VFIKNLDKSIDNKAMYDTFSAFGNILSCKVVCDENGSRGYGFVHFETQEAADRAIEKMNGMLLNDRLARRRFVGRFKSRKEREQEMGARAKEFTN---VYIKNFGDDMDEDKLREFFGKFGKALSVCVMSDECGKSRGFGFVSFEQHEDAQRAVNEMNGKELNGRTVFVGRAQKKGERQAELKRKFEMLKQ-----ERISRYQG--VNLYVKNLDDNIDDEQLRKEFAPYGTITSTKVMSEEGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPL 366          

HSP 2 Score: 60.4622 bits (145), Expect = 5.764e-10
Identity = 42/192 (21.88%), Postives = 86/192 (44.79%), Query Frame = 1
Query:   46 ESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCIS-CQLNLETSSA----YIEFDNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQNSAPY---------FVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSK 579
             +K    +Y+ N    + E+ L   FG FG  +S C ++ E   +    ++ F+    A++A+      M+  ++N    +V   Q               +  +++     V ++V  +  +ID+ +L+  F+  G +   KV+   +G+ KGF FV FS+ +EA  A+  MN  +  ++ +    A + +
Sbjct:  189 RAKEFTNVYIKNFGDDMDEDKLREFFGKFGKALSVCVMSDECGKSRGFGFVSFEQHEDAQRAV----NEMNGKELNGRTVFVGRAQKKGERQAELKRKFEMLKQERISRYQGVNLYVKNLDDNIDDEQLRKEFAPYGTITSTKVM-SEEGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKE 375          

HSP 3 Score: 58.151 bits (139), Expect = 3.452e-9
Identity = 43/174 (24.71%), Postives = 81/174 (46.55%), Query Frame = 1
Query:  346 IFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHK-GFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVMAENLSEDILRPTFERFGKIKNIKAFPEKN----HAFVNYDTHDAAAYAIQQLNGYKIN 852
            ++VG +  D+ EA L + FS  G V+  +V R    +   G+A+V+F    +A  A+ +MN  +   + I+  W+ +       P  +K   G                N  +  + +++    +  TF  FG I + K   ++N    + FV+++T +AA  AI+++NG  +N
Sbjct:   13 LYVGDLHPDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRD------PSLRKSGVG----------------NVFIKNLDKSIDNKAMYDTFSAFGNILSCKVVCDENGSRGYGFVHFETQEAADRAIEKMNGMLLN 164          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Sea Lamprey
Match: sf3b4 (splicing factor 3b, subunit 4 [Source:ZFIN;Acc:ZDB-GENE-020419-22])

HSP 1 Score: 65.0846 bits (157), Expect = 1.582e-11
Identity = 52/185 (28.11%), Postives = 91/185 (49.19%), Query Frame = 1
Query:   46 ESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS------AYIEFDNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQ-NSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDA-KVVRGPD-GQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATK 573
            E   + T+YV  L   +SE  L  +F   G  ++  +  +  +       ++EF  E  A+ A+ +         MN++  Y + ++ N A     +K +D      IF+G +  +IDE  L D FS  G ++   K +R P+ G  KG+AF++F++ + + AAI++MN     NR I  ++A K
Sbjct:    8 ERNQDATVYVGGLDDKVSEALLWELFLQAGPVVNTHMPKDRITQQHQGYGFVEFLGEEDADYAIKI---------MNMIKLYGKPIRVNKA--SAHNKNLDVGA--NIFIGNLDTEIDEKLLYDTFSAFGVILQTPKTMRDPETGNSKGYAFINFASFEASDAAIEAMNGQYLCNRPISVSYAFK 179          

HSP 2 Score: 55.8398 bits (133), Expect = 1.277e-8
Identity = 49/194 (25.26%), Postives = 88/194 (45.36%), Query Frame = 1
Query:  346 IFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGP-DGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVMAENLSEDILRPTFERFGKI----KNIKAFPE----KNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAG 900
            ++VGG+   + EA L + F   G V++  + +     QH+G+ FV F  E++A  AI+ MN    + + I+ N A+          NK +  G                N  +  +   + E +L  TF  FG I    K ++  PE    K +AF+N+ + +A+  AI+ +NG  + +  +  ++  K  + G
Sbjct:   15 VYVGGLDDKVSEALLWELFLQAGPVVNTHMPKDRITQQHQGYGFVEFLGEEDADYAIKIMNMIKLYGKPIRVNKASAH--------NKNLDVG---------------ANIFIGNLDTEIDEKLLYDTFSAFGVILQTPKTMRD-PETGNSKGYAFINFASFEASDAAIEAMNGQYLCNRPISVSYAFKKDSKG 184          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Sea Lamprey
Match: rbm34 (RNA binding motif protein 34 [Source:ZFIN;Acc:ZDB-GENE-040718-77])

HSP 1 Score: 64.3142 bits (155), Expect = 2.454e-11
Identity = 47/192 (24.48%), Postives = 85/192 (44.27%), Query Frame = 1
Query:   46 ESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSSAYIEFDNELSAEKALAMNDTPMDSNQMNVVIAYVEE-------------VQNSAPYFV--ASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPD-GQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATK 573
            E K  +T++V NLP  +++E +   F   GV  S +L           D E+S ++A     T    N  N  + + EE             +Q+     V  AS + ++     +F+G + +D++E +++  F  CG V   +VVR  + G  KGF ++ F   D    A+  ++ +    RK++   + K
Sbjct:  105 EEKRKRTVFVGNLPMSLAKEAVKKFFRPCGVIESVRLRC-----IARADPEMSLKQAAIQGKTHPQRNNKNAYVVFKEEQGAVQALSRNGEEIQSGFHIRVDAASGEKNHDHKRSVFIGNLPYDVEEDRIRSHFEPCGPVESVRVVRDRESGMGKGFGYILFKGTDAVLLALH-LDGSEMAGRKVRVKRSVK 290          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Sea Lamprey
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 62.3882 bits (150), Expect = 1.229e-10
Identity = 57/243 (23.46%), Postives = 107/243 (44.03%), Query Frame = 1
Query:  178 YIEFDNELSAEKAL-AMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFS-HCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVMAENLSEDILRPTFERFGKIKNIKAFPEKNHA----FVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKN 888
            ++ F+ + +A+KA+  MN   M  N   V +   +  +     F  +K  +++    +++   G D+D+ +L++ F  + G+ +  KV+    G+ KGF FVSF   ++A  A+  MN    + R I    A K          K     Q   +     Y+    N  V  + +N++++ L   F  FG I + K   E+  +    FV + + + A  A+ ++NG  I S  L     ++ 
Sbjct:    2 FVHFETQEAADKAIEKMNG--MLLNDRKVFVGRFKSRKEREAEF-GAKAREFTN---VYIKNFGDDMDDERLREYFEQYVGKTLSVKVMMDEGGKSKGFGFVSFERHEDAQKAVDEMNTKELNGRAIYVGRAQKKAERQTELKRKFEMLKQERMS----KYQG--VNLYVKNLDDNINDERLWKEFSPFGTITSAKVMMEEGRSRGFGFVCFSSPEEATKAVTEMNGRIIGSKPLYVALAQRK 232          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 75.8702 bits (185), Expect = 5.529e-15
Identity = 71/288 (24.65%), Postives = 121/288 (42.01%), Query Frame = 1
Query:   64 TIYVSNLPSPISEEDLLSIFGSFG------VCISCQLNLETSSAYIEFDNELSAEKALA-MNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVMAENLSEDILRPTFERFGKIKNIKAFPEKN-------HAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKK 885
            ++YV +L   +SE  L  IF   G      VC           AY+ F++  +  KA+  +N TP+      ++            +      +       IF+  +  DID   L D FS  G ++ +K+    +G+ KGF FV F  E  A  AI ++N  + + ++I             V P+  ++  +    LEE   +A  TN  V  +    +++  +  F +FG I  + A  EK+         FVNY+ H+ A  A++ LN  ++N  +L     +K
Sbjct:   39 SLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIM------------WSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIY------------VAPH--LSRKERDSQLEET--KAHYTNLYVKNINSETTDEQFQELFAKFGPI--VSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQK 296          

