Calcium uptake protein 1, mitochondrial

Overview
NameCalcium uptake protein 1, mitochondrial
Smed IDSMED30008431
Length (bp)1862
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcium uptake protein 1, mitochondrial (SMED30008431) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcium uptake protein 1, mitochondrial (SMED30008431) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcium uptake protein 1, mitochondrial (SMED30008431) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcium uptake protein 1, mitochondrial (SMED30008431) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Human
Match: MICU1 (mitochondrial calcium uptake 1 [Source:HGNC Symbol;Acc:HGNC:1530])

HSP 1 Score: 390.963 bits (1003), Expect = 1.217e-129
Identity = 200/370 (54.05%), Postives = 270/370 (72.97%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATIQDTTN----EVYMTPQDFVRSISPGVKQPEGLGLDSF--RRVDLRKEKIDSE----ISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTV 1660
            R GFRD +++ YE+RIR+YSTPDKIFRYFAT++  +     EV+MTP+DFVRSI+P  KQPE LGLD +  +R D + +KI  E      + S+FY  GE  LI+FSDY+FL TV+STPQR FEIAF+MFDLNGDGE+D+EEF+ V+SIIRS ++MG RHRD   TGNTL + + S+L+ YFFG+  K KLTI +F  FQR+LQ +++KLEFER+ PVDG I E  F   LL Y+     K     R++++ +K+    G++F +   F   LK I+DVDTAL+FYH+AGAS+D+ T++ V++ VA VELSDH+  +VF LFD + +G LSNKEF+ +MKQ+L+RGL+KP D GF RL+ A+ KCA++T 
Sbjct:  103 RSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVISEPGEAEVFMTPEDFVRSITPNEKQPEHLGLDQYIIKRFDGKVKKISQEREKFADEGSIFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTTYFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRITERQFGGMLLAYSGVQSKKLTAMQRQLKKHFKEGK--GLTFQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLMQAMWKCAQETA 470          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Human
Match: MICU1 (mitochondrial calcium uptake 1 [Source:HGNC Symbol;Acc:HGNC:1530])

HSP 1 Score: 388.652 bits (997), Expect = 1.075e-128
Identity = 201/374 (53.74%), Postives = 270/374 (72.19%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATIQDTTN----EVYMTPQDFVRSISPGVKQPEGLGLDSF--RRVD----LRKEKIDSE----ISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTV 1660
            R GFRD +++ YE+RIR+YSTPDKIFRYFAT++  +     EV+MTP+DFVRSI+P  KQPE LGLD +  +R D     + EKI  E      + S+FY  GE  LI+FSDY+FL TV+STPQR FEIAF+MFDLNGDGE+D+EEF+ V+SIIRS ++MG RHRD   TGNTL + + S+L+ YFFG+  K KLTI +F  FQR+LQ +++KLEFER+ PVDG I E  F   LL Y+     K     R++++ +K+    G++F +   F   LK I+DVDTAL+FYH+AGAS+D+ T++ V++ VA VELSDH+  +VF LFD + +G LSNKEF+ +MKQ+L+RGL+KP D GF RL+ A+ KCA++T 
Sbjct:  103 RSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVISEPGEAEVFMTPEDFVRSITPNEKQPEHLGLDQYIIKRFDGKDFWQTEKISQEREKFADEGSIFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTTYFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRITERQFGGMLLAYSGVQSKKLTAMQRQLKKHFKEGK--GLTFQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLMQAMWKCAQETA 474          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Human
Match: MICU1 (mitochondrial calcium uptake 1 [Source:HGNC Symbol;Acc:HGNC:1530])

HSP 1 Score: 388.267 bits (996), Expect = 1.113e-128
Identity = 199/368 (54.08%), Postives = 269/368 (73.10%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATIQDTTN----EVYMTPQDFVRSISPGVKQPEGLGLDSF--RRVDLRKEKIDSE--ISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTV 1660
            R GFRD +++ YE+RIR+YSTPDKIFRYFAT++  +     EV+MTP+DFVRSI+P  KQPE LGLD +  +R D +K   + E    + S+FY  GE  LI+FSDY+FL TV+STPQR FEIAF+MFDLNGDGE+D+EEF+ V+SIIRS ++MG RHRD   TGNTL + + S+L+ YFFG+  K KLTI +F  FQR+LQ +++KLEFER+ PVDG I E  F   LL Y+     K     R++++ +K+    G++F +   F   LK I+DVDTAL+FYH+AGAS+D+ T++ V++ VA VELSDH+  +VF LFD + +G LSNKEF+ +MKQ+L+RGL+KP D GF RL+ A+ KCA++T 
Sbjct:  103 RSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVISEPGEAEVFMTPEDFVRSITPNEKQPEHLGLDQYIIKRFDGKKISQEREKFADEGSIFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTTYFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRITERQFGGMLLAYSGVQSKKLTAMQRQLKKHFKEGK--GLTFQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLMQAMWKCAQETA 468          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Human
Match: MICU1 (mitochondrial calcium uptake 1 [Source:HGNC Symbol;Acc:HGNC:1530])

HSP 1 Score: 386.726 bits (992), Expect = 5.087e-128
Identity = 200/372 (53.76%), Postives = 270/372 (72.58%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATIQDTTN----EVYMTPQDFVRSISPGVKQPEGLGLDSF--RRVDLRK--EKIDSE----ISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTV 1660
            R GFRD +++ YE+RIR+YSTPDKIFRYFAT++  +     EV+MTP+DFVRSI+P  KQPE LGLD +  +R D +   +KI  E      + S+FY  GE  LI+FSDY+FL TV+STPQR FEIAF+MFDLNGDGE+D+EEF+ V+SIIRS ++MG RHRD   TGNTL + + S+L+ YFFG+  K KLTI +F  FQR+LQ +++KLEFER+ PVDG I E  F   LL Y+     K     R++++ +K+    G++F +   F   LK I+DVDTAL+FYH+AGAS+D+ T++ V++ VA VELSDH+  +VF LFD + +G LSNKEF+ +MKQ+L+RGL+KP D GF RL+ A+ KCA++T 
Sbjct:  103 RSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVISEPGEAEVFMTPEDFVRSITPNEKQPEHLGLDQYIIKRFDGKDFWQKISQEREKFADEGSIFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTTYFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRITERQFGGMLLAYSGVQSKKLTAMQRQLKKHFKEGK--GLTFQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLMQAMWKCAQETA 472          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Human
Match: MICU1 (mitochondrial calcium uptake 1 [Source:HGNC Symbol;Acc:HGNC:1530])

HSP 1 Score: 266.929 bits (681), Expect = 2.090e-84
Identity = 135/253 (53.36%), Postives = 185/253 (73.12%), Query Frame = 2
Query:  902 TPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTV 1660
             PQR FEIAF+MFDLNGDGE+D+EEF+ V+SIIRS ++MG RHRD   TGNTL + + S+L+ YFFG+  K KLTI +F  FQR+LQ +++KLEFER+ PVDG I E  F   LL Y+     K     R++++ +K+    G++F +   F   LK I+DVDTAL+FYH+AGAS+D+ T++ V++ VA VELSDH+  +VF LFD + +G LSNKEF+ +MKQ+L+RGL+KP D GF RL+ A+ KCA++T 
Sbjct:   20 APQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTTYFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRITERQFGGMLLAYSGVQSKKLTAMQRQLKKHFKEGK--GLTFQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLMQAMWKCAQETA 270          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Celegans
Match: micu-1 (Calcium uptake protein 1 homolog, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q95PZ2])

HSP 1 Score: 323.939 bits (829), Expect = 2.112e-103
Identity = 175/366 (47.81%), Postives = 243/366 (66.39%), Query Frame = 2
Query:  584 VGFRDSRIIAYEDRIRSYSTPDKIFRYFATI------QDTTN-EVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRKEKIDSEISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVD---GIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAK 1651
            +GFR+ RII YEDR+R YSTPDKIFRYFAT+      +D+   EV+MTP+DF+RS +PGV QP   GLDSF+  +  K K       DS+FY  GEN LINFSDY+FL+T++ST    F +AF++FD++G+G LD EEF  V+ +I S + +G+RHRD+     +     NS+L  YFFG  GK  L+   F  FQ +LQ +I+K+EFER   +D   G+I E  FA  LL++A+  + K+K  L+RV++++K EN  GISF +  AF   L  I DVD AL F+ +AG SID   L+ V+  V  + LSDH++ +V TLFD+N DG LS++E + VM++++ RGL++P DTG  RL  AV +C K
Sbjct:  158 LGFRERRIIEYEDRLRLYSTPDKIFRYFATLKIIDPNEDSGRFEVFMTPEDFLRSFTPGVMQPRRWGLDSFKNYNPEKHKRHKFSDPDSIFYKLGENGLINFSDYLFLMTLLSTSHADFALAFKIFDVDGNGALDKEEFTKVQQLIMSQTTVGQRHRDHITPNQSFRVETNSALETYFFGKDGKGSLSSEKFIEFQERLQHDILKMEFERRDALDNPDGLINEDSFAQLLLLHAQINEKKQKHMLKRVKRRFKGENLKGISFGETKAFFEFLYHIDDVDIALHFHKMAGMSIDAKLLQRVAVKVTGIPLSDHVVDVVITLFDDNLDGKLSHEEMVAVMRRRMRRGLERPRDTGLFRLFDAVLECGK 523          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Celegans
Match: C56A3.6 (pep chromosome:WBcel235:V:13553374:13556408:-1 gene:WBGene00008345.1 transcript:C56A3.6c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C56A3.6)

HSP 1 Score: 132.109 bits (331), Expect = 4.270e-33
Identity = 96/329 (29.18%), Postives = 168/329 (51.06%), Query Frame = 2
Query:  656 FRYFATIQDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRKEKIDSEISQDSVFYLFG--------ENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXK-------YFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYA--EFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGL 1591
            F  FA+++   + +YM+P DF+ S++    +        +RRV L+++ I   + +   F   G        ++ +I++S+Y+FLLT+++  +  F IAF MFD + +G +D +EF ++  +  S +A         ++G  L +     + K       + FG  G   L+ ++F  F   LQ+E+M++EF  ++     I  VDFA  +L Y+   F D  K  +L+RVQ+K  D++  GIS S +  FS  L  +++  +A+  Y  +   + +             EL   ++ ++F +FDENNDG LS  EF+ VM  +L RGL
Sbjct:   83 FLQFASVE-YDDVIYMSPMDFIDSLTLDAPRER-----VYRRV-LKEKDIQRILKKTPPFRSGGKHFFRTMDQSGIISYSEYIFLLTLLTKSKAAFRIAFLMFDEDDNGNIDRDEFMLIARMFASKAA--------TLSGTRLVHKSEEEVRKQDTTLLLHLFGLRGNATLSFDEFQQFYENLQEELMEIEFYEFARGKTAISPVDFARLILRYSIVNFDDYHK--YLQRVQEK-SDDDEPGISLSQWATFSRFLNNLAEFQSAVRLYVNSNVPVSEPEFARAVGCTIGKELDPVVVSMIFRIFDENNDGTLSYPEFLAVMSDRLHRGL 393          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Celegans
Match: C56A3.6 (pep chromosome:WBcel235:V:13553374:13556408:-1 gene:WBGene00008345.1 transcript:C56A3.6b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C56A3.6)

HSP 1 Score: 128.257 bits (321), Expect = 5.730e-32
Identity = 94/322 (29.19%), Postives = 164/322 (50.93%), Query Frame = 2
Query:  656 FRYFATIQDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRKEKIDSEISQDSVFYLFG--------ENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYA--EFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGL 1591
            F  FA+++   + +YM+P DF+ S++    +        +RRV L+++ I   + +   F   G        ++ +I++S+Y+FLLT+++  +  F IAF MFD + +G +D +EF     +++S   +  R +D  +               + FG  G   L+ ++F  F   LQ+E+M++EF  ++     I  VDFA  +L Y+   F D  K  +L+RVQ+K  D++  GIS S +  FS  L  +++  +A+  Y  +   + +             EL   ++ ++F +FDENNDG LS  EF+ VM  +L RGL
Sbjct:   83 FLQFASVE-YDDVIYMSPMDFIDSLTLDAPRER-----VYRRV-LKEKDIQRILKKTPPFRSGGKHFFRTMDQSGIISYSEYIFLLTLLTKSKAAFRIAFLMFDEDDNGNIDRDEF-----MLKSEEEV--RKQDTTL-------------LLHLFGLRGNATLSFDEFQQFYENLQEELMEIEFYEFARGKTAISPVDFARLILRYSIVNFDDYHK--YLQRVQEK-SDDDEPGISLSQWATFSRFLNNLAEFQSAVRLYVNSNVPVSEPEFARAVGCTIGKELDPVVVSMIFRIFDENNDGTLSYPEFLAVMSDRLHRGL 374          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Celegans
Match: C56A3.6 (pep chromosome:WBcel235:V:13553374:13556408:-1 gene:WBGene00008345.1 transcript:C56A3.6d.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C56A3.6)

HSP 1 Score: 123.25 bits (308), Expect = 8.383e-30
Identity = 98/362 (27.07%), Postives = 174/362 (48.07%), Query Frame = 2
Query:  656 FRYFATIQDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRKEKIDSEISQDSVFYLFG--------ENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSI---IRSGS--------------------------AMGKRHRDNNVTGXXXXXXXXXXXXK-----------YFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYA--EFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGL 1591
            F  FA+++   + +YM+P DF+ S++    +        +RRV L+++ I   + +   F   G        ++ +I++S+Y+FLLT+++  +  F IAF MFD + +G +D +EF +++S+   +RS +                          A+ +   D   TG     ++ +   +           + FG  G   L+ ++F  F   LQ+E+M++EF  ++     I  VDFA  +L Y+   F D  K  +L+RVQ+K  D++  GIS S +  FS  L  +++  +A+  Y  +   + +             EL   ++ ++F +FDENNDG LS  EF+ VM  +L RGL
Sbjct:   83 FLQFASVE-YDDVIYMSPMDFIDSLTLDAPRER-----VYRRV-LKEKDIQRILKKTPPFRSGGKHFFRTMDQSGIISYSEYIFLLTLLTKSKAAFRIAFLMFDEDDNGNIDRDEFMLIRSLTSSLRSTTRVQPSTASDEEDRRESCQLDAADYHFAVSRIGADRLFTGADSYAVMFTKSEEEVRKQDTTLLLHLFGLRGNATLSFDEFQQFYENLQEELMEIEFYEFARGKTAISPVDFARLILRYSIVNFDDYHK--YLQRVQEK-SDDDEPGISLSQWATFSRFLNNLAEFQSAVRLYVNSNVPVSEPEFARAVGCTIGKELDPVVVSMIFRIFDENNDGTLSYPEFLAVMSDRLHRGL 434          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Celegans
Match: C56A3.6 (pep chromosome:WBcel235:V:13553374:13556391:-1 gene:WBGene00008345.1 transcript:C56A3.6d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C56A3.6)

HSP 1 Score: 123.25 bits (308), Expect = 8.383e-30
Identity = 98/362 (27.07%), Postives = 174/362 (48.07%), Query Frame = 2
Query:  656 FRYFATIQDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRKEKIDSEISQDSVFYLFG--------ENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSI---IRSGS--------------------------AMGKRHRDNNVTGXXXXXXXXXXXXK-----------YFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYA--EFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGL 1591
            F  FA+++   + +YM+P DF+ S++    +        +RRV L+++ I   + +   F   G        ++ +I++S+Y+FLLT+++  +  F IAF MFD + +G +D +EF +++S+   +RS +                          A+ +   D   TG     ++ +   +           + FG  G   L+ ++F  F   LQ+E+M++EF  ++     I  VDFA  +L Y+   F D  K  +L+RVQ+K  D++  GIS S +  FS  L  +++  +A+  Y  +   + +             EL   ++ ++F +FDENNDG LS  EF+ VM  +L RGL
Sbjct:   83 FLQFASVE-YDDVIYMSPMDFIDSLTLDAPRER-----VYRRV-LKEKDIQRILKKTPPFRSGGKHFFRTMDQSGIISYSEYIFLLTLLTKSKAAFRIAFLMFDEDDNGNIDRDEFMLIRSLTSSLRSTTRVQPSTASDEEDRRESCQLDAADYHFAVSRIGADRLFTGADSYAVMFTKSEEEVRKQDTTLLLHLFGLRGNATLSFDEFQQFYENLQEELMEIEFYEFARGKTAISPVDFARLILRYSIVNFDDYHK--YLQRVQEK-SDDDEPGISLSQWATFSRFLNNLAEFQSAVRLYVNSNVPVSEPEFARAVGCTIGKELDPVVVSMIFRIFDENNDGTLSYPEFLAVMSDRLHRGL 434          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Fly
Match: MICU1 (gene:FBgn0031893 transcript:FBtr0113028)

HSP 1 Score: 394.43 bits (1012), Expect = 9.840e-131
Identity = 208/366 (56.83%), Postives = 278/366 (75.96%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATIQ----DTTNEVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRK--EKIDSEISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVD-GIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDT 1657
            +VGFR+ +II YE+RIR +STPDK+FRYFATIQ    D  +EVYMTP DF+ S++PG+KQP+GLGLD +RR D +   E+++  + ++S+FY  G   LI FSDY+FLLTV+S  +R FEIAFRMFDLNGDG++D EEF++V +++R  ++MG RHRD+  TGNT   + ++ ++ YFFG +  +KLTI  F  FQ QLQ+EI+ LEFER  P D G I E DFA+ LL YA +P  KK+K L+RV+++++D    GIS  DY+ F H L  I+DVDTALTFYH+AGASIDQ TL+HV+K VA V LSDH++ +VFT+FDENND  LSNKEFI VMK ++ RGL+KP DTGF++++ +V KCAK+T
Sbjct:  155 KVGFRERKIIEYENRIRQFSTPDKVFRYFATIQVPVADDRHEVYMTPTDFLTSMTPGMKQPDGLGLDQYRRYDPKSVGEQLNLHLEKNSIFYKLGSYGLITFSDYIFLLTVLSISRRHFEIAFRMFDLNGDGDVDCEEFEMVATLVRQQTSMGTRHRDHANTGNTFKGVNSALIT-YFFGPNMDEKLTIEKFLDFQEQLQREILSLEFERKEPNDEGNITEADFAELLLAYAGYPLKKKQKKLKRVKRRFRDHGK-GISKQDYLDFFHFLNNINDVDTALTFYHIAGASIDQQTLQHVAKTVAMVNLSDHVVDVVFTIFDENNDNQLSNKEFISVMKNRVQRGLEKPKDTGFLKMMRSVFKCAKET 518          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Fly
Match: MICU1 (gene:FBgn0031893 transcript:FBtr0079405)

HSP 1 Score: 392.119 bits (1006), Expect = 7.558e-130
Identity = 209/365 (57.26%), Postives = 277/365 (75.89%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATI--QDTTNE-VYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRK--EKIDSEISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVD-GIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDT 1657
            +VGFR+ +II YE+RIR +STPDKIFRYFAT+  QD T   V MTP+DF+RSI PG+KQP+GLGLD +RR D +   E+++  + ++S+FY  G   LI FSDY+FLLTV+S  +R FEIAFRMFDLNGDG++D EEF++V +++R  ++MG RHRD+  TGNT   + ++ ++ YFFG +  +KLTI  F  FQ QLQ+EI+ LEFER  P D G I E DFA+ LL YA +P  KK+K L+RV+++++D    GIS  DY+ F H L  I+DVDTALTFYH+AGASIDQ TL+HV+K VA V LSDH++ +VFT+FDENND  LSNKEFI VMK ++ RGL+KP DTGF++++ +V KCAK+T
Sbjct:  155 KVGFRERKIIEYENRIRQFSTPDKIFRYFATVRLQDATQTIVCMTPEDFLRSIYPGIKQPDGLGLDQYRRYDPKSVGEQLNLHLEKNSIFYKLGSYGLITFSDYIFLLTVLSISRRHFEIAFRMFDLNGDGDVDCEEFEMVATLVRQQTSMGTRHRDHANTGNTFKGVNSALIT-YFFGPNMDEKLTIEKFLDFQEQLQREILSLEFERKEPNDEGNITEADFAELLLAYAGYPLKKKQKKLKRVKRRFRDHGK-GISKQDYLDFFHFLNNINDVDTALTFYHIAGASIDQQTLQHVAKTVAMVNLSDHVVDVVFTIFDENNDNQLSNKEFISVMKNRVQRGLEKPKDTGFLKMMRSVFKCAKET 517          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Fly
Match: CG4704 (gene:FBgn0039029 transcript:FBtr0084314)

HSP 1 Score: 206.838 bits (525), Expect = 9.507e-61
Identity = 122/354 (34.46%), Postives = 195/354 (55.08%), Query Frame = 2
Query:  608 IAYEDRIRSYSTPDKIFRYFATIQDTTN----EVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRK-EKIDSEISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGS-AMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERY-SPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCA 1648
            + YE+R+R ++ P KIFRYFATI+        E+YMTP DF+RSI PG+KQPE LGLD F+ +D     K   E+  DS+F    +  L+ +SDYV L  ++S P+R   I+F++FDLNGDG++ ++E D V   +  G  +M   H                 L  +FFG    K L+I++F  F   L  EI   +F+        +I E+DFA  +L   +    ++++ L+RV++K+   +  GI+  +++AF   ++ +S +D AL FY+  GA I   T++H++  V  V+LS HL  ++F +FD NND  +  KEF   M+++ +  +    +   +  +  V KC 
Sbjct:    1 MQYENRLRLHAHPTKIFRYFATIKMKNKSGKWELYMTPNDFLRSIQPGLKQPENLGLDKFQILDEHAANKWIPEVKDDSIFLKIEKRGLLTYSDYVLLTILLSIPERNVRISFKLFDLNGDGDVTIDELDTVFMAMTQGEVSMMNSH-----------------LKSHFFGHRLNKTLSIDEFLKFLHALHIEIHTDQFQNLLKESSSVISELDFAKVVLGLRK-SRSERREILKRVKKKFGQMDH-GITLEEFLAFFRFVQDVSIMDNALAFYYFTGADISPKTMRHIAYVVTGVKLSQHLTDVIFCIFDRNNDNIIQRKEFT-DMRRQWMHPIPLRKNPKLLSKMCIVCKCT 334          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Fly
Match: CG4704 (gene:FBgn0039029 transcript:FBtr0339138)

HSP 1 Score: 206.838 bits (525), Expect = 9.507e-61
Identity = 122/354 (34.46%), Postives = 195/354 (55.08%), Query Frame = 2
Query:  608 IAYEDRIRSYSTPDKIFRYFATIQDTTN----EVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRK-EKIDSEISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGS-AMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERY-SPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCA 1648
            + YE+R+R ++ P KIFRYFATI+        E+YMTP DF+RSI PG+KQPE LGLD F+ +D     K   E+  DS+F    +  L+ +SDYV L  ++S P+R   I+F++FDLNGDG++ ++E D V   +  G  +M   H                 L  +FFG    K L+I++F  F   L  EI   +F+        +I E+DFA  +L   +    ++++ L+RV++K+   +  GI+  +++AF   ++ +S +D AL FY+  GA I   T++H++  V  V+LS HL  ++F +FD NND  +  KEF   M+++ +  +    +   +  +  V KC 
Sbjct:    1 MQYENRLRLHAHPTKIFRYFATIKMKNKSGKWELYMTPNDFLRSIQPGLKQPENLGLDKFQILDEHAANKWIPEVKDDSIFLKIEKRGLLTYSDYVLLTILLSIPERNVRISFKLFDLNGDGDVTIDELDTVFMAMTQGEVSMMNSH-----------------LKSHFFGHRLNKTLSIDEFLKFLHALHIEIHTDQFQNLLKESSSVISELDFAKVVLGLRK-SRSERREILKRVKKKFGQMDH-GITLEEFLAFFRFVQDVSIMDNALAFYYFTGADISPKTMRHIAYVVTGVKLSQHLTDVIFCIFDRNNDNIIQRKEFT-DMRRQWMHPIPLRKNPKLLSKMCIVCKCT 334          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Fly
Match: CG4662 (gene:FBgn0038735 transcript:FBtr0083814)

HSP 1 Score: 150.214 bits (378), Expect = 6.780e-39
Identity = 103/353 (29.18%), Postives = 171/353 (48.44%), Query Frame = 2
Query:  665 FATIQDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRKEKIDS--------EISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSG--------------------SAMGKRHRD-----------------NNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRG 1588
            FA+++   +++YMTPQDF+ S+     +P        +R  L  +++D         +     +F    +  ++++++Y+FLL++++ P+  F IAF MFD +G+  +D +EF V+ SI+                        A  ++H +                 N+  G    +++ ++L  +FFG  G   +  ++F  F   LQ E+++LEF  +S  + +I E+DFA  LL Y      +   FL R+ ++ KDE   GISF D+  F H L  + D   A+  Y LA  +I +       K     +LS HLI  VF +FD + DG LS KEFI +MK +L RG
Sbjct:  107 FASVE-YDDQLYMTPQDFLDSVVEQEPRPR------LKRRQLSSDEVDKYKENTPALKKGSTRLFRNLRDKGIVSYTEYLFLLSILTKPKSGFRIAFNMFDTDGNQRVDKDEFLVIISILAGALKDTQNVDPQTKRIMERIFSGAWKEKHGEQEPEEELATPTPLENYVNDGEGLQRRHMVATTLQLHFFGKRGTGVINYDNFYRFMDNLQTEVLELEFHEFSKGNSVISELDFAKILLRYTYLATDEYDVFLERLLERVKDEK--GISFHDFRDFCHFLNNLDDFTIAMRMYTLADRAISKDEFSRAVKICTGYKLSPHLIDTVFAIFDADGDGLLSYKEFIAIMKDRLHRG 450          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Zebrafish
Match: micu1 (mitochondrial calcium uptake 1 [Source:NCBI gene;Acc:561210])

HSP 1 Score: 406.757 bits (1044), Expect = 7.176e-136
Identity = 211/369 (57.18%), Postives = 269/369 (72.90%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATI----QDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSF--RRVDLRKEKIDSE--ISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXX-XKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTV 1660
            R+GFRD +++ YE+RIR+YSTPDKIFRYFAT+    +    EVYMTPQDFVRSI+P  KQPE LGLD F  +R D +K   D E    +DS+FY  GE  LI+FSDY+FL TV+STPQR FEIAF+MFDLNGDGE+D+EEF+ V+SIIRS ++MG RHRD + TGNTL     SS  + YFFG+  K KLTI+ F  FQR+LQ +++KLEFER  PVDG I E  F   LL Y+     K K+  + +++ +KD    GI+F +   F   LK ++DVDTAL+FYH+AGASID+AT+K V++ VA VELSDH+  +VF LFD + +G LSNKEFI +MKQ+L+RGL+KP D GF RLV A+ KCA+DT 
Sbjct:  110 RIGFRDRKVMEYENRIRAYSTPDKIFRYFATLKIINEHGDAEVYMTPQDFVRSITPNEKQPENLGLDQFMVKRYDGKKISQDREKFADEDSIFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDLEEFEQVQSIIRSQTSMGMRHRDRSTTGNTLKTGGCSSALTTYFFGADLKGKLTISSFLEFQRKLQHDVLKLEFERNDPVDGRITEKQFGGMLLAYSGVQSRKLKQMQKNLKRMFKDAQ--GITFEEVENFFTFLKNVNDVDTALSFYHMAGASIDKATMKQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFIAIMKQRLMRGLEKPKDMGFTRLVRAMWKCAQDTA 476          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Zebrafish
Match: micu1 (mitochondrial calcium uptake 1 [Source:NCBI gene;Acc:561210])

HSP 1 Score: 402.134 bits (1032), Expect = 6.211e-134
Identity = 210/373 (56.30%), Postives = 270/373 (72.39%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATI----QDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSF--RRVDLRK--EKIDSE----ISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXX-XKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTV 1660
            R+GFRD +++ YE+RIR+YSTPDKIFRYFAT+    +    EVYMTPQDFVRSI+P  KQPE LGLD F  +R D +   +KI  +      +DS+FY  GE  LI+FSDY+FL TV+STPQR FEIAF+MFDLNGDGE+D+EEF+ V+SIIRS ++MG RHRD + TGNTL     SS  + YFFG+  K KLTI+ F  FQR+LQ +++KLEFER  PVDG I E  F   LL Y+     K K+  + +++ +KD    GI+F +   F   LK ++DVDTAL+FYH+AGASID+AT+K V++ VA VELSDH+  +VF LFD + +G LSNKEFI +MKQ+L+RGL+KP D GF RLV A+ KCA+DT 
Sbjct:  114 RIGFRDRKVMEYENRIRAYSTPDKIFRYFATLKIINEHGDAEVYMTPQDFVRSITPNEKQPENLGLDQFMVKRYDGKDFWQKISQDREKFADEDSIFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDLEEFEQVQSIIRSQTSMGMRHRDRSTTGNTLKTGGCSSALTTYFFGADLKGKLTISSFLEFQRKLQHDVLKLEFERNDPVDGRITEKQFGGMLLAYSGVQSRKLKQMQKNLKRMFKDAQ--GITFEEVENFFTFLKNVNDVDTALSFYHMAGASIDKATMKQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFIAIMKQRLMRGLEKPKDMGFTRLVRAMWKCAQDTA 484          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Zebrafish
Match: micu1 (mitochondrial calcium uptake 1 [Source:NCBI gene;Acc:561210])