HSP 2 Score: 67.0106 bits (162), Expect = 2.948e-12
Identity = 52/202 (25.74%), Postives = 96/202 (47.52%), Query Frame = 1
Query:   25 YFNRQKMESKNNKT------IYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS-----AYIEFDNELSAEKAL-AMNDTPMDSNQMNVVIA-------YVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATK 573
            + +R++ +S+  +T      +YV N+ S  ++E    +F  FG  +S  L  +         ++ ++    A KA+ A+ND+ ++  ++ V  A       +V + Q  A  +   K   Y   V +FV  +   +D+ KL++ F+  G +  AKV+R  +G+ KGF FV FS  +EA  AI   N  +   + +    A +
Sbjct:  201 HLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEA--YRLEKMAKYQG-VNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 65.4698 bits (158), Expect = 6.315e-12
Identity = 50/190 (26.32%), Postives = 89/190 (46.84%), Query Frame = 1
Query:  337 PVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVV--RGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIK--AFPE----KNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNW 876
            P  IFVG + + ID+  LK  F H G VI A+V+  RG D + +G+ +V F N+  A  AIQ M       R I C+ +T    GN    ++   FG +            E + ++++  ++ N   D +   F + G++ +++    PE    K   +V +   + A  A+  L G  I++  ++ ++
Sbjct:  167 PATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTD-RSRGYGYVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNN---DRAKKFGDT----------PSEPSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDF 342          

HSP 2 Score: 59.6918 bits (143), Expect = 5.431e-10
Identity = 47/187 (25.13%), Postives = 91/187 (48.66%), Query Frame = 1
Query:   46 ESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS------AYIEFDNELSAEKAL-AMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQ----IFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDG-QHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWAT 570
            E++   TI+V  L   I +E L   F   G  I  ++  E  +       Y++F+N+  AEKA+  M    +D   +N  ++  +   N+      +KK    TP +    +F+G + F+ D   + + F+  G+V+  ++   P+  Q KGF +V FSN ++A  A+ ++      NR ++ ++++
Sbjct:  163 ETEEPATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNND----RAKKFG-DTPSEPSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSS 344          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Yeast
Match: GBP2 (Poly(A+) RNA-binding protein; key surveillance factor for the selective export of spliced mRNAs from the nucleus to the cytoplasm; preference for intron-containing genes; similar to Npl3p; also binds single-stranded telomeric repeat sequence in vitro; relocalizes to the cytosol in response to hypoxia; GBP2 has a paralog, HRB1, that arose from the whole genome duplication [Source:SGD;Acc:S000000517])

HSP 1 Score: 63.929 bits (154), Expect = 2.237e-11
Identity = 67/307 (21.82%), Postives = 127/307 (41.37%), Query Frame = 1
Query:   64 TIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSSAY------IEFDNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLE---------EISYEA--------PETNTSVYVMAENL----SEDILRPTFERFGKIKNIKAFPEKNH-----AFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKN 888
            +I+V NL    + EDL  +FG+ G  +  + ++ TS  +      +EF    S + A++  D  +  ++  +V       + +  +   + + +     ++F+  + + ++   LKD F  CG V+ A V    +G  +GF  V +  EDE   AI + N      R ++      +K  N    N++    + T+  E          I   A        P  + + ++   NL    +   L   F   GKI N +  P++N      A V Y+    A + IQ+LN Y      L+ ++ +++
Sbjct:  123 SIFVRNLTFDCTPEDLKELFGTVGEVV--EADIITSKGHHRGMGTVEFTKNESVQDAISKFDGALFMDRKLMVRQDNPPPEAAKEFSKKATREEIDNGFEVFIINLPYSMNWQSLKDMFKECGHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEVREGRFNKRKNNDRYNQRREDLEDTRGTEPGLAQDAAVHIDETAAKFTEGVNPGGDRNCFIYCSNLPFSTARSDLFDLFGPIGKINNAELKPQENGQPTGVAVVEYENLVDADFCIQKLNNYNYGGCSLQISYARRD 427          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 56.9954 bits (136), Expect = 3.806e-9
Identity = 32/103 (31.07%), Postives = 50/103 (48.54%), Query Frame = 1
Query:  589 GVPPNKKMAFGQSTKTLEEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNA 891
            G+PP        + + ++ I   AP   T+ Y+  +    +E  L P F+ FG I + K +PEK   F+ YDTH+ AA  I  L  +      L+  WGK+ +
Sbjct:  319 GLPPQV------NPQAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERS 415          

HSP 2 Score: 54.299 bits (129), Expect = 2.770e-8
Identity = 42/186 (22.58%), Postives = 81/186 (43.55%), Query Frame = 1
Query:  346 IFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVMAENLSEDILRPTFERF-----GKIK-NIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKK 885
            ++VG +   I E  LK  F   G + + K++   + ++  +AFV +    +A  A+Q++N     N  ++ NWA +S+  +            S  T           N  V  +  N+ ++ LR  F+ F     G +  +++    + + FV++ + D A  A+  + G  +N   L+ NW  K
Sbjct:   77 LYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSS------------SDDTF----------NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAK 240          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Yeast
Match: HRP1 (Subunit of cleavage factor I; cleavage factor I is a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences; required for genome stability [Source:SGD;Acc:S000005483])