HSP 1 Score: 401.749 bits (1031), Expect = 6.852e-134
Identity = 210/373 (56.30%), Postives = 270/373 (72.39%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATI----QDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSF--RRVDLRK--EKIDSE----ISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXX-XKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTV 1660
            R+GFRD +++ YE+RIR+YSTPDKIFRYFAT+    +    EVYMTPQDFVRSI+P  KQPE LGLD F  +R D +   +KI  +      +DS+FY  GE  LI+FSDY+FL TV+STPQR FEIAF+MFDLNGDGE+D+EEF+ V+SIIRS ++MG RHRD + TGNTL     SS  + YFFG+  K KLTI+ F  FQR+LQ +++KLEFER  PVDG I E  F   LL Y+     K K+  + +++ +KD    GI+F +   F   LK ++DVDTAL+FYH+AGASID+AT+K V++ VA VELSDH+  +VF LFD + +G LSNKEFI +MKQ+L+RGL+KP D GF RLV A+ KCA+DT 
Sbjct:  110 RIGFRDRKVMEYENRIRAYSTPDKIFRYFATLKIINEHGDAEVYMTPQDFVRSITPNEKQPENLGLDQFMVKRYDGKDFWQKISQDREKFADEDSIFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDLEEFEQVQSIIRSQTSMGMRHRDRSTTGNTLKTGGCSSALTTYFFGADLKGKLTISSFLEFQRKLQHDVLKLEFERNDPVDGRITEKQFGGMLLAYSGVQSRKLKQMQKNLKRMFKDAQ--GITFEEVENFFTFLKNVNDVDTALSFYHMAGASIDKATMKQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFIAIMKQRLMRGLEKPKDMGFTRLVRAMWKCAQDTA 480          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Zebrafish
Match: micu1 (mitochondrial calcium uptake 1 [Source:NCBI gene;Acc:561210])

HSP 1 Score: 221.476 bits (563), Expect = 3.098e-68
Identity = 119/198 (60.10%), Postives = 149/198 (75.25%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATI----QDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSF--RRVDLRKEKIDSE--ISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXX-XXXXXXXXXXKYFFGSHGKKKLTINDFTAF 1147
            R+GFRD +++ YE+RIR+YSTPDKIFRYFAT+    +    EVYMTPQDFVRSI+P  KQPE LGLD F  +R D +K   D E    +DS+FY  GE  LI+FSDY+FL TV+STPQR FEIAF+MFDLNGDGE+D+EEF+ V+SIIRS ++MG RHRD + TGNT  +   +S+L+ YFFG+  K KLTI+ F  F
Sbjct:    5 RIGFRDRKVMEYENRIRAYSTPDKIFRYFATLKIINEHGDAEVYMTPQDFVRSITPNEKQPENLGLDQFMVKRYDGKKISQDREKFADEDSIFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDLEEFEQVQSIIRSQTSMGMRHRDRSTTGNTLKTGGCSSALTTYFFGADLKGKLTISSFLEF 202          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Zebrafish
Match: micu3a (mitochondrial calcium uptake family, member 3a [Source:ZFIN;Acc:ZDB-GENE-070713-1])

HSP 1 Score: 156.377 bits (394), Expect = 2.818e-41
Identity = 105/326 (32.21%), Postives = 168/326 (51.53%), Query Frame = 2
Query:  638 STPDKIFRYFATIQDTTNEVYMTPQDFVRSIS---PGVKQPEGLGLDSFRRVDLRKEKIDSEISQDSVFYLFG---ENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXK---YFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRG 1588
            S+ +  FR F++++    ++YMTPQ+F+ S++   P +K+P      S  + +L K   D+         LF    E  +I +++Y+FLL +++ P   F+IAF MFD +G+  +D  EF V++ I R  +    R  D   +    ++      +    +FFG  GK +LT +DF  F   LQ E++++EF  YS     I E DFA  LL Y    DI+   +L  V+Q   DE   GI+F ++ +F   L  + D   A+  Y+ A  SI Q            ++L+ HL+  +F +FD ++D  LS KEFI +MK +L RG
Sbjct:  105 SSHEHRFRLFSSVE-YEGQLYMTPQNFIESVTMSEPRIKKP----WRSLTKQELEKILSDTPPVWKGTSKLFRNLRERGIIAYTEYLFLLCILTKPHAGFKIAFNMFDADGNQMVDKREFMVLQEIFRKKNEKKGRKGDAEKSAQLRADENMMIDTTLLVHFFGKKGKAELTFDDFYRFMDNLQTEMLEIEFLTYSKGMTTISEEDFARILLRYTNVEDIRS--YLENVRQCIPDEK--GITFEEFRSFFQFLNNLEDFAIAMQMYNFACRSIGQDEFARAVYVATGLKLTRHLVNTIFKIFDVDHDDQLSYKEFIGIMKDRLHRG 421          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Xenopus
Match: micu1 (mitochondrial calcium uptake 1 [Source:NCBI gene;Acc:100127574])

HSP 1 Score: 409.453 bits (1051), Expect = 6.081e-137
Identity = 207/370 (55.95%), Postives = 274/370 (74.05%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATI----QDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSF--RRVDLRKEKIDSE----ISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTV 1660
            RVGFRD +++ YE+RIR+YSTPDKIFRYFAT+    +   +EV+MTPQDFVRSI+P  KQPE LGLD F  +R D + EKI  E      +DS+FY  GE  LI+FSDY+FL TV+STPQR FEIAF+MFDLNGDGE+D+EEF+ V+SIIRS ++MG RHRD + TGNTL    +S+L+ YFFG+  K KLTI +F  FQR+LQ +++KLEFER+ PVDG I E  F   LL Y+     K    L+++++++KD    G++F +   F   LK I+DVDTAL+FYH+AGAS+D+ T++ V++ VA VELSDH+  +VF LFD + +G LSNKEFI +MKQ+L+RGL+KP D GF RL+ A+ KCA++T 
Sbjct:  100 RVGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVIHESGESEVFMTPQDFVRSITPNEKQPENLGLDQFIIKRYDGKTEKISQEREKFADEDSIFYSLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRSTTGNTLKTGFSSALTTYFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGHITERQFGSMLLAYSGVQSKKLTHMLKQLKKRFKDAE--GLTFEEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFIAIMKQRLMRGLEKPKDMGFTRLMRAMWKCAQETA 467          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Xenopus
Match: micu1 (mitochondrial calcium uptake 1 [Source:NCBI gene;Acc:100127574])

HSP 1 Score: 404.445 bits (1038), Expect = 5.458e-135
Identity = 205/368 (55.71%), Postives = 273/368 (74.18%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATI----QDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSF--RRVDLRKEKIDSE--ISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTV 1660
            RVGFRD +++ YE+RIR+YSTPDKIFRYFAT+    +   +EV+MTPQDFVRSI+P  KQPE LGLD F  +R D +K   + E    +DS+FY  GE  LI+FSDY+FL TV+STPQR FEIAF+MFDLNGDGE+D+EEF+ V+SIIRS ++MG RHRD + TGNTL    +S+L+ YFFG+  K KLTI +F  FQR+LQ +++KLEFER+ PVDG I E  F   LL Y+     K    L+++++++KD    G++F +   F   LK I+DVDTAL+FYH+AGAS+D+ T++ V++ VA VELSDH+  +VF LFD + +G LSNKEFI +MKQ+L+RGL+KP D GF RL+ A+ KCA++T 
Sbjct:  100 RVGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVIHESGESEVFMTPQDFVRSITPNEKQPENLGLDQFIIKRYDGKKISQEREKFADEDSIFYSLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRSTTGNTLKTGFSSALTTYFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGHITERQFGSMLLAYSGVQSKKLTHMLKQLKKRFKDAE--GLTFEEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFIAIMKQRLMRGLEKPKDMGFTRLMRAMWKCAQETA 465          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Xenopus
Match: tmem170a (transmembrane protein 170A [Source:Xenbase;Acc:XB-GENE-955221])

HSP 1 Score: 145.206 bits (365), Expect = 8.949e-37
Identity = 103/326 (31.60%), Postives = 166/326 (50.92%), Query Frame = 2
Query:  638 STPDKIFRYFATIQDTTNEVYMTPQDFVRSISPGVKQPEGLG-LDSFRRVDLRKEKIDSEI---SQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXK-----YFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRG 1588
            S+ ++ FR FA+++    ++YMTP+DF+ S++    +P       S  R +  +  +D+          F   G+  +I++++Y+FLL +++ P   F+IAF MFD +G+  +D EEF V++ I R  +   +R  +         + + SS+       +FFG  GK +L   DF  F   LQ E++++EF  YS     I E DFA  LL Y    +     +L  V+ +  +E   GISF ++ +F   L  + D   A+  Y+ A  SI Q   K        ++LS HL+  VF +FD + D  LS KEFI +MK +L RG
Sbjct:  164 SSREQRFRIFASLE-YEGQLYMTPRDFLASVT--TDEPRSAKHWRSISRTEQNQMLLDTPPVWKGTSRFFRTLGDKGMISYTEYLFLLCILTKPHAGFKIAFNMFDTDGNQMVDREEFLVLQEIFRKKNEKKERKGEEEKCAQLGPDELTSSMIHTTLLVHFFGKKGKAELNFEDFYKFMDNLQTEVLEIEFLTYSKGMSTISEEDFAHILLRYTNVENTSS--YLENVRLRIPEEK--GISFDEFRSFFQFLNNLEDFAIAMQMYNFANRSIGQDEFKRAVYVATGLKLSPHLVNTVFKIFDVDKDDQLSYKEFIGIMKDRLHRG 482          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Xenopus
Match: MICU2 (mitochondrial calcium uptake 2 [Source:NCBI gene;Acc:100486652])

HSP 1 Score: 126.716 bits (317), Expect = 6.055e-31
Identity = 94/343 (27.41%), Postives = 170/343 (49.56%), Query Frame = 2
Query:  656 FRYFATIQDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRKEKIDSEISQDSVFYL-FGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXK----YFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDK-PMDTGFIRLVTAVTKCAKDTVIQ 1666
            F  FA+++    E YMTP+DF+ S+              F +++ +   + ++    S+F+   G+  LI++++Y+FLLT+++ PQ  F IAF M D +G+ +++  EF  ++ I+     M  +     VT     +  +S ++     +FFG  G++KL  ++F  F   LQ E+ ++EF ++S     +R+ DFA+ LL + +  +     + + VQ +     SI  S  ++ +F   +  + D    +  +  A  +I  A  K   K     ELS++++  VF +FD + D  LS+ EF+ V++ +L RGL   P   G    V    KC K   I+
Sbjct:   86 FMQFASLK-YEGEYYMTPRDFLFSVM-------------FEQMERKSHTLATKAKPGSMFFRDLGDKGLISYTEYLFLLTILTKPQTGFRIAFNMLDTDGNEQVEKREFFKLQRILGHKEDM--KMSPGGVTSTQEPSTDSSDVNTTLLVHFFGRGGREKLQYSEFYKFMENLQTEVQEMEFIQFSKGLNFMRKEDFAEWLLFFTD--EENNDVYWQNVQARIPPGESI--SMDEFKSFYQFMNNLEDFSITMKLFSSANRAIKMAEFKRAVKVATGQELSNNVLDTVFKIFDLDGDNCLSHGEFLGVLRNRLHRGLKHVPQQQG----VHGYWKCVKRETIK 404          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Xenopus
Match: MICU2 (mitochondrial calcium uptake 2 [Source:NCBI gene;Acc:100486652])

HSP 1 Score: 126.716 bits (317), Expect = 1.807e-30
Identity = 102/352 (28.98%), Postives = 177/352 (50.28%), Query Frame = 2
Query:  656 FRYFATIQDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSFRRV---DLRKEKIDSEISQ------DSVFYL-FGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXK----YFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDK-PMDTGFIRLVTAVTKCAKDTVIQ 1666
            F  FA+++    E YMTP+DF+ S+    +Q E       RR     L K+++D+ +SQ       S+F+   G+  LI++++Y+FLLT+++ PQ  F IAF M D +G+ +++  EF  ++ I+  G     +     VT     +  +S ++     +FFG  G++KL  ++F  F   LQ E+ ++EF ++S     +R+ DFA+ LL + +  +     + + VQ +     SI  S  ++ +F   +  + D    +  +  A  +I  A  K   K     ELS++++  VF +FD + D  LS+ EF+ V++ +L RGL   P   G    V    KC K   I+
Sbjct:  140 FMQFASLK-YEGEYYMTPRDFLFSVM--FEQME-------RRTISKPLTKKELDAMLSQATKAKPGSMFFRDLGDKGLISYTEYLFLLTILTKPQTGFRIAFNMLDTDGNEQVEKREFFKLQRIL--GHKEDMKMSPGGVTSTQEPSTDSSDVNTTLLVHFFGRGGREKLQYSEFYKFMENLQTEVQEMEFIQFSKGLNFMRKEDFAEWLLFFTD--EENNDVYWQNVQARIPPGESI--SMDEFKSFYQFMNNLEDFSITMKLFSSANRAIKMAEFKRAVKVATGQELSNNVLDTVFKIFDLDGDNCLSHGEFLGVLRNRLHRGLKHVPQQQG----VHGYWKCVKRETIK 471          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Mouse
Match: Micu1 (mitochondrial calcium uptake 1 [Source:MGI Symbol;Acc:MGI:2384909])

HSP 1 Score: 392.504 bits (1007), Expect = 1.823e-130
Identity = 201/368 (54.62%), Postives = 268/368 (72.83%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATI----QDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSF--RRVDLRKEKIDSE--ISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTV 1660
            R GFRD +++ YE+RIR+YSTPDKIFRYFAT+    +    EV+MTPQDFVRSI+P  KQPE LGLD +  +R D +K   + E    + S+FY  GE  LI+FSDY+FL TV+STPQR FEIAF+MFDLNGDGE+D+EEF+ V+SIIRS ++MG RHRD   TGNTL + + S+L+ YFFG+  K KLTI +F  FQR+LQ +++KLEFER+ PVDG I E  F   LL Y+     K     R++++ +KD    G++F +   F   LK I+DVDTAL+FYH+AGAS+D+ T++ V++ VA VELSDH+  +VF LFD + +G LSNKEF+ +MKQ+L+RGL+KP D GF RL+ A+ KCA++T 
Sbjct:  105 RSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVINEPGETEVFMTPQDFVRSITPNEKQPEHLGLDQYIIKRFDGKKIAQEREKFADEGSIFYSLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTTYFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRISERQFGGMLLAYSGVQSKKLTAMQRQLKKHFKDGK--GLTFQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLMQAMWKCAQETA 470          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Mouse
Match: Micu1 (mitochondrial calcium uptake 1 [Source:MGI Symbol;Acc:MGI:2384909])

HSP 1 Score: 392.504 bits (1007), Expect = 1.823e-130
Identity = 201/368 (54.62%), Postives = 268/368 (72.83%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATI----QDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSF--RRVDLRKEKIDSE--ISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTV 1660
            R GFRD +++ YE+RIR+YSTPDKIFRYFAT+    +    EV+MTPQDFVRSI+P  KQPE LGLD +  +R D +K   + E    + S+FY  GE  LI+FSDY+FL TV+STPQR FEIAF+MFDLNGDGE+D+EEF+ V+SIIRS ++MG RHRD   TGNTL + + S+L+ YFFG+  K KLTI +F  FQR+LQ +++KLEFER+ PVDG I E  F   LL Y+     K     R++++ +KD    G++F +   F   LK I+DVDTAL+FYH+AGAS+D+ T++ V++ VA VELSDH+  +VF LFD + +G LSNKEF+ +MKQ+L+RGL+KP D GF RL+ A+ KCA++T 
Sbjct:  105 RSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVINEPGETEVFMTPQDFVRSITPNEKQPEHLGLDQYIIKRFDGKKIAQEREKFADEGSIFYSLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTTYFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRISERQFGGMLLAYSGVQSKKLTAMQRQLKKHFKDGK--GLTFQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLMQAMWKCAQETA 470          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Mouse
Match: Micu1 (mitochondrial calcium uptake 1 [Source:MGI Symbol;Acc:MGI:2384909])