HSP 1 Score: 56.6102 bits (135), Expect = 6.185e-9
Identity = 43/174 (24.71%), Postives = 82/174 (47.13%), Query Frame = 1
Query:   49 SKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSSAYIEFDNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPD-GQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWA 567
            SK +  +++  L    +E++L   FG +G     ++  + ++        LS EK  ++++        +++   V + + + P     K        +IFVGGIG D+   + ++ FS  G +IDA+++   D GQ +GF FV++ + D      Q+     F +RKI+   A
Sbjct:  155 SKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEV---VKTQHILDGKVIDPKRAIPRDEQDKTG------KIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQN-KFIDFKDRKIEIKRA 318          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Nematostella
Match: EDO32492 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUY1])

HSP 1 Score: 91.2781 bits (225), Expect = 5.878e-21
Identity = 64/250 (25.60%), Postives = 118/250 (47.20%), Query Frame = 1
Query:   70 YVSNLPSPISEEDLLSIFGSFGVCISCQL----NLETSSAYIEFDNELSAEKA-LAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGP-DGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVMAENLSEDI----LRPTFERFGKIKNIKAFPEKNHAFV 789
            YV NL    ++E + SIF      + C++    + +    ++EF+    A++A   M+   +   ++ V         N A      K+ D +    IFVG +  ++D A L+  F   G++ + +VV+ P   + KGF FVSF   ++A  AI  M++     ++++ NWA +  N     P +           +++ +++ + NT+VYV   NL  D+    L+  F ++G I   K F +K +AF+
Sbjct:    1 YVGNLDPKCTQELICSIFNKIAKVVRCKMINSVSYKGPYCFVEFETHADAQEAKFRMDQRTVMDKKLKV---------NWATNHPGMKRGDTNNHFHIFVGDLAENVDNALLRKTFEPFGEISEVRVVKDPAKNKSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQVKTNWAARKNN-----PTQSKYVCVKNLLWDDVFHQSSQLNTTVYV--GNLPPDVKDYELQQMFSQYGSILETKVFADKGYAFI 234          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Nematostella
Match: EDO33206 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSV8])

HSP 1 Score: 82.0333 bits (201), Expect = 1.437e-16
Identity = 71/310 (22.90%), Postives = 137/310 (44.19%), Query Frame = 1
Query:   67 IYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS-----AYIEFDNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVMAENLSEDI----LRPTFERFGKIKNIKAFPE-----KNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWG-----KKNAAAGGNMNKPMGNQMNQ 939
            I++ NL   I  + L   F +FG  +SC++  +         ++ F+ E +A +A+A  D  + +++   V  ++ + +         KK        ++V   G D+D+ ++K+  +  G+++  KV+  P+G+ KGF FVSF   +EA  A+  +N      R++   WA ++K        +     +    +E+   E       V +  +NL + I    LR  F  +G I + K   +     K   FV + + + A  A+ ++NG  + S  L          +K   A  +M++  G +M+Q
Sbjct:  103 IFIKNLDKSIDNKSLYDTFSAFGNILSCKIAQDELGNPKGYGFVHFETEDAALEAIARVDGMLLNDKKVFVGRWMSKKERIEKMGTQPKKF-----TNVYVKNFGDDMDDEQMKEICAEAGKIVSLKVMTDPEGKSKGFGFVSFETPEEAEEAVNVLNGKEIGGRRL---WAGRAK-------KRAERAAEVKAEIEKKRQERINRFQGVNLYIKNLDDPIDDERLREEFSPYGTISSAKVMKDDKGNSKGFGFVCFSSPEEATKAVTEMNGRILISKPLYVALAQRREERKAQLAAQHMHRISGLRMHQ 397          

HSP 2 Score: 53.1434 bits (126), Expect = 1.850e-7
Identity = 44/175 (25.14%), Postives = 75/175 (42.86%), Query Frame = 1
Query:  346 IFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHK-GFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVMAENLSEDILRPTFERFGKIKNIKAFPE-----KNHAFVNYDTHDAAAYAIQQLNGYKIN 852
            ++VG +  D+ EA L + FS  G V+  +V R    +   G+A+V+F     A  A+ +MN      R  +  W  +       P  +K   G                N  +  + +++    L  TF  FG I + K   +     K + FV+++T DAA  AI +++G  +N
Sbjct:   15 LYVGDLAPDVTEAMLYEKFSTAGSVLSIRVCRDLVTRRSLGYAYVNFQQPGHAEKALDTMNFDPIKGRPCRIMWQQRD------PSLRKSGVG----------------NIFIKNLDKSIDNKSLYDTFSAFGNILSCKIAQDELGNPKGYGFVHFETEDAALEAIARVDGMLLN 167          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Nematostella
Match: EDO34879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN30])

HSP 1 Score: 70.0922 bits (170), Expect = 3.517e-13
Identity = 71/318 (22.33%), Postives = 128/318 (40.25%), Query Frame = 1
Query:   67 IYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS------AYIEFDNELSAEKALA-MNDTPMDSNQMNVVIAY--VEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMF--HNRKIQCNW---------------ATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTS----------------------------------VYVMAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNG 840
            + ++ +P  +S+ED+  IFG+ G   SC+L  + ++      A++ +DN   A KA+  MN   + +  + V  A     E++N+                 +++ G+  D+ E +++  F   G++I +KV++   G+ +G  FV F    EA  AI  +NN      N K+   +               A  S  G  + P +  + G     +  + Y +P T +S                                  VY + +  +   L   F  +G I NI+   +K + FVN   ++ A +AI  LNG
Sbjct:   12 LIINYVPPSMSQEDIKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFARPSSTEIKNA----------------NLYISGLPKDMKEEEVEALFKPFGKIITSKVLKDVSGEGRGTGFVRFDKRCEAQTAIDDLNNKTLPGTNVKLTVKFANPPNSRQPAMPLSPALTSPLGRALTPQRNFSGGPVHHQMLNMRY-SPMTASSFSPACQANCHSPNNSSSNSYTNLSGLTPQGWCIFVYGLPQEATPLFLYKLFSPYGAITNIELKLDKGYGFVNMSNYEEACHAICCLNG 312          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Nematostella
Match: EDO37342 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFY3])