HSP 1 Score: 392.119 bits (1006), Expect = 3.917e-130
Identity = 203/374 (54.28%), Postives = 269/374 (71.93%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATI----QDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSF--RRVD----LRKEKIDSE----ISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTV 1660
            R GFRD +++ YE+RIR+YSTPDKIFRYFAT+    +    EV+MTPQDFVRSI+P  KQPE LGLD +  +R D     + EKI  E      + S+FY  GE  LI+FSDY+FL TV+STPQR FEIAF+MFDLNGDGE+D+EEF+ V+SIIRS ++MG RHRD   TGNTL + + S+L+ YFFG+  K KLTI +F  FQR+LQ +++KLEFER+ PVDG I E  F   LL Y+     K     R++++ +KD    G++F +   F   LK I+DVDTAL+FYH+AGAS+D+ T++ V++ VA VELSDH+  +VF LFD + +G LSNKEF+ +MKQ+L+RGL+KP D GF RL+ A+ KCA++T 
Sbjct:  105 RSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVINEPGETEVFMTPQDFVRSITPNEKQPEHLGLDQYIIKRFDGKEFWQTEKIAQEREKFADEGSIFYSLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTTYFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRISERQFGGMLLAYSGVQSKKLTAMQRQLKKHFKD--GKGLTFQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLMQAMWKCAQETA 476          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Mouse
Match: Micu1 (mitochondrial calcium uptake 1 [Source:MGI Symbol;Acc:MGI:2384909])

HSP 1 Score: 391.349 bits (1004), Expect = 7.491e-130
Identity = 202/372 (54.30%), Postives = 270/372 (72.58%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATI----QDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSF--RRVDLRK--EKIDSE----ISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTV 1660
            R GFRD +++ YE+RIR+YSTPDKIFRYFAT+    +    EV+MTPQDFVRSI+P  KQPE LGLD +  +R D ++  +KI  E      + S+FY  GE  LI+FSDY+FL TV+STPQR FEIAF+MFDLNGDGE+D+EEF+ V+SIIRS ++MG RHRD   TGNTL + + S+L+ YFFG+  K KLTI +F  FQR+LQ +++KLEFER+ PVDG I E  F   LL Y+     K     R++++ +KD    G++F +   F   LK I+DVDTAL+FYH+AGAS+D+ T++ V++ VA VELSDH+  +VF LFD + +G LSNKEF+ +MKQ+L+RGL+KP D GF RL+ A+ KCA++T 
Sbjct:  105 RSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVINEPGETEVFMTPQDFVRSITPNEKQPEHLGLDQYIIKRFDGKEFWQKIAQEREKFADEGSIFYSLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTTYFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRISERQFGGMLLAYSGVQSKKLTAMQRQLKKHFKD--GKGLTFQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLMQAMWKCAQETA 474          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Mouse
Match: Micu1 (mitochondrial calcium uptake 1 [Source:MGI Symbol;Acc:MGI:2384909])

HSP 1 Score: 197.593 bits (501), Expect = 9.620e-59
Identity = 98/160 (61.25%), Postives = 123/160 (76.88%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATI----QDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSF--RRVDLRKEKIDSE--ISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRD 1036
            R GFRD +++ YE+RIR+YSTPDKIFRYFAT+    +    EV+MTPQDFVRSI+P  KQPE LGLD +  +R D +K   + E    + S+FY  GE  LI+FSDY+FL TV+STPQR FEIAF+MFDLNGDGE+D+EEF+ V+SIIRS ++MG RHRD
Sbjct:   72 RSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVINEPGETEVFMTPQDFVRSITPNEKQPEHLGLDQYIIKRFDGKKIAQEREKFADEGSIFYSLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRD 231          
BLAST of Calcium uptake protein 1, mitochondrial vs. UniProt/SwissProt
Match: sp|B1H2N3|MICU1_XENTR (Calcium uptake protein 1, mitochondrial OS=Xenopus tropicalis OX=8364 GN=micu1 PE=2 SV=2)

HSP 1 Score: 404.445 bits (1038), Expect = 2.891e-134
Identity = 205/368 (55.71%), Postives = 273/368 (74.18%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATI----QDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSF--RRVDLRKEKIDSE--ISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTV 1660
            RVGFRD +++ YE+RIR+YSTPDKIFRYFAT+    +   +EV+MTPQDFVRSI+P  KQPE LGLD F  +R D +K   + E    +DS+FY  GE  LI+FSDY+FL TV+STPQR FEIAF+MFDLNGDGE+D+EEF+ V+SIIRS ++MG RHRD + TGNTL    +S+L+ YFFG+  K KLTI +F  FQR+LQ +++KLEFER+ PVDG I E  F   LL Y+     K    L+++++++KD    G++F +   F   LK I+DVDTAL+FYH+AGAS+D+ T++ V++ VA VELSDH+  +VF LFD + +G LSNKEFI +MKQ+L+RGL+KP D GF RL+ A+ KCA++T 
Sbjct:  100 RVGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVIHESGESEVFMTPQDFVRSITPNEKQPENLGLDQFIIKRYDGKKISQEREKFADEDSIFYSLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRSTTGNTLKTGFSSALTTYFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGHITERQFGSMLLAYSGVQSKKLTHMLKQLKKRFKDAE--GLTFEEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFIAIMKQRLMRGLEKPKDMGFTRLMRAMWKCAQETA 465          
BLAST of Calcium uptake protein 1, mitochondrial vs. UniProt/SwissProt
Match: sp|A4IG32|MICU1_DANRE (Calcium uptake protein 1, mitochondrial OS=Danio rerio OX=7955 GN=micu1 PE=2 SV=1)

HSP 1 Score: 401.749 bits (1031), Expect = 5.172e-133
Identity = 210/373 (56.30%), Postives = 270/373 (72.39%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATI----QDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSF--RRVDLRK--EKIDSE----ISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXX-XKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTV 1660
            R+GFRD +++ YE+RIR+YSTPDKIFRYFAT+    +    EVYMTPQDFVRSI+P  KQPE LGLD F  +R D +   +KI  +      +DS+FY  GE  LI+FSDY+FL TV+STPQR FEIAF+MFDLNGDGE+D+EEF+ V+SIIRS ++MG RHRD + TGNTL     SS  + YFFG+  K KLTI+ F  FQR+LQ +++KLEFER  PVDG I E  F   LL Y+     K K+  + +++ +KD    GI+F +   F   LK ++DVDTAL+FYH+AGASID+AT+K V++ VA VELSDH+  +VF LFD + +G LSNKEFI +MKQ+L+RGL+KP D GF RLV A+ KCA+DT 
Sbjct:  110 RIGFRDRKVMEYENRIRAYSTPDKIFRYFATLKIINEHGDAEVYMTPQDFVRSITPNEKQPENLGLDQFMVKRYDGKDFWQKISQDREKFADEDSIFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDLEEFEQVQSIIRSQTSMGMRHRDRSTTGNTLKTGGCSSALTTYFFGADLKGKLTISSFLEFQRKLQHDVLKLEFERNDPVDGRITEKQFGGMLLAYSGVQSRKLKQMQKNLKRMFKDAQ--GITFEEVENFFTFLKNVNDVDTALSFYHMAGASIDKATMKQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFIAIMKQRLMRGLEKPKDMGFTRLVRAMWKCAQDTA 480          
BLAST of Calcium uptake protein 1, mitochondrial vs. UniProt/SwissProt
Match: sp|Q6P6Q9|MICU1_RAT (Calcium uptake protein 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Micu1 PE=2 SV=1)

HSP 1 Score: 393.275 bits (1009), Expect = 6.322e-130
Identity = 201/368 (54.62%), Postives = 268/368 (72.83%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATI----QDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSF--RRVDLRKEKIDSE--ISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTV 1660
            R GFRD +++ YE+RIR+YSTPDKIFRYFAT+    +    EV+MTPQDFVRSI+P  KQPE LGLD +  +R D +K   + E    + S+FY  GE  LI+FSDY+FL TV+STPQR FEIAF+MFDLNGDGE+D+EEF+ V+SIIRS ++MG RHRD   TGNTL + + S+L+ YFFG+  K KLTI +F  FQR+LQ +++KLEFER+ PVDG I E  F   LL Y+     K     R++++ +KD    G++F +   F   LK I+DVDTAL+FYH+AGAS+D+ T++ V++ VA VELSDH+  +VF LFD + +G LSNKEF+ +MKQ+L+RGL+KP D GF RL+ A+ KCA++T 
Sbjct:  105 RSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVINEPGETEVFMTPQDFVRSITPNEKQPEHLGLDQYIIKRFDGKKIAQEREKFADEGSIFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTTYFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRISERQFGGMLLAYSGVQSKKLTAMQRQLKKHFKDGK--GLTFQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLMQAMWKCAQETA 470          
BLAST of Calcium uptake protein 1, mitochondrial vs. UniProt/SwissProt
Match: sp|A2VEI2|MICU1_DROME (Calcium uptake protein 1 homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN=MICU1 PE=2 SV=1)

HSP 1 Score: 394.43 bits (1012), Expect = 9.864e-130
Identity = 208/366 (56.83%), Postives = 278/366 (75.96%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATIQ----DTTNEVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRK--EKIDSEISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVD-GIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDT 1657
            +VGFR+ +II YE+RIR +STPDK+FRYFATIQ    D  +EVYMTP DF+ S++PG+KQP+GLGLD +RR D +   E+++  + ++S+FY  G   LI FSDY+FLLTV+S  +R FEIAFRMFDLNGDG++D EEF++V +++R  ++MG RHRD+  TGNT   + ++ ++ YFFG +  +KLTI  F  FQ QLQ+EI+ LEFER  P D G I E DFA+ LL YA +P  KK+K L+RV+++++D    GIS  DY+ F H L  I+DVDTALTFYH+AGASIDQ TL+HV+K VA V LSDH++ +VFT+FDENND  LSNKEFI VMK ++ RGL+KP DTGF++++ +V KCAK+T
Sbjct:  155 KVGFRERKIIEYENRIRQFSTPDKVFRYFATIQVPVADDRHEVYMTPTDFLTSMTPGMKQPDGLGLDQYRRYDPKSVGEQLNLHLEKNSIFYKLGSYGLITFSDYIFLLTVLSISRRHFEIAFRMFDLNGDGDVDCEEFEMVATLVRQQTSMGTRHRDHANTGNTFKGVNSALIT-YFFGPNMDEKLTIEKFLDFQEQLQREILSLEFERKEPNDEGNITEADFAELLLAYAGYPLKKKQKKLKRVKRRFRDHGK-GISKQDYLDFFHFLNNINDVDTALTFYHIAGASIDQQTLQHVAKTVAMVNLSDHVVDVVFTIFDENNDNQLSNKEFISVMKNRVQRGLEKPKDTGFLKMMRSVFKCAKET 518          
BLAST of Calcium uptake protein 1, mitochondrial vs. UniProt/SwissProt
Match: sp|Q8VCX5|MICU1_MOUSE (Calcium uptake protein 1, mitochondrial OS=Mus musculus OX=10090 GN=Micu1 PE=1 SV=1)

HSP 1 Score: 392.504 bits (1007), Expect = 1.275e-129
Identity = 201/368 (54.62%), Postives = 268/368 (72.83%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATI----QDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSF--RRVDLRKEKIDSE--ISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTV 1660
            R GFRD +++ YE+RIR+YSTPDKIFRYFAT+    +    EV+MTPQDFVRSI+P  KQPE LGLD +  +R D +K   + E    + S+FY  GE  LI+FSDY+FL TV+STPQR FEIAF+MFDLNGDGE+D+EEF+ V+SIIRS ++MG RHRD   TGNTL + + S+L+ YFFG+  K KLTI +F  FQR+LQ +++KLEFER+ PVDG I E  F   LL Y+     K     R++++ +KD    G++F +   F   LK I+DVDTAL+FYH+AGAS+D+ T++ V++ VA VELSDH+  +VF LFD + +G LSNKEF+ +MKQ+L+RGL+KP D GF RL+ A+ KCA++T 
Sbjct:  105 RSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVINEPGETEVFMTPQDFVRSITPNEKQPEHLGLDQYIIKRFDGKKIAQEREKFADEGSIFYSLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTTYFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRISERQFGGMLLAYSGVQSKKLTAMQRQLKKHFKDGK--GLTFQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLMQAMWKCAQETA 470          
BLAST of Calcium uptake protein 1, mitochondrial vs. TrEMBL
Match: A0A1S3JJ26 (calcium uptake protein 1, mitochondrial isoform X2 OS=Lingula unguis OX=7574 GN=LOC106173734 PE=4 SV=1)

HSP 1 Score: 457.603 bits (1176), Expect = 5.281e-152
Identity = 216/357 (60.50%), Postives = 285/357 (79.83%), Query Frame = 2
Query:  584 VGFRDSRIIAYEDRIRSYSTPDKIFRYFATIQDT-TNEVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRKEKIDSEISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAK 1651
            VGFRD +IIAYEDRIR+YSTPDKIFRYFAT+Q+  + E+YMTP+DFVRS++PG+KQPEGLGLD F++ D++K+ +   +SQDSVF   GE+AL+ F+DY+FLLT++S PQ+QFE+AF+MFDLNGDGELD  EF+ V+ +IR+ +++G+RHRD   TG+++    N++L+ YFFG     KLT+ +F  FQ +LQ E+M+LEFE+  P DG I E DFA SL++YA   D+++ K L+R+++K+K E S GI+F DYV F H LK I DVDTALTFYH+AGASIDQ TLKHV+K VA V+L DH++  VFTLFDEN DG LSNKEF+ VMKQ+++RGL+KP DTGF +L+ AV KCAK
Sbjct:  149 VGFRDRKIIAYEDRIRAYSTPDKIFRYFATLQEQDSGEIYMTPEDFVRSLTPGMKQPEGLGLDQFKKFDIKKDSVARNVSQDSVFNALGEHALVAFNDYIFLLTLLSAPQKQFELAFKMFDLNGDGELDFGEFEKVQGVIRAQTSVGQRHRD---TGDSVIKHTNTALACYFFGPKCDGKLTVEEFLKFQGKLQMEVMRLEFEKCEPEDGKITERDFAMSLIMYAGMSDVRRTKMLKRIKKKFKGEASQGITFEDYVKFYHFLKNIGDVDTALTFYHIAGASIDQETLKHVAKTVAGVDLGDHIVETVFTLFDENEDGELSNKEFVSVMKQRMMRGLEKPKDTGFFKLLNAVYKCAK 502          
BLAST of Calcium uptake protein 1, mitochondrial vs. TrEMBL
Match: A0A1S3JKI1 (calcium uptake protein 1, mitochondrial isoform X1 OS=Lingula unguis OX=7574 GN=LOC106173734 PE=4 SV=1)