HSP 1 Score: 70.4774 bits (171), Expect = 1.055e-12
Identity = 49/174 (28.16%), Postives = 88/174 (50.57%), Query Frame = 1
Query:   46 ESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQL--NLETSS---AYIEFDNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKI 552
            ES + + +++SNL   I+E+ L   F   G  +  ++  N+   S   AY+EF+NE + + ALAM+   M+   M  +   V++ +N    F     +D  T   +FV  + FD  E+++++ FS  G V   ++V    G+ KG+ +V +  E  A  A+ +++ T    R I
Sbjct:  596 ESSDPRKVFISNLLFSITEDHLRDKFSKLGEVLDVRIVKNMAGRSKGYAYVEFNNESTVQAALAMDREKMEGRPM-FISPCVDKAKNPTT-FKFPTSLDKHT---LFVSNLPFDAKESEIEELFSKHGVVKQVRLVTNRAGKPKGYGYVEYEQESSASTAVLTLDKTEVKGRTI 764          

HSP 2 Score: 59.3066 bits (142), Expect = 2.957e-9
Identity = 51/208 (24.52%), Postives = 98/208 (47.12%), Query Frame = 1
Query:  274 VEEVQNSAPYFVASKK------VDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKI---QCNWATKSKNGNGVPPNKKM--AFGQSTKTLEEISYEAPETNTSVYVMAENLSEDILRPTFERFGKIKNI-----KAFPEKNHAFVNYDTHDAAAYAIQQLNGYKI 849
            +++V++S P   A+KK       + S P ++F+  + F I E  L+D FS  G+V+D ++V+   G+ KG+A+V F+NE    AA+ +M+      R +    C    K+KN    P   K   +  + T  +  + ++A E+               +   F + G +K +     +A   K + +V Y+   +A+ A+  L+  ++
Sbjct:  576 IDKVRSSEP---AAKKPCGESEEESSDPRKVFISNLLFSITEDHLRDKFSKLGEVLDVRIVKNMAGRSKGYAYVEFNNESTVQAAL-AMDREKMEGRPMFISPC--VDKAKN----PTTFKFPTSLDKHTLFVSNLPFDAKESE--------------IEELFSKHGVVKQVRLVTNRAGKPKGYGYVEYEQESSASTAVLTLDKTEV 759          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Nematostella
Match: EDO42417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1S3])

HSP 1 Score: 68.5514 bits (166), Expect = 1.549e-12
Identity = 53/188 (28.19%), Postives = 92/188 (48.94%), Query Frame = 1
Query:   46 ESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQL------NLETSSAYIEFDNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQ-NSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDA-KVVRGPD-GQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKN 582
            E   + TIYV  L   +SE  +  +F   G  ++  +       L     ++EF  E  A+ A+ +         MN++  Y + ++ N A     +K +D      +F+G +  ++DE  L D FS  G ++   K++R  D G  KGFAF++F++ D + AAI++MN     NR I  ++A K ++
Sbjct:    8 ERNQDATIYVGGLDEKVSEALIWELFLQSGPVVNVHMPKDRITQLHQGYGFVEFLGEEDADYAIKV---------MNMIKVYGKPIRVNKAS--AHNKNLDVGA--NLFIGNLDTEVDEKLLYDTFSAFGVILQTPKIMRDSDTGNSKGFAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKES 182          

HSP 2 Score: 54.6842 bits (130), Expect = 5.012e-8
Identity = 47/193 (24.35%), Postives = 84/193 (43.52%), Query Frame = 1
Query:  346 IFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQ-HKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVMAENLSEDILRPTFERFGKI-------KNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAG 900
            I+VGG+   + EA + + F   G V++  + +    Q H+G+ FV F  E++A  AI+ MN    + + I+ N A+          NK +  G                N  +  +   + E +L  TF  FG I       ++      K  AF+N+ + DA+  AI+ +NG  + +  +  ++  K  + G
Sbjct:   15 IYVGGLDEKVSEALIWELFLQSGPVVNVHMPKDRITQLHQGYGFVEFLGEEDADYAIKVMNMIKVYGKPIRVNKASAH--------NKNLDVG---------------ANLFIGNLDTEVDEKLLYDTFSAFGVILQTPKIMRDSDTGNSKGFAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKESKG 184          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Medaka
Match: ENSORLT00000003147.2 (nucleolysin TIA-1 [Source:NCBI gene;Acc:101155125])

HSP 1 Score: 162.54 bits (410), Expect = 1.856e-44
Identity = 110/354 (31.07%), Postives = 177/354 (50.00%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEFDNELSAEKALA-MNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKS---KNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKK--NAAAGGNMNKPMG------------NQMNQYYDNSQANFDNXXXXXXXXXXPNFFQVPQF 1029
            M+ +  KT+YV NL   ++E  +L +FG  G C SC++ ++T+      ++EF     A   +A MN   +   ++ V  A       + P    S+K D S+   +FVG +  +I    +K  F+  G++ D +VV+    G+ KG+ FVSF N+ +A  AIQ M       R+I+ NWAT+    K  N    +K+++F       +E+  ++  +N +VY   +   L+E I+R TF  FG+I  I+ FPEK ++FV +++H+AAA+AI  +NG  I    +KC WGK+  +   G     PM             NQ  Q+Y N+Q               PN +QVP +
Sbjct:    1 MDDEQPKTLYVGNLSRDVTEALILELFGQIGPCKSCKMIVDTAGHDPYCFVEFYEHRHATATIAAMNGRKILGKEVKVNWA-------TTP---TSQKKDTSSHFHVFVGDLSPEITTDDIKAAFAPFGKISDCRVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPAPKTTNESSSSKQLSF-------DEVVNQSSPSNCTVYCGGVTTGLTEQIMRQTFSPFGQIMEIRVFPEKGYSFVRFNSHEAAAHAIVSVNGTSIEGYVVKCYWGKETTDMVQGPIQQVPMAQQSTLGFAAQPYNQWGQWYGNTQ---------QIGQYVPNGWQVPSY 328          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Medaka
Match: ENSORLT00000019582.2 (nucleolysin TIA-1 [Source:NCBI gene;Acc:101158614])

HSP 1 Score: 160.614 bits (405), Expect = 1.015e-43
Identity = 95/292 (32.53%), Postives = 160/292 (54.79%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEF-DNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKN 888
            ME    +T+YV NL   ++E  +L +F   G C SC++ ++T+      ++EF D+  +A    AMN   +   ++ V  A       + P    S+K D S    +FVG +  +I    +K  F+  G++ DA+VV+    G+ KG+ FVSF N+ +A  AIQ M       R+I+ NWAT+       PP  K  +  ++K L  EE+  ++  +N +VY   ++  L+E ++R TF  FG+I  ++ FP+K ++FV +++H++AA+AI  +NG  I+   +KC WGK+ 
Sbjct:    1 MEDDQPRTLYVGNLSRDVTEPLILQVFTQIGPCKSCKMIVDTAGNDPYCFVEFYDHRHAAASLAAMNGRKIMGKEVKVNWA-------TTP---TSQKKDTSNHFHVFVGDLSPEITTEDVKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQHMGGQWLGGRQIRTNWATRK------PPAPKTTYESNSKHLSFEEVMSQSSPSNCTVYCGGVSSGLTEQLMRQTFSAFGQIMEVRVFPDKGYSFVRFNSHESAAHAIVSVNGTSIDGHVVKCYWGKET 276          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Medaka
Match: tial1 (TIA1 cytotoxic granule associated RNA binding protein like 1 [Source:NCBI gene;Acc:101155294])