HSP 1 Score: 450.284 bits (1157), Expect = 3.688e-149
Identity = 216/364 (59.34%), Postives = 285/364 (78.30%), Query Frame = 2
Query:  584 VGFRDSRIIAYEDRIRSYSTPDKIFRYFATIQDT-TNEVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLR-------KEKIDSEISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAK 1651
            VGFRD +IIAYEDRIR+YSTPDKIFRYFAT+Q+  + E+YMTP+DFVRS++PG+KQPEGLGLD F++ D++       K+ +   +SQDSVF   GE+AL+ F+DY+FLLT++S PQ+QFE+AF+MFDLNGDGELD  EF+ V+ +IR+ +++G+RHRD   TG+++    N++L+ YFFG     KLT+ +F  FQ +LQ E+M+LEFE+  P DG I E DFA SL++YA   D+++ K L+R+++K+K E S GI+F DYV F H LK I DVDTALTFYH+AGASIDQ TLKHV+K VA V+L DH++  VFTLFDEN DG LSNKEF+ VMKQ+++RGL+KP DTGF +L+ AV KCAK
Sbjct:  149 VGFRDRKIIAYEDRIRAYSTPDKIFRYFATLQEQDSGEIYMTPEDFVRSLTPGMKQPEGLGLDQFKKFDIKEYEHLYLKDSVARNVSQDSVFNALGEHALVAFNDYIFLLTLLSAPQKQFELAFKMFDLNGDGELDFGEFEKVQGVIRAQTSVGQRHRD---TGDSVIKHTNTALACYFFGPKCDGKLTVEEFLKFQGKLQMEVMRLEFEKCEPEDGKITERDFAMSLIMYAGMSDVRRTKMLKRIKKKFKGEASQGITFEDYVKFYHFLKNIGDVDTALTFYHIAGASIDQETLKHVAKTVAGVDLGDHIVETVFTLFDENEDGELSNKEFVSVMKQRMMRGLEKPKDTGFFKLLNAVYKCAK 509          
BLAST of Calcium uptake protein 1, mitochondrial vs. TrEMBL
Match: A0A158R802 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS4664 PE=4 SV=1)

HSP 1 Score: 444.891 bits (1143), Expect = 9.506e-149
Identity = 216/367 (58.86%), Postives = 290/367 (79.02%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATI----QDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRKEKIDSEISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENS---IGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTV 1660
            +V    S+ IAYEDRIR+YSTPDKIFRYFAT+    +D T+E+ MTP+DF+R+I+PG+KQP+GL LD+F + D +K+K+D  I QDS+FY FG NALI+F+D+VFLLTVISTPQRQFEIAFRMFD+NGDGEL+  EFDVV+ +I   +AMG+RHRD++ TG+TL ++ +S+L  YFFGS GK+KL I+ F  FQ +LQ+EI +LEFERY P +G I E  FA SLL YA F + K++  LRRV++K+ ++++   +GI+F +++ F+HLL+C+S++DTALTF+ LAGA+ID AT  HVSK VA+VEL+ HL+ +VF LFDEN+DG LS KEF+ VMK +L RGLDKPMDTGFIR + A+  C +  +
Sbjct:   25 KVSIACSQFIAYEDRIRAYSTPDKIFRYFATLKRVDEDGTSEILMTPEDFLRAITPGLKQPDGLDLDAFIKFDPKKDKLDLNIPQDSIFYCFGNNALISFTDFVFLLTVISTPQRQFEIAFRMFDINGDGELEASEFDVVRGVILDTTAMGRRHRDHSTTGSTLKSVSHSALHDYFFGSDGKQKLKISKFLEFQSRLQEEITQLEFERYGPKEGRITEQAFAKSLLTYAGFSENKRRLMLRRVKKKFPEDDAGTYVGITFKEFLDFTHLLRCVSELDTALTFHTLAGAAIDPATFLHVSKVVAHVELTPHLVDVVFALFDENDDGQLSYKEFVHVMKNRLFRGLDKPMDTGFIRFLNAIAYCVQHEI 391          
BLAST of Calcium uptake protein 1, mitochondrial vs. TrEMBL
Match: A0A0R3X5K5 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS8741 PE=4 SV=1)

HSP 1 Score: 445.662 bits (1145), Expect = 2.086e-148
Identity = 217/358 (60.61%), Postives = 286/358 (79.89%), Query Frame = 2
Query:  608 IAYEDRIRSYSTPDKIFRYFATI----QDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRKEKIDSEISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYK---DENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTV 1660
            IAYEDRIR+YSTPDKIFRYFAT+    +D T+EV+MTP DF+R+I+PG+KQP+GL LD+F + D +K+K+D  I +DS+FY FG NALI+F+D+VFLLTVISTPQRQFEIAFRMFD+NGDGEL+  EFDVV+ +I   +AMG+RHRD++ TG+TL ++ +S+L  YFFGS GK+KL I+ F  FQ +LQ+EI +LEFERY P +G I E  FA SLL YA F + K++  LRRV++K+    DENS+GI+F +++ F+HLL+C+S++DTALTF+ LAGA+ID  T  HVSK VA+V+L+ HL+ +VFTLFDEN+DG LS KEF+ VMK +L RGLDKPMDTGFIR + A+  C +  +
Sbjct:   80 IAYEDRIRAYSTPDKIFRYFATLKCVYEDGTSEVFMTPDDFLRAITPGLKQPDGLDLDAFIKFDPKKDKLDLNIPKDSIFYCFGNNALISFTDFVFLLTVISTPQRQFEIAFRMFDINGDGELEASEFDVVRGVILDTTAMGRRHRDHSTTGSTLKSVSHSALHDYFFGSDGKQKLKISKFLEFQSRLQEEITQLEFERYGPKEGRITEQAFAKSLLTYAGFSENKRRLMLRRVKKKFPEDDDENSVGITFQEFLDFTHLLRCVSELDTALTFHTLAGAAIDPTTFLHVSKVVAHVQLTPHLVDVVFTLFDENDDGQLSYKEFVQVMKNRLFRGLDKPMDTGFIRFLNAIVYCVQHEI 437          
BLAST of Calcium uptake protein 1, mitochondrial vs. TrEMBL
Match: A0A2C9JTJ9 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106067709 PE=4 SV=1)

HSP 1 Score: 442.58 bits (1137), Expect = 1.339e-147
Identity = 217/363 (59.78%), Postives = 283/363 (77.96%), Query Frame = 2
Query:  584 VGFRDSRIIAYEDRIRSYSTPDKIFRYFATIQ---DTTNEVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRKEKIDS--EISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDT 1657
            VGFRD RII YEDRIR+YSTPDKIFRYFAT++   D   E++MTP+DFVRSI+PG+KQPEGLGLDSF++ D  ++  D+   +  DS+FY FG+  LI+FSDY+FLLTV+STP R FEIAFRMFD NGDGE+D EEF  V+ IIR+ +++G +HR+++ TG+    + ++    YFFG+ GKKKLT++ F  FQRQL +EI K+EF+R++  + +I E DF   LL YA  PD KK + L+RV++KYK E+  GI+F +Y+AF   LK I+DVDTAL+FYHLAG SIDQ TLKHV+K VA VELSDH+I +VFTLFDENNDG LSN+EF+ VMK++++RGLD+P DTGF++L+ AV KCA  T
Sbjct:   53 VGFRDRRIIGYEDRIRAYSTPDKIFRYFATLKVNIDGDWEIFMTPEDFVRSITPGIKQPEGLGLDSFKKFDPTRQDKDAIGMLEPDSIFYKFGQTGLISFSDYIFLLTVLSTPPRNFEIAFRMFDFNGDGEVDSEEFSKVQEIIRNQTSVGMKHRNHSTTGSVDHGMSSALS-SYFFGTDGKKKLTVSQFLEFQRQLHREINKIEFDRHAE-NNLISERDFGSVLLTYAGLPDSKKSRMLKRVRRKYK-EDPKGITFEEYLAFWRFLKSINDVDTALSFYHLAGVSIDQETLKHVAKTVAMVELSDHVIDVVFTLFDENNDGELSNREFVSVMKRRVMRGLDQPKDTGFVKLINAVVKCATST 412          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Cavefish
Match: micu1 (mitochondrial calcium uptake 1 [Source:NCBI gene;Acc:103028098])

HSP 1 Score: 403.675 bits (1036), Expect = 8.587e-135
Identity = 210/369 (56.91%), Postives = 269/369 (72.90%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATIQDTTN----EVYMTPQDFVRSISPGVKQPEGLGLDSF--RRVDLRKEKIDSE--ISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXX-XKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTV 1660
            R+GFRD +++ YE+RIR+YSTPDKIFRYFAT++  +     EVYMTPQDF+RSI+P  KQPE LGLD F  +R D +K   + E    +DS+FY  GE  LI+FSDY+FL TV+STPQR FEIAF+MFDLNGDGE+D+EEF+ V+SIIRS ++MG RHRD + TGNTL     SS  + YFFG+  K KLTI  F  FQR+LQ +++KLEFER  PVDG I E  F   LL Y+     K K+  + +++ +KD    GISF +   F   LK ++DVDTAL+FYH+AGASID+AT+K V++ VA VELSDH+  +VF LFD + +G LSNKEFI +MKQ+L+RGL+KP D GF RLV A+ KCA+DT 
Sbjct:  108 RIGFRDRKVMEYENRIRAYSTPDKIFRYFATLKIISEHGDAEVYMTPQDFIRSITPNEKQPENLGLDQFAVKRYDGKKIAQEREKFADEDSIFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDLEEFEQVQSIIRSQTSMGMRHRDRSTTGNTLRTAGCSSALTTYFFGADLKGKLTIGSFLEFQRKLQHDVLKLEFERNDPVDGKITERQFGGMLLAYSGVQSRKLKQTQKGLKKMFKDAQ--GISFEEVENFFTFLKNVNDVDTALSFYHMAGASIDKATMKQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFIAIMKQRLMRGLEKPKDMGFTRLVRAMWKCAQDTA 474          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Cavefish
Match: micu1 (mitochondrial calcium uptake 1 [Source:NCBI gene;Acc:103028098])

HSP 1 Score: 402.134 bits (1032), Expect = 3.277e-134
Identity = 211/373 (56.57%), Postives = 270/373 (72.39%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATIQDTTN----EVYMTPQDFVRSISPGVKQPEGLGLDSF--RRVDLRK--EKIDSE----ISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXX-XKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTV 1660
            R+GFRD +++ YE+RIR+YSTPDKIFRYFAT++  +     EVYMTPQDF+RSI+P  KQPE LGLD F  +R D +   +KI  E      +DS+FY  GE  LI+FSDY+FL TV+STPQR FEIAF+MFDLNGDGE+D+EEF+ V+SIIRS ++MG RHRD + TGNTL     SS  + YFFG+  K KLTI  F  FQR+LQ +++KLEFER  PVDG I E  F   LL Y+     K K+  + +++ +KD    GISF +   F   LK ++DVDTAL+FYH+AGASID+AT+K V++ VA VELSDH+  +VF LFD + +G LSNKEFI +MKQ+L+RGL+KP D GF RLV A+ KCA+DT 
Sbjct:  108 RIGFRDRKVMEYENRIRAYSTPDKIFRYFATLKIISEHGDAEVYMTPQDFIRSITPNEKQPENLGLDQFAVKRYDGKDFWQKIAQEREKFADEDSIFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDLEEFEQVQSIIRSQTSMGMRHRDRSTTGNTLRTAGCSSALTTYFFGADLKGKLTIGSFLEFQRKLQHDVLKLEFERNDPVDGKITERQFGGMLLAYSGVQSRKLKQTQKGLKKMFKDAQ--GISFEEVENFFTFLKNVNDVDTALSFYHMAGASIDKATMKQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFIAIMKQRLMRGLEKPKDMGFTRLVRAMWKCAQDTA 478          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Cavefish
Match: micu3b (calcium uptake protein 3, mitochondrial [Source:NCBI gene;Acc:103030403])

HSP 1 Score: 145.591 bits (366), Expect = 1.807e-37
Identity = 109/355 (30.70%), Postives = 171/355 (48.17%), Query Frame = 2
Query:  584 VGFRDSRIIAYEDRIRSYSTPDKIFRYFATIQDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRKEKIDSE-ISQDS--VFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKY-----------------FFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRG 1588
            V  ++   I  +D   + S  +  FR F++++    ++YMTP DF+ S++    + +     S  + DL K   D+  I + S   F    E  +I++++Y+FLL +++ P+  F IAF MFD +G+  +D  EF V++ I R  +   +R  D++ T   +     +    Y                 FFG  G  +L   DF  F   LQ E++++EF  YS     I E DFA  LL Y    +I    +L  V+Q   DE   GISF ++ +F   L  + D   A+  Y+ A  SI Q             +LS HL+ I+F +FD ++D  LS KEFI +MK +L RG
Sbjct:   77 VAAKEKTKIRIDDENITMSAHEHRFRLFSSLE-YEGQLYMTPLDFIESVTMSEPKKKKF-WRSLTKQDLEKMLSDTPPIWKGSSRFFRNLCEKGIISYTEYLFLLCILTKPRAGFRIAFNMFDADGNAMVDKREFTVLEEIFRKKNDKKERGGDSDSTSQLVRKYTFAVSLLYWISNVHENITDTTLLVHFFGKKGNSELNFQDFYRFMDNLQTEVLEIEFLSYSKGMTTISEEDFARILLRYTTVDNIGS--YLENVRQSIPDEK--GISFEEFRSFFQFLNNLEDFAIAMQMYNFASRSIGQDEFGRAVYVATGHKLSAHLVNIIFKIFDVDHDDQLSYKEFIGIMKDRLHRG 425          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Cavefish
Match: micu2 (mitochondrial calcium uptake 2 [Source:ZFIN;Acc:ZDB-GENE-030131-3374])

HSP 1 Score: 132.109 bits (331), Expect = 3.195e-33
Identity = 95/326 (29.14%), Postives = 159/326 (48.77%), Query Frame = 2
Query:  692 EVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRKEKIDSEISQDS-VFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTVIQ 1666
            E+YMTP+DF+ SI                 +D +   + S+    S +F   G+  LI++++Y+FLLT+++ PQ  F+IAF+M D++G+  +D +EF+ V+ ++      G     +              L  +FFG  G+ KL   +F  F   LQ E+ ++EF ++S     +R  DFA+ LL Y    D     +L  ++++     S  I+F ++ AF      + D   ++     A   I  A  +   K     ELS++++  VF +FD + D  LS+KEFI VMK ++LRGL    + G    V+   KC K   ++
Sbjct:   81 ELYMTPRDFLYSIM----------------LDDKMLNVASKAKAGSNLFRGIGDGGLISYTEYLFLLTILTKPQTGFDIAFKMLDIDGNEHVDKKEFEKVQYLLHCLYQGGVDDEPSTT------------LQAFFFGRKGQNKLQYKEFHRFMEDLQAEVQEMEFLQFSKGMDTMRREDFAEWLLYYTNEED--NDVYLENMRKRIPTGES--ITFDEFKAFCLFANNLEDFILSMKMIAEANRPIGMAQFERAVKITTGQELSENVLDTVFKIFDLDGDNCLSHKEFIAVMKDRVLRGLRVRSNQG----VSGFWKCVKRETLK 370          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Cavefish
Match: micu3b (calcium uptake protein 3, mitochondrial [Source:NCBI gene;Acc:103030403])