HSP 1 Score: 149.828 bits (377), Expect = 8.099e-40
Identity = 99/309 (32.04%), Postives = 153/309 (49.51%), Query Frame = 1
Query:   61 KTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEFDNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNK---PMGNQMNQYYDN 951
            +T+YV NL   ++E  +L +F   G C SC++  E +S     ++EF             D       MN      +EV+ +     +S+K D S    +FVG +  DI    ++  F+  G++ DA+VV+    G+ KG+ FVSF N+ +A  AI  M       R+I+ NWAT+       PP  K      +K L  EE+  ++   N +VY   +   LSE ++R TF  FG+I  I+ FPEK ++F+ + +HD+AA+AI  +NG  I    +KC WGK++     N  +       Q NQ Y N
Sbjct:    8 RTLYVGNLSRDVTEILILQLFTQIGPCKSCKMITEHTSNDPYCFVEF---------FEHRDAAAALAAMNGRKILGKEVKVNWATTPSSQKKDTSNHFHVFVGDLNPDISTEDVRAAFTPFGKISDARVVKDLTTGKSKGYGFVSFYNKLDAENAIVHMAGQWLGGRQIRTNWATRK------PPAPKSLQDSVSKQLRFEEVVTQSSPQNCTVYCGGIQSELSEHLMRQTFSPFGQIMEIRVFPEKGYSFIRFSSHDSAAHAIVSVNGTSIEGHAVKCYWGKESTDMAKNPQQFEYSQWGQWNQVYGN 301          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Medaka
Match: tial1 (TIA1 cytotoxic granule associated RNA binding protein like 1 [Source:NCBI gene;Acc:101155294])

HSP 1 Score: 144.05 bits (362), Expect = 1.180e-37
Identity = 98/315 (31.11%), Postives = 154/315 (48.89%), Query Frame = 1
Query:   61 KTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLET--------SSAYIEF--DNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGN---MNKPMGNQMNQYYDN 951
            +T+YV NL   ++E  +L +F   G C SC++  E         SS +++   ++     +     D       MN      +EV+ +     +S+K D S    +FVG +  DI    ++  F+  G++ DA+VV+    G+ KG+ FVSF N+ +A  AI  M       R+I+ NWAT+       PP  K      +K L  EE+  ++   N +VY   +   LSE ++R TF  FG+I  I+ FPEK ++F+ + +HD+AA+AI  +NG  I    +KC WGK++     N          Q NQ Y N
Sbjct:    8 RTLYVGNLSRDVTEILILQLFTQIGPCKSCKMITEVPIFVNRWGSSFFLQHTSNDPYCFVEFFEHRDAAAALAAMNGRKILGKEVKVNWATTPSSQKKDTSNHFHVFVGDLNPDISTEDVRAAFTPFGKISDARVVKDLTTGKSKGYGFVSFYNKLDAENAIVHMAGQWLGGRQIRTNWATRK------PPAPKSLQDSVSKQLRFEEVVTQSSPQNCTVYCGGIQSELSEHLMRQTFSPFGQIMEIRVFPEKGYSFIRFSSHDSAAHAIVSVNGTSIEGHAVKCYWGKESTDMAKNPQQFEYSQWGQWNQVYGN 316          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Medaka
Match: ENSORLT00000019586.2 (nucleolysin TIA-1 [Source:NCBI gene;Acc:101158614])

HSP 1 Score: 132.109 bits (331), Expect = 2.055e-34
Identity = 86/276 (31.16%), Postives = 144/276 (52.17%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS----AYIEF-DNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRG-PDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTL--EEISYEAPETNTSVYV--MAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNG 840
            ME    +T+YV NL   ++E  +L +F   G C SC++ ++T+      ++EF D+  +A    AMN   +   ++ V  A       + P    S+K D S    +FVG +  +I    +K  F+  G++ DA+VV+    G+ KG+ FVSF N+ +A  AIQ M       R+I+ NWAT+       PP  K  +  ++K L  EE+  ++  +N +VY   ++  L+E ++R TF  FG+I  ++ FP+K ++FV+  ++       Q LNG
Sbjct:    1 MEDDQPRTLYVGNLSRDVTEPLILQVFTQIGPCKSCKMIVDTAGNDPYCFVEFYDHRHAAASLAAMNGRKIMGKEVKVNWA-------TTP---TSQKKDTSNHFHVFVGDLSPEITTEDVKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQHMGGQWLGGRQIRTNWATRK------PPAPKTTYESNSKHLSFEEVMSQSSPSNCTVYCGGVSSGLTEQLMRQTFSAFGQIMEVRVFPDKGYSFVSAISNGGVMEPTQGLNG 260          

HSP 2 Score: 54.299 bits (129), Expect = 1.007e-7
Identity = 42/197 (21.32%), Postives = 81/197 (41.12%), Query Frame = 1
Query:  337 PVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVMAENLSEDI----LRPTFERFGKIKNIKAFPE------KNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAA 897
            P  ++VG +  D+ E  +   F+  G     K++    G    + FV F +   A A++ +MN      ++++ NWAT        P ++K                  +T+   +V   +LS +I    ++  F  FG+I + +   +      K + FV++     A  AIQ + G  +   +++ NW  +   A
Sbjct:    6 PRTLYVGNLSRDVTEPLILQVFTQIGPCKSCKMIVDTAGNDP-YCFVEFYDHRHAAASLAAMNGRKIMGKEVKVNWAT-------TPTSQK-----------------KDTSNHFHVFVGDLSPEITTEDVKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQHMGGQWLGGRQIRTNWATRKPPA 177          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Planmine SMEST
Match: SMESG000044649.1 (SMESG000044649.1)

HSP 1 Score: 823.543 bits (2126), Expect = 0.000e+0
Identity = 429/430 (99.77%), Postives = 429/430 (99.77%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSSAYIEFDNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVMAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNKPMGNQMNQYYDNSQANFDNXXXXXXXXXXPNFFQVPQFYNNSQMGSYYNSAPNXXXXXXXXXXXXXNSNANFSNPQGNFIAQPNLLGQPKVSYGGQLKSNLKAIPKAPISSQTKPRMNRAPHPYNKPKVNNANQFNTYQ 1332
            MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSSAYIEFDNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEA AAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVMAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNKPMGNQMNQYYDNSQANFDNYQQQYDQYCQPNFFQVPQFYNNSQMGSYYNSAPNYPQYPMPYFQQQPNSNANFSNPQGNFIAQPNLLGQPKVSYGGQLKSNLKAIPKAPISSQTKPRMNRAPHPYNKPKVNNANQFNTYQ
Sbjct:    1 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSSAYIEFDNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEASAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVMAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNKPMGNQMNQYYDNSQANFDNYQQQYDQYCQPNFFQVPQFYNNSQMGSYYNSAPNYPQYPMPYFQQQPNSNANFSNPQGNFIAQPNLLGQPKVSYGGQLKSNLKAIPKAPISSQTKPRMNRAPHPYNKPKVNNANQFNTYQ 430          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Planmine SMEST
Match: SMESG000044671.1 (SMESG000044671.1)

HSP 1 Score: 308.145 bits (788), Expect = 3.340e-99
Identity = 184/453 (40.62%), Postives = 257/453 (56.73%), Query Frame = 1
Query:   40 KMESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSSAYIEFDNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQN-SAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVMAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWG------------------KKNAAAGGNMNKPMGNQMNQYYDNSQA--NFDNXXXXXXXXXXPNF---FQVPQFYNNSQMGSYYNSAPNXXXXXXXXXXXXXNSNANFSNPQGNFIAQPNLLG--QPKVSYGGQLKSNLKAIPKAPISSQTKPRMNRAPHPYNKPKVNNANQF 1320
            KMESKN KTIY+S+LP  ++EEDLLSIF ++G+C+SC L+ ET +AY+EFDNE SA  +L+MN   M + ++ + IAY+E+  N      +  +  +   P QIFVG IG  +DE  LK GF H G +I+AKV+R  DG+HKG+ FV+FSNE EA +AI  MN T FH+ KI+C+W  K+K+   V     +A   ++KTLEEI  E P++ T+V+V  +N+++++L P FE FGKIKNIKAFP  N AF+NY +H++A  AI Q+NG+ +N+IEL C+W                   K   A  G   K + NQ+NQY    Q   ++D       Q+ QP+F   +    FYN   M +Y +   N      P        N     P+     QP   G  QPK  YG          P   I +Q KPR+NR   P+ KP + N  ++
Sbjct:    3 KMESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCTAYVEFDNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQETSEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWG-KNKSNLAV-----VASKNASKTLEEIFNETPKSYTNVFVTGDNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSIKKLILPPPPMRKMRIANVGATRKYLANQINQYNGRQQPYESYDETGYGLPQFQQPSFTDDYTDQSFYNPVAMPTYQDDY-NSYNVYPPSVPAPLIRNPPLGQPKPYLNVQPKPFGPAQPK-PYGNVQSKPFNVQPLMGIPAQPKPRLNRVAQPFKKPILGNPGKY 447          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Planmine SMEST
Match: SMESG000044671.1 (SMESG000044671.1)

HSP 1 Score: 307.76 bits (787), Expect = 6.726e-99
Identity = 184/453 (40.62%), Postives = 257/453 (56.73%), Query Frame = 1
Query:   40 KMESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSSAYIEFDNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQN-SAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVMAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWG------------------KKNAAAGGNMNKPMGNQMNQYYDNSQ--ANFDNXXXXXXXXXXPNF---FQVPQFYNNSQMGSYYNSAPNXXXXXXXXXXXXXNSNANFSNPQGNFIAQPNLLG--QPKVSYGGQLKSNLKAIPKAPISSQTKPRMNRAPHPYNKPKVNNANQF 1320
            KMESKN KTIY+S+LP  ++EEDLLSIF ++G+C+SC L+ ET +AY+EFDNE SA  +L+MN   M + ++ + IAY+E+  N      +  +  +   P QIFVG IG  +DE  LK GF H G +I+AKV+R  DG+HKG+ FV+FSNE EA +AI  MN T FH+ KI+C+W  K+K+   V     +A   ++KTLEEI  E P++ T+V+V  +N+++++L P FE FGKIKNIKAFP  N AF+NY +H++A  AI Q+NG+ +N+IEL C+W                   K   A  G   K + NQ+NQY    Q   ++D       Q+ QP+F   +    FYN   M +Y +   N      P        N     P+     QP   G  QPK  YG          P   I +Q KPR+NR   P+ KP + N  ++
Sbjct:   11 KMESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCTAYVEFDNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQETSEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWG-KNKSNLAV-----VASKNASKTLEEIFNETPKSYTNVFVTGDNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSIKKLILPPPPMRKMRIANVGATRKYLANQINQYNGRQQPYESYDETGYGLPQFQQPSFTDDYTDQSFYNPVAMPTYQDDY-NSYNVYPPSVPAPLIRNPPLGQPKPYLNVQPKPFGPAQPK-PYGNVQSKPFNVQPLMGIPAQPKPRLNRVAQPFKKPILGNPGKY 455          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Planmine SMEST
Match: SMESG000055074.1 (SMESG000055074.1)

HSP 1 Score: 279.256 bits (713), Expect = 1.071e-89
Identity = 150/299 (50.17%), Postives = 198/299 (66.22%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS-----AYIEFDNELSAEKAL-AMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVMAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNKPM 921
            M  KNN+TIYV NLP  ++++ L+ IFG+FG CISC +  + S      A+IE+ +  SA  AL AM+   M +NQ+ V  +         P  V S K+DYS  VQIFVG IG D+DE  LK+GFS  GQ+IDAKVVR PDGQ +GFAFVSFSN DEA  AIQSM+ T FHNR I+CNWAT+    NG+   + + +  + +  E +  EAP TNT+VYV  ENL+E++L   F+ FG+I ++K +PEK HAF+N+ TH+AAA AI Q +GYKIN   +KCNWGK+N A   +   P+
Sbjct:    1 MSFKNNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTI-PGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATR----NGLDGEQFIKY--TPRPYELVYKEAPLTNTNVYVAGENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAISTSTMPPL 292          
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Planmine SMEST
Match: SMESG000055075.1 (SMESG000055075.1)