HSP 1 Score: 107.457 bits (267), Expect = 2.475e-24
Identity = 103/388 (26.55%), Postives = 171/388 (44.07%), Query Frame = 2
Query:  584 VGFRDSRIIAYEDRIRSYSTPDKIFRYFATIQDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRKEKIDSEI---SQDSVFYLFGENALINFSDYVFLLTVISTP--------------------QRQFEIAFRMF-----------DLNGDGELDVEEFDVVKSIIRSGSAMGKRHRD-------------------NNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRG 1588
            V  ++   I  +D   + S  +  FR F++++    ++YMTP DF+ S++    + +     S  + DL K   D+          F    E  +I++++Y+FLL +++ P                    +R+F +   +F           D +   +L VE +    S+  SG+ + K   +                   +++  N   N+ +++L  +FFG  G  +L   DF  F   LQ E++++EF  YS     I E DFA  LL Y    +I    +L  V+Q   DE   GISF ++ +F   L  + D   A+  Y+ A  SI Q             +LS HL+ I+F +FD ++D  LS KEFI +MK +L RG
Sbjct:   77 VAAKEKTKIRIDDENITMSAHEHRFRLFSSLE-YEGQLYMTPLDFIESVTMSEPKKKKF-WRSLTKQDLEKMLSDTPPIWKGSSRFFRNLCEKGIISYTEYLFLLCILTKPRAGFRIAFNMFDADGNAMVDKREFTVLEEIFRKKNDKKERGGDSDSTSQLSVELYGYQGSV--SGAVLKKDQAEFEPRSFWDVLKQGAKVVLFSDLVENVQENITDTTLLVHFFGKKGNSELNFQDFYRFMDNLQTEVLEIEFLSYSKGMTTISEEDFARILLRYTTVDNIGS--YLENVRQSIPDEK--GISFEEFRSFFQFLNNLEDFAIAMQMYNFASRSIGQDEFGRAVYVATGHKLSAHLVNIIFKIFDVDHDDQLSYKEFIGIMKDRLHRG 456          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Sea Lamprey
Match: micu1 (mitochondrial calcium uptake 1 [Source:NCBI gene;Acc:561210])

HSP 1 Score: 401.364 bits (1030), Expect = 1.142e-134
Identity = 207/369 (56.10%), Postives = 276/369 (74.80%), Query Frame = 2
Query:  584 VGFRDSRIIAYEDRIRSYSTPDKIFRYFATI----QDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSF--RRVDLRKEKIDSEI--SQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTVIQ 1666
            VGFRD R+I YE+RIR++STPDKIFRYFAT+    +   ++V+MTPQDFVRSI+P  KQPE LGLD F  +R D +K   + E+   +DS+F++ GE  LI+FSDY+FL TV+STPQR FEIAF+MFDLNGDGE+D+EEF+ V+SI+RS ++MG RHRD + TGNTL +  NS+L+ +FFG     KLTI+ F  FQR+LQ++I+KLEFER  PVDG I E  F + LL Y+     K    L+ V++++KD    GI+F +   F   LK I+DVDTALTFYH+AGASID++T++ V++ VA VELSDH+  +V+TLFD + +G LSNKEF+ +MKQ+L+RGL+KP D GF RLV A+ KCAK+T  +
Sbjct:  101 VGFRDRRVIEYENRIRAFSTPDKIFRYFATLKIYNESGESDVFMTPQDFVRSITPNEKQPENLGLDQFIVKRYDGKKLAHEREMFADEDSIFHVLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDLEEFERVQSIVRSQTSMGMRHRDRSTTGNTLKSGFNSALTTFFFGEDLHGKLTIDKFLQFQRRLQRDILKLEFERQDPVDGHISERRFGNMLLAYSGVKSKKLTHMLKHVKKEFKD--GPGITFEEVQNFFTFLKNINDVDTALTFYHMAGASIDKSTMQQVARTVAKVELSDHVCDVVYTLFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLVDAMWKCAKETTWE 467          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004434.1 (pep scaffold:Pmarinus_7.0:GL476717:249768:260461:-1 gene:ENSPMAG00000004025.1 transcript:ENSPMAT00000004434.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.6633 bits (226), Expect = 3.824e-20
Identity = 57/168 (33.93%), Postives = 82/168 (48.81%), Query Frame = 2
Query: 1091 YFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKK--KKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRG 1588
            + FG +G K+L   DF  F   LQ+E++  EF   +    +I E  FA  LL Y +  D     +    RV          GISF ++ +F   L  + D   A+  Y  AG +I Q   +   +    + LS HL+  VF LFDE+ DG LS+ EF+ VM+ +L RG
Sbjct:  202 HLFGRNGDKELDYQDFYRFTTALQEEVLWREFSACAHGRRVISEGAFARVLLRYTDVRDAAAITENLAARVPAGQ------GISFEEFHSFFQFLNNLEDFSIAVQMYTRAGLAIGQDEFRRAVRVATGLHLSPHLVCTVFHLFDEDGDGRLSHTEFLGVMRDRLRRG 363          

HSP 2 Score: 65.4698 bits (158), Expect = 1.146e-11
Identity = 39/107 (36.45%), Postives = 60/107 (56.07%), Query Frame = 2
Query:  698 YMTPQDFVRSI---SPGVKQPEG-LGLDSFRRVDLRKEKIDSEISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRS 1006
            YMTP DFV S+   SP    P+  L     + +  +   +D   SQ  +F+  G N LI++SDY+FLL +++ P   F+IAF M D +G+  +D  EF +++ I  S
Sbjct:   19 YMTPSDFVDSVTRNSPCDDAPKRILTEKEVQSILAKTPALDERRSQ--LFHSMGHNGLISYSDYLFLLCILTKPLAGFQIAFNMLDTDGNQHIDKTEFLMMQEIFNS 123          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005927.1 (pep scaffold:Pmarinus_7.0:GL478382:39338:47730:1 gene:ENSPMAG00000005358.1 transcript:ENSPMAT00000005927.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 1.911e-6
Identity = 49/187 (26.20%), Postives = 83/187 (44.39%), Query Frame = 2
Query:  689 NEVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRKEKIDSEISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFE-RYSPVDGIIREVDFADSLL 1246
             E YMTP+DFV+           LGL +    +    +  + I+  +      ++ LI+F ++    +V+  P   F +AF++FD  G GE+    F+ VK++    +    +H   N          +    +  FG    K+LT  +FT F ++LQ E  +  F  + S   G I  +DF D +L
Sbjct:   50 GEHYMTPEDFVQRY---------LGLHNEHNYNPLTVRTLASIADTT------KDGLISFQEFSAFESVLCAPDALFIVAFQLFDKEGKGEV---TFEGVKAVFSQTTI--HQHIPFN---------WDCDFIRLHFGHTRDKRLTYAEFTQFLQELQLEHARQAFALKDSNKSGTIPALDFNDIML 207          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005924.1 (pep scaffold:Pmarinus_7.0:GL478382:39024:47730:1 gene:ENSPMAG00000005358.1 transcript:ENSPMAT00000005924.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.7506 bits (112), Expect = 1.981e-6
Identity = 49/187 (26.20%), Postives = 83/187 (44.39%), Query Frame = 2
Query:  689 NEVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRKEKIDSEISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFE-RYSPVDGIIREVDFADSLL 1246
             E YMTP+DFV+           LGL +    +    +  + I+  +      ++ LI+F ++    +V+  P   F +AF++FD  G GE+    F+ VK++    +    +H   N          +    +  FG    K+LT  +FT F ++LQ E  +  F  + S   G I  +DF D +L
Sbjct:   33 GEHYMTPEDFVQRY---------LGLHNEHNYNPLTVRTLASIADTT------KDGLISFQEFSAFESVLCAPDALFIVAFQLFDKEGKGEV---TFEGVKAVFSQTTI--HQHIPFN---------WDCDFIRLHFGHTRDKRLTYAEFTQFLQELQLEHARQAFALKDSNKSGTIPALDFNDIML 190          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Sea Lamprey
Match: slc25a12 (solute carrier family 25 member 12 [Source:ZFIN;Acc:ZDB-GENE-031006-11])

HSP 1 Score: 48.9062 bits (115), Expect = 3.174e-6
Identity = 66/286 (23.08%), Postives = 122/286 (42.66%), Query Frame = 2
Query:  602 RIIAYEDRIRSYSTPDK---IFRYFATIQDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRKEKIDSEISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFE-RYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLK 1447
            R++  + +I   + P +   +F  FA+ Q+   E YM+P DFV+           L + +    +    K  + ++  +      ++ LI+F ++V   +V+  P   F +AF++FD +G G++    F+ VK I    +    +H   N               +  FGS  KK +  ++FT F ++LQ E  +  F  + +   G I  +DF D ++     P +        +        +  +SF+ + AF+ LL  +  V     +  LAG+ ID    K
Sbjct:    2 RLLIVQVQITKRADPAELKDVFLKFAS-QNRNGEYYMSPADFVQRF---------LSMSTEATANPSWIKFLAGVADHN------KDGLISFQEFVAFESVLCAPDAMFIVAFQLFDRSGHGQVT---FENVKEIFSQTTI--HQHIPFN---------WECEFIQLHFGSSHKKSMNYDEFTQFLQELQLEHARQAFSVKDTDKSGTIAALDFRDIMVTIR--PHMLTSFVEENLVAAVGGLKAHRVSFAFFNAFNSLLNNMELVQK--IYSTLAGSRIDMEVTK 253          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Nematostella
Match: EDO46619 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPR4])

HSP 1 Score: 367.851 bits (943), Expect = 2.122e-122
Identity = 193/375 (51.47%), Postives = 261/375 (69.60%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATIQ-----DTTNEVYMTPQDFVRSISPGVKQPEGLGLDSFRR------VDLRKEKIDS----EISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTV 1660
            R  FRD RII YE+RIR YSTPDK+FRYFA+++        NEV+MTP+DFVRS++PG KQP+G+  DSF+          +K K       EI ++SVF   G++ LI+FSDY+FLLTV+S P R FEIAF+MFDLNGDGE+D +EF+ V++I+ S +A G RHRD+  TG+ LS  +N+ L  YFFG    KKLT+ +F  FQ++LQKE+M LEF  Y PVDG I EV+FAD LL Y+ F + KK++ L+RV++ +K ENS G++F DYV F   L+ +S+ + AL+F+  A  +ID  T K V+  +  V L DH++ IV+ +FDEN DG LS+KEFI VMK +L+RGL+ P DTGF +L+ A+  CAK  V
Sbjct:   22 RKSFRDRRIIEYENRIRQYSTPDKVFRYFASLKIVHSGAEENEVFMTPEDFVRSLTPGKKQPDGI--DSFQCFVYLCCCSFQKHKYSGYESQEIGENSVFMKMGDHGLISFSDYIFLLTVLSLPPRMFEIAFQMFDLNGDGEVDSKEFEKVQNILFSLTATGSRHRDHTTTGSVLSAHVNTGLKIYFFGESEDKKLTVEEFVDFQKKLQKEVMYLEFVAYDPVDGRISEVEFADMLLTYSSFQEKKKQQILKRVKKAFK-ENSQGVTFQDYVDFFTFLRNLSEAEVALSFHMAANRAIDSETFKRVASTITGVSLQDHVVNIVYKMFDENGDGELSHKEFISVMKNQLVRGLENPKDTGFAKLMAALVHCAKHQV 393          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Nematostella
Match: EDO37981 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE58])

HSP 1 Score: 88.9669 bits (219), Expect = 2.754e-19
Identity = 88/328 (26.83%), Postives = 136/328 (41.46%), Query Frame = 2
Query:  656 FRYFATIQDTTNEVYMTPQDFVRSIS----PGVKQPEGLGLDSFRRV-----DLRKEKIDSEISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVV-------------------------KSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXK-YFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDG 1534
            F  FA+ Q    +  MTP DF+ SI     PG  +   +      R+      +RK         +  F    +  +I + +Y+FL+T+++  +R  EIAFRM D +G+ EL  +EF VV                         KSI  S  A+        +  N   NL+ ++  K +FF   G   LT   F+ F   LQ E+ ++EF  YS     + E  FA  LL        +  K+L R+  +       GI+   YV FS  L  + D   A+  Y ++G  + Q   +   +      +  +++  VF LFD  NDG
Sbjct:   15 FEKFASCQ-AQGQCLMTPADFLESIVHEDLPGWSRKREVNNQDINRMLNGTPGIRK-------GSNKFFRQLQDRGIITYPEYLFLVTILTKSRRGIEIAFRMLDKDGNHELSKDEFLVVRVEDSEPTDIGNRSSKIEDLYGETRKSIANSSQALENAALPGGMDPNQWQNLVGNTTLKTHFFTPRGNGTLTFAQFSKFMADLQVEVSEMEFIEYSRGMPTVPEESFARLLLRNTALEAEEVAKYLDRLNSRLTVRK--GITKQQYVDFSMFLNNLDDFSMAMRIYSISGQPVTQDEFQRAVRISTGHAIDPYVVHTVFQLFD--NDG 330          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Medaka
Match: micu1 (mitochondrial calcium uptake 1 [Source:NCBI gene;Acc:101162864])

HSP 1 Score: 399.053 bits (1024), Expect = 1.395e-132
Identity = 209/369 (56.64%), Postives = 266/369 (72.09%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATI----QDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSF--RRVDLRKEKIDSE--ISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXX-XKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTV 1660
            R GFRD +++ YE+RIR+YSTPDKIFRYFAT+    +    EVYMTPQDF+RSI+P  KQPE LGLD F  +R D +K   + E    +DS+FY  GE  LI+FSDY+FL TV+STPQR FEIAF+MFDLNGDGE+D+EEF+ V+SIIRS ++MG RHRD + TGNTL     SS  + YFFG   K KLTI  F  FQR+LQ +++KLEFER  PVDG I E  F   LL Y+     K K+  + +++ +KD    GI+F +   F   LK ++DVDTAL+FYH+AGASID+AT+K V++ VA VELSDH+  +VF LFD + +G LSNKEFI +MKQ+L+RGL+KP D GF RLV A+ KCA+DT 
Sbjct:  138 RSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVINEHGDAEVYMTPQDFIRSITPNEKQPENLGLDQFIVKRYDGKKIAHERERFADEDSIFYSLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDLEEFEQVQSIIRSQTSMGMRHRDRSTTGNTLKTAGCSSALTTYFFGEDLKGKLTIGSFLEFQRKLQHDVLKLEFERNDPVDGRISERQFGGMLLAYSGVQSRKLKQMQKGLKKMFKDAQ--GITFEEVENFFTFLKNVNDVDTALSFYHMAGASIDKATMKQVARTVAKVELSDHVCNVVFALFDCDGNGELSNKEFIAIMKQRLMRGLEKPKDMGFTRLVRAMWKCAQDTA 504          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Medaka
Match: micu1 (mitochondrial calcium uptake 1 [Source:NCBI gene;Acc:101162864])

HSP 1 Score: 396.741 bits (1018), Expect = 4.157e-132
Identity = 210/373 (56.30%), Postives = 267/373 (71.58%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATI----QDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSF--RRVDLRK--EKIDSE----ISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXX-XKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTV 1660
            R GFRD +++ YE+RIR+YSTPDKIFRYFAT+    +    EVYMTPQDF+RSI+P  KQPE LGLD F  +R D +   +KI  E      +DS+FY  GE  LI+FSDY+FL TV+STPQR FEIAF+MFDLNGDGE+D+EEF+ V+SIIRS ++MG RHRD + TGNTL     SS  + YFFG   K KLTI  F  FQR+LQ +++KLEFER  PVDG I E  F   LL Y+     K K+  + +++ +KD    GI+F +   F   LK ++DVDTAL+FYH+AGASID+AT+K V++ VA VELSDH+  +VF LFD + +G LSNKEFI +MKQ+L+RGL+KP D GF RLV A+ KCA+DT 
Sbjct:  109 RSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVINEHGDAEVYMTPQDFIRSITPNEKQPENLGLDQFIVKRYDGKDFWQKIAHERERFADEDSIFYSLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDLEEFEQVQSIIRSQTSMGMRHRDRSTTGNTLKTAGCSSALTTYFFGEDLKGKLTIGSFLEFQRKLQHDVLKLEFERNDPVDGRISERQFGGMLLAYSGVQSRKLKQMQKGLKKMFKDAQ--GITFEEVENFFTFLKNVNDVDTALSFYHMAGASIDKATMKQVARTVAKVELSDHVCNVVFALFDCDGNGELSNKEFIAIMKQRLMRGLEKPKDMGFTRLVRAMWKCAQDTA 479          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Medaka
Match: micu1 (mitochondrial calcium uptake 1 [Source:NCBI gene;Acc:101162864])

HSP 1 Score: 384.415 bits (986), Expect = 8.036e-127
Identity = 209/407 (51.35%), Postives = 270/407 (66.34%), Query Frame = 2
Query:  581 RVGFRDSRIIAYEDRIRSYSTPDKIFRYFATI----QDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSF--RRVDLR--------------------------------KEKIDSEIS--------QDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXX-XKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTV 1660
            R GFRD +++ YE+RIR+YSTPDKIFRYFAT+    +    EVYMTPQDF+RSI+P  KQPE LGLD F  +R D +                                ++ + S+I+        +DS+FY  GE  LI+FSDY+FL TV+STPQR FEIAF+MFDLNGDGE+D+EEF+ V+SIIRS ++MG RHRD + TGNTL     SS  + YFFG   K KLTI  F  FQR+LQ +++KLEFER  PVDG I E  F   LL Y+     K K+  + +++ +KD    GI+F +   F   LK ++DVDTAL+FYH+AGASID+AT+K V++ VA VELSDH+  +VF LFD + +G LSNKEFI +MKQ+L+RGL+KP D GF RLV A+ KCA+DT 
Sbjct:  109 RSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVINEHGDAEVYMTPQDFIRSITPNEKQPENLGLDQFIVKRYDGKDFWQTEVTLTRLRPPFHLWACSVHLFGGASSQRDAVFSKIAHERERFADEDSIFYSLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDLEEFEQVQSIIRSQTSMGMRHRDRSTTGNTLKTAGCSSALTTYFFGEDLKGKLTIGSFLEFQRKLQHDVLKLEFERNDPVDGRISERQFGGMLLAYSGVQSRKLKQMQKGLKKMFKDAQ--GITFEEVENFFTFLKNVNDVDTALSFYHMAGASIDKATMKQVARTVAKVELSDHVCNVVFALFDCDGNGELSNKEFIAIMKQRLMRGLEKPKDMGFTRLVRAMWKCAQDTA 513          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Medaka
Match: micu3a (mitochondrial calcium uptake family member 3 [Source:NCBI gene;Acc:101166695])

HSP 1 Score: 142.124 bits (357), Expect = 1.006e-35
Identity = 102/345 (29.57%), Postives = 167/345 (48.41%), Query Frame = 2
Query:  638 STPDKIFRYFATIQDTTNEVYMTPQDFVRSIS---PGVKQPEGLGLDSFRRVDLRKEKIDSEI---SQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXK----------------------YFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRG 1588
            S+ ++ FR F++++    ++YMTPQ+F+ S++   P  ++P      S  + +L K   D+         +F    E  +I++++Y+FLL +++ P   F+IAF MFD +G+  +D  EF V++ I R  +    R  D   +      L    ++                       +FFG  GK +LT  DF  F   LQ E++++EF  YS     I E DFA  LL +    +I    +L  V+Q   DE   GI+F ++ +F   L  + D   A+  Y+ A  SI Q            ++L+ HL+  +F +FD ++D  LS KEFI +MK +L RG
Sbjct:  163 SSHEQRFRMFSSVE-YEGQLYMTPQNFIESVTMSEPRNRRP----WRSLTKQELEKILADTPPVWRGSSKLFRNLRERGIISYTEYLFLLCILTKPHAGFKIAFNMFDADGNQMVDKREFLVLQEIFRKKNEKRGRRGDAEKSAQLSMQLYGYQVAPMNSDFTLERSDDSITIDTTLLVHFFGKKGKAELTFEDFYRFMDNLQTEVLEIEFLTYSKGMTTISEEDFAKILLRFTNVENISS--YLENVRQCIPDEK--GITFDEFRSFFQFLNNLEDFAIAMQMYNFASRSIGQDEFGRAVYVATGLKLTRHLVNTIFKIFDVDHDDQLSYKEFIGIMKDRLHRG 498          
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Medaka
Match: micu2 (mitochondrial calcium uptake 2 [Source:NCBI gene;Acc:101156187])

HSP 1 Score: 135.961 bits (341), Expect = 2.398e-34
Identity = 102/328 (31.10%), Postives = 169/328 (51.52%), Query Frame = 2
Query:  689 NEVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRKEKIDSEISQDS-------VFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAK 1651
             E YMTP+DF+ S+       E +     +RV L  ++++S +   S       +F  +G+N LI++++Y+FLLT+++ P+  F IAF+M D++G+ ++D +EF  +K+II S  A     +    T    S  +++SL  YFFG  G+ KL   +F  F   LQ E+ ++EF ++S     +R  DFA+ LL Y    D   + +   ++++     S  I+F ++ AF      + D   ++     A   +  A  +   K     ELSD ++  VF LFD + D  LS+KEF+ VM  ++LRGL     +G    V+   KC K
Sbjct:   88 QEPYMTPRDFLFSV-----MLEKVDRKLQKRV-LTAQEVNSMLRTASAAGAGTDLFRTWGDNGLISYTEYLFLLTILTKPRTGFRIAFQMLDVDGNEQVDKKEFLKLKTIIGSSKARVATAK----TAAENSEAVSTSLQAYFFGKRGENKLKYQEFLRFMEDLQAEVQEMEFLQFSKGMDTMRREDFAEWLLHYTNEED--NEIYWENMRKRIPAGQS--ITFDEFKAFCLFSNNLEDFVFSMKMVTGANRPVGMAQFRRAVKIATGHELSDSVLDTVFKLFDMDGDDCLSHKEFMAVMTDRVLRGLKVQPQSG----VSGYWKCVK 397          
BLAST of Calcium uptake protein 1, mitochondrial vs. Planmine SMEST
Match: SMESG000065412.1 (SMESG000065412.1)

HSP 1 Score: 1015.76 bits (2625), Expect = 0.000e+0
Identity = 526/527 (99.81%), Postives = 527/527 (100.00%), Query Frame = 2
Query:   89 MNILKLKKINLRSFISVTQYAISKYSIHQPVLPIIRNASNWKFRSEYEDKPVVNPEKLRNRYTNFYSHRLFLLKFHKNYYYVFFLISILFMSEIPLRVLNRIEGFFGSKDYKEEYENLEKNLSDEPQRMKQRFFKADASTEMLMISEEMXXXXXXXXXXXXXXXRVGFRDSRIIAYEDRIRSYSTPDKIFRYFATIQDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRKEKIDSEISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTVIQE 1669
            MNILKLKKINLRSFISVTQYAISKYSIHQPVLPIIRNASNWKFRSEYEDKPVVNPEKLRNRYTNFYSHRLFLLKFHKNYYYVFFLISILFMSEIPLRVLNRIEGFFGSKDYKEEYENLEKNLSDEPQRMKQRFFKADASTEM+MISEEMSDDKSTSGKSKPKKSRVGFRDSRIIAYEDRIRSYSTPDKIFRYFATIQDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRKEKIDSEISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGNTLSNLINSSLSKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTVIQE
Sbjct:    1 MNILKLKKINLRSFISVTQYAISKYSIHQPVLPIIRNASNWKFRSEYEDKPVVNPEKLRNRYTNFYSHRLFLLKFHKNYYYVFFLISILFMSEIPLRVLNRIEGFFGSKDYKEEYENLEKNLSDEPQRMKQRFFKADASTEMVMISEEMSDDKSTSGKSKPKKSRVGFRDSRIIAYEDRIRSYSTPDKIFRYFATIQDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRKEKIDSEISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGNTLSNLINSSLSKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTVIQE 527          
BLAST of Calcium uptake protein 1, mitochondrial vs. Planmine SMEST
Match: SMESG000065412.1 (SMESG000065412.1)

HSP 1 Score: 830.091 bits (2143), Expect = 0.000e+0
Identity = 436/437 (99.77%), Postives = 437/437 (100.00%), Query Frame = 2
Query:  359 MSEIPLRVLNRIEGFFGSKDYKEEYENLEKNLSDEPQRMKQRFFKADASTEMLMISEEMXXXXXXXXXXXXXXXRVGFRDSRIIAYEDRIRSYSTPDKIFRYFATIQDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRKEKIDSEISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTVIQE 1669
            MSEIPLRVLNRIEGFFGSKDYKEEYENLEKNLSDEPQRMKQRFFKADASTEM+MISEEMSDDKSTSGKSKPKKSRVGFRDSRIIAYEDRIRSYSTPDKIFRYFATIQDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRKEKIDSEISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGNTLSNLINSSLSKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTVIQE
Sbjct:    1 MSEIPLRVLNRIEGFFGSKDYKEEYENLEKNLSDEPQRMKQRFFKADASTEMVMISEEMSDDKSTSGKSKPKKSRVGFRDSRIIAYEDRIRSYSTPDKIFRYFATIQDTTNEVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRKEKIDSEISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVVKSIIRSGSAMGKRHRDNNVTGNTLSNLINSSLSKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGLDKPMDTGFIRLVTAVTKCAKDTVIQE 437          
BLAST of Calcium uptake protein 1, mitochondrial vs. Planmine SMEST
Match: SMESG000011239.1 (SMESG000011239.1)

HSP 1 Score: 147.132 bits (370), Expect = 1.028e-38
Identity = 108/332 (32.53%), Postives = 166/332 (50.00%), Query Frame = 2
Query:  665 FATIQDTTNEVYMTPQDFVRSIS---PGVKQPEG-LGLDSFRRVDLRKEKIDSEISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEF------------------DVVKSIIRSGSAMGKRHRDN-NVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGL 1591
            FA+ +    EVYMTP DF+ S++   P  +     L +   +R+ +R        S+D +F    +  LI++++Y+FLL V++ P+  F+IAF MFD + + E+D  EF                  ++V+ +I +GS    +  +N N   +      ++++  +FFG  GK KL   DF+ F   LQ E++++EF  +S     I E +FA  LL Y    D K   +  RV +K  +E   GI+F D+ AF   L  + D   A+  Y L    I Q       KA  N+ LS  L+  +F LFDE+NDG LS  EFI  MK ++ RG 
Sbjct:   32 FASFE-CNGEVYMTPADFLESVTQNNPRYRTTRHVLTVKEAKRM-VRNTPARRSGSKD-LFRSLDKEGLISYTEYLFLLGVLTKPRSGFKIAFNMFDTDMNEEVDKTEFLVLHKAIVGVSTAFETNENLVEEVIEAGSNDVSQENENINKFTSIPELEFDTTMLVHFFGKSGKDKLRFTDFSRFMENLQTEVLEIEFLEFSKGLKTISESEFAKILLRYTTVDDDKHDIYCDRVLKKMSNEK--GITFDDFKAFFQFLNNLEDFILAMKMYTLVDRPISQQEFHQAVKACTNMTLSSQLVQTIFFLFDEDNDGFLSYNEFIKSMKNRMNRGF 358          
BLAST of Calcium uptake protein 1, mitochondrial vs. Planmine SMEST
Match: SMESG000011239.1 (SMESG000011239.1)

HSP 1 Score: 147.132 bits (370), Expect = 1.147e-38
Identity = 108/332 (32.53%), Postives = 166/332 (50.00%), Query Frame = 2
Query:  665 FATIQDTTNEVYMTPQDFVRSIS---PGVKQPEG-LGLDSFRRVDLRKEKIDSEISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEF------------------DVVKSIIRSGSAMGKRHRDN-NVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGL 1591
            FA+ +    EVYMTP DF+ S++   P  +     L +   +R+ +R        S+D +F    +  LI++++Y+FLL V++ P+  F+IAF MFD + + E+D  EF                  ++V+ +I +GS    +  +N N   +      ++++  +FFG  GK KL   DF+ F   LQ E++++EF  +S     I E +FA  LL Y    D K   +  RV +K  +E   GI+F D+ AF   L  + D   A+  Y L    I Q       KA  N+ LS  L+  +F LFDE+NDG LS  EFI  MK ++ RG 
Sbjct:   34 FASFE-CNGEVYMTPADFLESVTQNNPRYRTTRHVLTVKEAKRM-VRNTPARRSGSKD-LFRSLDKEGLISYTEYLFLLGVLTKPRSGFKIAFNMFDTDMNEEVDKTEFLVLHKAIVGVSTAFETNENLVEEVIEAGSNDVSQENENINKFTSIPELEFDTTMLVHFFGKSGKDKLRFTDFSRFMENLQTEVLEIEFLEFSKGLKTISESEFAKILLRYTTVDDDKHDIYCDRVLKKMSNEK--GITFDDFKAFFQFLNNLEDFILAMKMYTLVDRPISQQEFHQAVKACTNMTLSSQLVQTIFFLFDEDNDGFLSYNEFIKSMKNRMNRGF 360          
BLAST of Calcium uptake protein 1, mitochondrial vs. Planmine SMEST
Match: SMESG000011239.1 (SMESG000011239.1)