HSP 1 Score: 278.87 bits (712), Expect = 1.299e-89
Identity = 150/299 (50.17%), Postives = 198/299 (66.22%), Query Frame = 1
Query:   43 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSS-----AYIEFDNELSAEKAL-AMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVMAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNKPM 921
            M  KNN+TIYV NLP  ++++ L+ IFG+FG CISC +  + S      A+IE+ +  SA  AL AM+   M +NQ+ V  +         P  V S K+DYS  VQIFVG IG D+DE  LK+GFS  GQ+IDAKVVR PDGQ +GFAFVSFSN DEA  AIQSM+ T FHNR I+CNWAT+    NG+   + + +  + +  E +  EAP TNT+VYV  ENL+E++L   F+ FG+I ++K +PEK HAF+N+ TH+AAA AI Q +GYKIN   +KCNWGK+N A   +   P+
Sbjct:    1 MSFKNNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTI-PGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATR----NGLDGEQFIKY--TPRPYELVYKEAPLTNTNVYVAGENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWGKENFAISTSAMPPL 292          
The following BLAST results are available for this feature:
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TIA11.334e-4131.41TIA1 cytotoxic granule associated RNA binding prot... [more]
TIA13.085e-4030.09TIA1 cytotoxic granule associated RNA binding prot... [more]
TIA15.647e-4030.48TIA1 cytotoxic granule associated RNA binding prot... [more]
TIAL13.682e-3931.83TIA1 cytotoxic granule associated RNA binding prot... [more]
TIAL13.246e-3631.03TIA1 cytotoxic granule associated RNA binding prot... [more]
back to top
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tiar-14.376e-3932.86TIA-1/TIAL RNA binding protein homolog [Source:Un... [more]
tiar-22.342e-3531.29TIA-1/TIAL RNA binding protein homolog [Source:Un... [more]
tiar-13.560e-3230.80TIA-1/TIAL RNA binding protein homolog [Source:Un... [more]
tiar-12.109e-3135.79TIA-1/TIAL RNA binding protein homolog [Source:Un... [more]
tiar-12.178e-3135.79TIA-1/TIAL RNA binding protein homolog [Source:Un... [more]
back to top
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rox82.284e-3630.23gene:FBgn0005649 transcript:FBtr0084592[more]
Rox82.284e-3630.23gene:FBgn0005649 transcript:FBtr0084594[more]
Rox83.037e-3630.23gene:FBgn0005649 transcript:FBtr0333200[more]
Rox83.037e-3630.23gene:FBgn0005649 transcript:FBtr0333202[more]
Rox83.037e-3630.23gene:FBgn0005649 transcript:FBtr0333201[more]
back to top
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tia1l4.932e-4534.31cytotoxic granule-associated RNA binding protein 1... [more]
tia1l2.222e-4433.99cytotoxic granule-associated RNA binding protein 1... [more]
tia12.308e-4330.03TIA1 cytotoxic granule-associated RNA binding prot... [more]
tia13.397e-4129.97TIA1 cytotoxic granule-associated RNA binding prot... [more]
tial16.832e-4031.97TIA1 cytotoxic granule-associated RNA binding prot... [more]
back to top
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tia18.101e-4230.66TIA1 cytotoxic granule-associated RNA binding prot... [more]
tia13.407e-4130.31TIA1 cytotoxic granule-associated RNA binding prot... [more]
tia14.852e-4030.84TIA1 cytotoxic granule-associated RNA binding prot... [more]
tia16.170e-3930.23TIA1 cytotoxic granule-associated RNA binding prot... [more]
tial18.023e-3730.55Xenopus tropicalis TIA1 cytotoxic granule-associat... [more]
back to top
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tia15.987e-4230.64cytotoxic granule-associated RNA binding protein 1... [more]
Tia11.377e-4130.46cytotoxic granule-associated RNA binding protein 1... [more]
Tia11.715e-4029.71cytotoxic granule-associated RNA binding protein 1... [more]
Tia11.974e-4029.71cytotoxic granule-associated RNA binding protein 1... [more]
Tial12.286e-3931.83Tia1 cytotoxic granule-associated RNA binding prot... [more]
back to top
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P52912|TIA1_MOUSE1.200e-3929.71Nucleolysin TIA-1 OS=Mus musculus OX=10090 GN=Tia1... [more]
sp|P31483|TIA1_HUMAN2.712e-3930.48Nucleolysin TIA-1 isoform p40 OS=Homo sapiens OX=9... [more]
sp|Q01085|TIAR_HUMAN1.768e-3831.83Nucleolysin TIAR OS=Homo sapiens OX=9606 GN=TIAL1 ... [more]
sp|P70318|TIAR_MOUSE1.469e-3531.03Nucleolysin TIAR OS=Mus musculus OX=10090 GN=Tial1... [more]
sp|Q9SYG4|UBP1A_ARATH4.297e-2931.68Oligouridylate-binding protein 1A OS=Arabidopsis t... [more]
back to top
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D5JG750.000e+071.92TIA1-like protein (Fragment) OS=Dugesia japonica O... [more]
D5JG765.465e-8939.60TIA1-like protein (Fragment) OS=Dugesia japonica O... [more]
D5JG774.288e-8651.74TIA1-like protein OS=Dugesia japonica OX=6161 GN=T... [more]
D5JG784.604e-7747.40TIA1-like protein (Fragment) OS=Dugesia japonica O... [more]
A4V6J57.168e-5750.77Polyadenylate-binding protein (Fragment) OS=Dugesi... [more]
back to top
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tia1l1.167e-4433.88TIA1 cytotoxic granule associated RNA binding prot... [more]
tia1l1.167e-4433.88TIA1 cytotoxic granule associated RNA binding prot... [more]
tial11.721e-3832.52TIA1 cytotoxic granule associated RNA binding prot... [more]
tia1l2.758e-3333.08TIA1 cytotoxic granule associated RNA binding prot... [more]
ENSAMXT00000035946.11.945e-1523.40polyadenylate-binding protein 1-like [Source:NCBI ... [more]
back to top
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tia1l2.121e-3136.22cytotoxic granule-associated RNA binding protein 1... [more]
pabpc43.144e-1422.46poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
sf3b41.582e-1128.11splicing factor 3b, subunit 4 [Source:ZFIN;Acc:ZDB... [more]
rbm342.454e-1124.48RNA binding motif protein 34 [Source:ZFIN;Acc:ZDB-... [more]
pabpc41.229e-1023.46poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
back to top
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PAB15.529e-1524.65Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
NSR16.315e-1226.32Nucleolar protein that binds nuclear localization ... [more]
GBP22.237e-1121.82Poly(A+) RNA-binding protein; key surveillance fac... [more]
PUB13.806e-931.07Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
HRP16.185e-924.71Subunit of cleavage factor I; cleavage factor I is... [more]
back to top
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO324925.878e-2125.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332061.437e-1622.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348793.517e-1322.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373421.055e-1228.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424171.549e-1228.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000003147.21.856e-4431.07nucleolysin TIA-1 [Source:NCBI gene;Acc:101155125][more]
ENSORLT00000019582.21.015e-4332.53nucleolysin TIA-1 [Source:NCBI gene;Acc:101158614][more]
tial18.099e-4032.04TIA1 cytotoxic granule associated RNA binding prot... [more]
tial11.180e-3731.11TIA1 cytotoxic granule associated RNA binding prot... [more]
ENSORLT00000019586.22.055e-3431.16nucleolysin TIA-1 [Source:NCBI gene;Acc:101158614][more]
back to top
BLAST of Nuclear and cytoplasmic polyadenylated RNA-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044649.10.000e+099.77SMESG000044649.1[more]
SMESG000044671.13.340e-9940.62SMESG000044671.1[more]
SMESG000044671.16.726e-9940.62SMESG000044671.1[more]
SMESG000055074.11.071e-8950.17SMESG000055074.1[more]
SMESG000055075.11.299e-8950.17SMESG000055075.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008437 ID=SMED30008437|Name=Nuclear and cytoplasmic polyadenylated RNA-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1639bp
TTTAAATATCGCTTAATTTAATTATATTTCAATCGACAAAAAATGGAAAG
TAAAAATAACAAAACTATTTATGTTTCAAATTTACCTTCGCCAATTAGCG
AAGAAGATTTGCTTAGCATTTTTGGGAGCTTTGGTGTATGTATTTCGTGT
CAATTAAACTTAGAAACTTCAAGCGCTTATATTGAATTTGACAATGAATT
ATCTGCTGAAAAAGCCTTGGCAATGAATGATACTCCAATGGATTCGAATC
AAATGAATGTTGTTATTGCTTATGTCGAAGAAGTTCAAAATTCTGCTCCA
TATTTCGTTGCATCAAAGAAAGTAGATTACTCTACACCAGTTCAAATATT
TGTTGGAGGTATCGGTTTTGATATTGATGAAGCCAAATTAAAAGATGGAT
TTTCTCACTGTGGACAAGTCATAGATGCTAAAGTTGTCAGGGGTCCTGAT
GGTCAACATAAAGGTTTCGCTTTTGTATCCTTTAGCAACGAAGACGAAGC
AGGTGCAGCAATTCAAAGTATGAATAATACCATGTTTCATAATCGAAAAA
TTCAATGCAATTGGGCTACAAAAAGTAAAAATGGCAATGGTGTGCCTCCA
AATAAGAAAATGGCATTTGGACAATCAACTAAAACACTTGAAGAAATTTC
ATACGAAGCACCTGAAACAAATACCAGTGTTTATGTAATGGCAGAAAATC
TTTCAGAAGATATTTTACGACCGACATTTGAAAGATTTGGTAAAATTAAA
AATATTAAAGCTTTTCCCGAAAAAAATCACGCATTTGTCAATTATGATAC
CCATGATGCAGCTGCTTATGCTATACAACAACTGAATGGTTACAAAATCA
ATAGCATTGAATTAAAATGTAACTGGGGAAAGAAGAATGCAGCTGCAGGT
GGTAACATGAATAAGCCAATGGGCAATCAAATGAATCAATATTATGACAA
CTCACAAGCTAATTTCGATAACTATCAACAACAATATGATCAATATTGCC
AGCCAAACTTTTTTCAAGTTCCACAGTTTTACAACAATTCTCAAATGGGA
TCATACTACAACTCGGCGCCTAACTATCCACAATATCCGATGCCGTATTT
TCAACAACAGCCTAATTCTAATGCAAATTTTTCCAATCCACAGGGAAATT
TTATCGCTCAACCTAATCTTTTAGGTCAGCCGAAAGTCAGCTATGGAGGA
CAACTGAAAAGTAACCTTAAAGCGATTCCAAAGGCACCAATAAGTTCTCA
AACGAAACCAAGAATGAATAGGGCTCCTCATCCGTATAACAAGCCTAAAG
TTAACAATGCTAATCAATTTAACACTTATCAATAGTAATTCAGCTTAGAC
AATAAACATTTCTCATTGAAGTCTTTCTATCCTTATATAGAAGCTTAAAA
GTTTTAATTCTTTTATATATAGAAGAAACGATATTCAATGACTTTTATGA
AGATGTTTATGATTTGTGTTGTATATAATAAATTATAAAATAATTGTTTT
ATATAGTATCGATTTTTGTACCCTGCATTTGTCATGTAGTTTTTAGTTAT
TTGTGATGAATCCAATTTTGTAATTATTTAATAAATTGTTAAATCTTGCA
AACGATTTTCATCATCTAGGCTTATTCAGTGTTATGAAG
back to top

protein sequence of SMED30008437-orf-1

>SMED30008437-orf-1 ID=SMED30008437-orf-1|Name=SMED30008437-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=431bp
MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSSAYIEFD
NELSAEKALAMNDTPMDSNQMNVVIAYVEEVQNSAPYFVASKKVDYSTPV
QIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNE
DEAGAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLE
EISYEAPETNTSVYVMAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVN
YDTHDAAAYAIQQLNGYKINSIELKCNWGKKNAAAGGNMNKPMGNQMNQY
YDNSQANFDNYQQQYDQYCQPNFFQVPQFYNNSQMGSYYNSAPNYPQYPM
PYFQQQPNSNANFSNPQGNFIAQPNLLGQPKVSYGGQLKSNLKAIPKAPI
SSQTKPRMNRAPHPYNKPKVNNANQFNTYQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 8..74
e-value: 4.9E-13
score: 59.3
coord: 101..173
e-value: 8.1E-25
score: 98.5
coord: 212..277
e-value: 5.5E-11
score: 52.5
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 9..70
e-value: 5.5E-11
score: 42.1
coord: 217..274
e-value: 8.2E-13
score: 48.0
coord: 102..170
e-value: 5.8E-20
score: 70.9
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 7..78
score: 13.174
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 211..281
score: 12.884
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 100..177
score: 18.069
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 1..82
e-value: 8.4E-16
score: 59.9
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 206..287
e-value: 2.0E-16
score: 62.0
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 83..191
e-value: 1.1E-25
score: 92.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 395..430
NoneNo IPR availablePANTHERPTHR47640FAMILY NOT NAMEDcoord: 3..320
NoneNo IPR availablePANTHERPTHR47640:SF5TIA-1/TIAL RNA BINDING PROTEIN HOMOLOGcoord: 3..320
NoneNo IPR availableCDDcd00590RRM_SFcoord: 9..73
e-value: 1.73135E-13
score: 63.0929
NoneNo IPR availableCDDcd00590RRM_SFcoord: 102..173
e-value: 1.30953E-21
score: 86.2049
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 3..84
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 96..184
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 203..282