HSP 1 Score: 147.132 bits (370), Expect = 2.435e-38
Identity = 106/327 (32.42%), Postives = 163/327 (49.85%), Query Frame = 2
Query:  680 DTTNEVYMTPQDFVRSIS---PGVKQPEG-LGLDSFRRVDLRKEKIDSEISQDSVFYLFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEF------------------DVVKSIIRSGSAMGKRHRDN-NVTGXXXXXXXXXXXXKYFFGSHGKKKLTINDFTAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFLRRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQATLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRGL 1591
            +   EVYMTP DF+ S++   P  +     L +   +R+ +R        S+D +F    +  LI++++Y+FLL V++ P+  F+IAF MFD + + E+D  EF                  ++V+ +I +GS    +  +N N   +      ++++  +FFG  GK KL   DF+ F   LQ E++++EF  +S     I E +FA  LL Y    D K   +  RV +K  +E   GI+F D+ AF   L  + D   A+  Y L    I Q       KA  N+ LS  L+  +F LFDE+NDG LS  EFI  MK ++ RG 
Sbjct:   79 ECNGEVYMTPADFLESVTQNNPRYRTTRHVLTVKEAKRM-VRNTPARRSGSKD-LFRSLDKEGLISYTEYLFLLGVLTKPRSGFKIAFNMFDTDMNEEVDKTEFLVLHKAIVGVSTAFETNENLVEEVIEAGSNDVSQENENINKFTSIPELEFDTTMLVHFFGKSGKDKLRFTDFSRFMENLQTEVLEIEFLEFSKGLKTISESEFAKILLRYTTVDDDKHDIYCDRVLKKMSNEK--GITFDDFKAFFQFLNNLEDFILAMKMYTLVDRPISQQEFHQAVKACTNMTLSSQLVQTIFFLFDEDNDGFLSYNEFIKSMKNRMNRGF 401          
The following BLAST results are available for this feature:
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MICU11.217e-12954.05mitochondrial calcium uptake 1 [Source:HGNC Symbol... [more]
MICU11.075e-12853.74mitochondrial calcium uptake 1 [Source:HGNC Symbol... [more]
MICU11.113e-12854.08mitochondrial calcium uptake 1 [Source:HGNC Symbol... [more]
MICU15.087e-12853.76mitochondrial calcium uptake 1 [Source:HGNC Symbol... [more]
MICU12.090e-8453.36mitochondrial calcium uptake 1 [Source:HGNC Symbol... [more]
back to top
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
micu-12.112e-10347.81Calcium uptake protein 1 homolog, mitochondrial [... [more]
C56A3.64.270e-3329.18pep chromosome:WBcel235:V:13553374:13556408:-1 gen... [more]
C56A3.65.730e-3229.19pep chromosome:WBcel235:V:13553374:13556408:-1 gen... [more]
C56A3.68.383e-3027.07pep chromosome:WBcel235:V:13553374:13556408:-1 gen... [more]
C56A3.68.383e-3027.07pep chromosome:WBcel235:V:13553374:13556391:-1 gen... [more]
back to top
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MICU19.840e-13156.83gene:FBgn0031893 transcript:FBtr0113028[more]
MICU17.558e-13057.26gene:FBgn0031893 transcript:FBtr0079405[more]
CG47049.507e-6134.46gene:FBgn0039029 transcript:FBtr0084314[more]
CG47049.507e-6134.46gene:FBgn0039029 transcript:FBtr0339138[more]
CG46626.780e-3929.18gene:FBgn0038735 transcript:FBtr0083814[more]
back to top
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
micu17.176e-13657.18mitochondrial calcium uptake 1 [Source:NCBI gene;A... [more]
micu16.211e-13456.30mitochondrial calcium uptake 1 [Source:NCBI gene;A... [more]
micu16.852e-13456.30mitochondrial calcium uptake 1 [Source:NCBI gene;A... [more]
micu13.098e-6860.10mitochondrial calcium uptake 1 [Source:NCBI gene;A... [more]
micu3a2.818e-4132.21mitochondrial calcium uptake family, member 3a [So... [more]
back to top
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
micu16.081e-13755.95mitochondrial calcium uptake 1 [Source:NCBI gene;A... [more]
micu15.458e-13555.71mitochondrial calcium uptake 1 [Source:NCBI gene;A... [more]
tmem170a8.949e-3731.60transmembrane protein 170A [Source:Xenbase;Acc:XB-... [more]
MICU26.055e-3127.41mitochondrial calcium uptake 2 [Source:NCBI gene;A... [more]
MICU21.807e-3028.98mitochondrial calcium uptake 2 [Source:NCBI gene;A... [more]
back to top
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Micu11.823e-13054.62mitochondrial calcium uptake 1 [Source:MGI Symbol;... [more]
Micu11.823e-13054.62mitochondrial calcium uptake 1 [Source:MGI Symbol;... [more]
Micu13.917e-13054.28mitochondrial calcium uptake 1 [Source:MGI Symbol;... [more]
Micu17.491e-13054.30mitochondrial calcium uptake 1 [Source:MGI Symbol;... [more]
Micu19.620e-5961.25mitochondrial calcium uptake 1 [Source:MGI Symbol;... [more]
back to top
BLAST of Calcium uptake protein 1, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B1H2N3|MICU1_XENTR2.891e-13455.71Calcium uptake protein 1, mitochondrial OS=Xenopus... [more]
sp|A4IG32|MICU1_DANRE5.172e-13356.30Calcium uptake protein 1, mitochondrial OS=Danio r... [more]
sp|Q6P6Q9|MICU1_RAT6.322e-13054.62Calcium uptake protein 1, mitochondrial OS=Rattus ... [more]
sp|A2VEI2|MICU1_DROME9.864e-13056.83Calcium uptake protein 1 homolog, mitochondrial OS... [more]
sp|Q8VCX5|MICU1_MOUSE1.275e-12954.62Calcium uptake protein 1, mitochondrial OS=Mus mus... [more]
back to top
BLAST of Calcium uptake protein 1, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JJ265.281e-15260.50calcium uptake protein 1, mitochondrial isoform X2... [more]
A0A1S3JKI13.688e-14959.34calcium uptake protein 1, mitochondrial isoform X1... [more]
A0A158R8029.506e-14958.86Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A0R3X5K52.086e-14860.61Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A2C9JTJ91.339e-14759.78Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
micu18.587e-13556.91mitochondrial calcium uptake 1 [Source:NCBI gene;A... [more]
micu13.277e-13456.57mitochondrial calcium uptake 1 [Source:NCBI gene;A... [more]
micu3b1.807e-3730.70calcium uptake protein 3, mitochondrial [Source:NC... [more]
micu23.195e-3329.14mitochondrial calcium uptake 2 [Source:ZFIN;Acc:ZD... [more]
micu3b2.475e-2426.55calcium uptake protein 3, mitochondrial [Source:NC... [more]
back to top
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
micu11.142e-13456.10mitochondrial calcium uptake 1 [Source:NCBI gene;A... [more]
ENSPMAT00000004434.13.824e-2033.93pep scaffold:Pmarinus_7.0:GL476717:249768:260461:-... [more]
ENSPMAT00000005927.11.911e-626.20pep scaffold:Pmarinus_7.0:GL478382:39338:47730:1 g... [more]
ENSPMAT00000005924.11.981e-626.20pep scaffold:Pmarinus_7.0:GL478382:39024:47730:1 g... [more]
slc25a123.174e-623.08solute carrier family 25 member 12 [Source:ZFIN;Ac... [more]
back to top
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO466192.122e-12251.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379812.754e-1926.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcium uptake protein 1, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
micu11.395e-13256.64mitochondrial calcium uptake 1 [Source:NCBI gene;A... [more]
micu14.157e-13256.30mitochondrial calcium uptake 1 [Source:NCBI gene;A... [more]
micu18.036e-12751.35mitochondrial calcium uptake 1 [Source:NCBI gene;A... [more]
micu3a1.006e-3529.57mitochondrial calcium uptake family member 3 [Sour... [more]
micu22.398e-3431.10mitochondrial calcium uptake 2 [Source:NCBI gene;A... [more]
back to top
BLAST of Calcium uptake protein 1, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065412.10.000e+099.81SMESG000065412.1[more]
SMESG000065412.10.000e+099.77SMESG000065412.1[more]
SMESG000011239.11.028e-3832.53SMESG000011239.1[more]
SMESG000011239.11.147e-3832.53SMESG000011239.1[more]
SMESG000011239.12.435e-3832.42SMESG000011239.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008431 ID=SMED30008431|Name=Calcium uptake protein 1, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=1862bp
TTTCATCTTAGATATTTGTAAAATAAATAAATAATACCTTTTATCTAATA
GAAAGATAATTAAAATTCAATTTTGTAGTGAATGTATTATGAATATTCTA
AAATTAAAGAAAATTAATTTACGGTCGTTCATTTCTGTAACACAGTACGC
AATTAGTAAATATTCGATTCATCAGCCGGTTTTACCGATCATCCGAAATG
CTTCAAATTGGAAATTTAGGAGTGAATATGAAGACAAACCGGTTGTAAAT
CCAGAGAAGCTAAGGAATCGTTATACAAACTTTTATTCACATAGATTATT
TTTATTAAAATTTCATAAAAACTACTATTATGTATTTTTTTTGATTTCGA
TACTCTTTATGTCGGAGATACCTTTACGAGTTTTGAATAGAATTGAAGGT
TTCTTTGGATCTAAAGATTACAAAGAAGAATATGAAAATTTGGAGAAAAA
TCTAAGTGATGAACCACAACGAATGAAGCAACGTTTCTTTAAAGCAGACG
CCAGTACTGAAATGTTAATGATTTCTGAAGAAATGAGCGATGACAAAAGC
ACTAGCGGTAAATCCAAACCGAAAAAATCCCGCGTTGGTTTTCGAGATTC
TCGGATTATTGCTTACGAAGATCGGATTCGATCCTATTCCACACCTGATA
AAATATTCCGCTATTTTGCCACCATACAGGACACGACTAATGAGGTGTAC
ATGACTCCTCAGGATTTTGTAAGATCGATTTCTCCCGGAGTGAAACAGCC
AGAAGGGCTTGGATTGGACAGTTTTCGCCGAGTTGATCTACGGAAAGAAA
AAATCGACTCTGAAATTTCTCAAGATTCTGTTTTCTATCTATTTGGGGAA
AACGCTTTGATCAATTTTTCAGATTATGTGTTCCTATTGACTGTGATAAG
CACTCCTCAGAGACAATTTGAAATTGCATTTCGCATGTTTGACCTGAACG
GCGATGGAGAGTTAGATGTTGAAGAGTTCGATGTGGTCAAATCAATTATC
CGCTCCGGCTCAGCGATGGGGAAGCGTCACAGAGACAATAATGTGACAGG
GAATACTTTGAGTAATCTCATCAACTCATCGCTTAGTAAATATTTCTTCG
GGTCGCATGGGAAAAAGAAGCTAACGATCAATGATTTCACTGCATTCCAG
CGTCAGTTACAGAAGGAAATCATGAAGTTGGAGTTCGAGCGCTACTCCCC
GGTTGATGGCATAATTAGGGAGGTGGACTTTGCCGATTCACTGCTGATTT
ACGCTGAATTTCCTGACATAAAAAAGAAAAAATTCCTTCGTCGAGTTCAA
CAGAAATATAAAGATGAAAATTCAATTGGTATCAGTTTTAGTGATTATGT
CGCCTTTTCCCATCTGTTGAAATGCATTAGCGATGTCGACACTGCCTTGA
CTTTTTACCATTTAGCGGGGGCCTCTATCGATCAGGCGACACTGAAACAT
GTGTCCAAGGCGGTTGCCAACGTAGAATTAAGCGACCACCTAATTGGTAT
TGTTTTCACGCTTTTCGACGAGAATAACGATGGCCATCTAAGCAACAAGG
AGTTTATTATGGTTATGAAACAGAAATTGTTGCGAGGATTAGACAAACCG
ATGGATACTGGATTCATCCGACTTGTAACTGCCGTCACAAAATGTGCAAA
GGATACAGTAATCCAGGAAATCCTTTAATTTCTTCAAATTTTACTTTTCA
TCCAATTGAGTTATCTGTTGCTGCTATGTTGTCATATCCTGATCACTCGC
GTTCTTGTTGATCGTATTTAATGCCCTATTATCATTGCTATGATCTGCCA
TTTATAATCTTTATCAAATGTATTTGTTTCTCTTCAATATATTCCCTTAA
TTTATGGAAAAA
back to top

protein sequence of SMED30008431-orf-1

>SMED30008431-orf-1 ID=SMED30008431-orf-1|Name=SMED30008431-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=530bp
MNILKLKKINLRSFISVTQYAISKYSIHQPVLPIIRNASNWKFRSEYEDK
PVVNPEKLRNRYTNFYSHRLFLLKFHKNYYYVFFLISILFMSEIPLRVLN
RIEGFFGSKDYKEEYENLEKNLSDEPQRMKQRFFKADASTEMLMISEEMS
DDKSTSGKSKPKKSRVGFRDSRIIAYEDRIRSYSTPDKIFRYFATIQDTT
NEVYMTPQDFVRSISPGVKQPEGLGLDSFRRVDLRKEKIDSEISQDSVFY
LFGENALINFSDYVFLLTVISTPQRQFEIAFRMFDLNGDGELDVEEFDVV
KSIIRSGSAMGKRHRDNNVTGNTLSNLINSSLSKYFFGSHGKKKLTINDF
TAFQRQLQKEIMKLEFERYSPVDGIIREVDFADSLLIYAEFPDIKKKKFL
RRVQQKYKDENSIGISFSDYVAFSHLLKCISDVDTALTFYHLAGASIDQA
TLKHVSKAVANVELSDHLIGIVFTLFDENNDGHLSNKEFIMVMKQKLLRG
LDKPMDTGFIRLVTAVTKCAKDTVIQEIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006851mitochondrial calcium ion transmembrane transport
GO:0006810transport
GO:0006811ion transport
GO:0006816calcium ion transport
GO:0007615anesthesia-resistant memory
GO:0036444mitochondrial calcium uptake
GO:0051561positive regulation of mitochondrial calcium ion concentration
GO:0072375medium-term memory
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR039800MICU1/2/3
IPR002048EF_hand_dom
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0005758mitochondrial intermembrane space
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 108..128
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 112..362
e-value: 5.4E-10
score: 41.3
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 363..507
e-value: 1.2E-6
score: 30.0
NoneNo IPR availablePFAMPF13833EF-hand_8coord: 444..494
e-value: 1.0E-5
score: 25.3
NoneNo IPR availablePANTHERPTHR12294:SF1CALCIUM UPTAKE PROTEIN 1, MITOCHONDRIALcoord: 121..521
NoneNo IPR availableCDDcd15900EFh_MICUcoord: 276..497
e-value: 2.18559E-59
score: 191.673
NoneNo IPR availableTMHMMTMhelixcoord: 79..96
IPR002048EF-hand domainSMARTSM00054efh_1coord: 468..496
e-value: 0.49
score: 19.4
coord: 276..304
e-value: 0.12
score: 21.5
IPR002048EF-hand domainPFAMPF13202EF-hand_5coord: 280..298
e-value: 1.6E-5
score: 24.2
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 272..307
score: 10.831
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 464..499
score: 10.831
IPR039800Calcium uptake protein 1/2/3PANTHERPTHR12294EF HAND DOMAIN FAMILY A1,A2-RELATEDcoord: 121..521
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 285..297
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 477..489
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 357..494
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 246..494