PI-PLC X domain-containing protein 3

Overview
NamePI-PLC X domain-containing protein 3
Smed IDSMED30008425
Length (bp)1424
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PI-PLC X domain-containing protein 3 (SMED30008425) t-SNE clustered cells

Violin plots show distribution of expression levels for PI-PLC X domain-containing protein 3 (SMED30008425) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PI-PLC X domain-containing protein 3 (SMED30008425) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PI-PLC X domain-containing protein 3 (SMED30008425) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008425

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30008425SMESG000075551.1 PL04005A1B03ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008425SMESG000075551.1 Contig2968GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30008425SMESG000075551.1 dd_Smed_v4_5433_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008425SMESG000075551.1 dd_Smed_v4_5433_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008425SMESG000075551.1 dd_Smed_v4_5433_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30008425SMESG000075551.1 dd_Smed_v4_5433_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008425SMESG000075551.1 dd_Smed_v4_5433_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Human
Match: PLCXD3 (phosphatidylinositol specific phospholipase C X domain containing 3 [Source:HGNC Symbol;Acc:HGNC:31822])

HSP 1 Score: 236.113 bits (601), Expect = 1.435e-73
Identity = 112/302 (37.09%), Postives = 187/302 (61.92%), Query Frame = 1
Query:  289 LNAWMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFD-NNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAP--YSEIIPSLKDMWKSNHQVIVFYHCD-NIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLNF 1182
            L  WM+ LP+S+ ++P+  +AIPGSHDSF++ I   S V P+  + ++NF  +FG +AK+++ +W  TQ ++  GQL AGIRYFD+R +    D +NE+Y  H LF+ ++ + L  I  FL  + +EVV LD  +FY   K+ H KL  +L+ I+  K+ P  +++ + SLK +W+ ++QV+VFYH    +  PFLWPG M+P+PW  T +  K++ FL  +  E   +  F+I+Q VLTP  +  +  +   L+  + ++A PA  +W+  ++ G+  IN    DF +  D++ +V++LN+
Sbjct:   12 LADWMATLPESMHSIPLTNLAIPGSHDSFSFYIDEASPVGPEQPETVQNFVSVFGTVAKKLMRKWLATQTMNFTGQLGAGIRYFDLRISTKPRDPDNELYFAHGLFSAKVNEGLEEINAFLTDHHKEVVFLDFNHFYGMQKYHHEKLVQMLKDIYGNKMCPAIFAQEV-SLKYLWEKDYQVLVFYHSPVALEVPFLWPGQMMPAPWANTTDPEKLIQFLQASITERRKKGSFFISQVVLTPKASTVVKGVASGLRETITERALPAMMQWVRTQKPGESGINIVTADFVELGDFISTVIKLNY 312          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Human
Match: PLCXD3 (phosphatidylinositol specific phospholipase C X domain containing 3 [Source:HGNC Symbol;Acc:HGNC:31822])

HSP 1 Score: 236.113 bits (601), Expect = 1.435e-73
Identity = 112/302 (37.09%), Postives = 187/302 (61.92%), Query Frame = 1
Query:  289 LNAWMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFD-NNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAP--YSEIIPSLKDMWKSNHQVIVFYHCD-NIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLNF 1182
            L  WM+ LP+S+ ++P+  +AIPGSHDSF++ I   S V P+  + ++NF  +FG +AK+++ +W  TQ ++  GQL AGIRYFD+R +    D +NE+Y  H LF+ ++ + L  I  FL  + +EVV LD  +FY   K+ H KL  +L+ I+  K+ P  +++ + SLK +W+ ++QV+VFYH    +  PFLWPG M+P+PW  T +  K++ FL  +  E   +  F+I+Q VLTP  +  +  +   L+  + ++A PA  +W+  ++ G+  IN    DF +  D++ +V++LN+
Sbjct:   12 LADWMATLPESMHSIPLTNLAIPGSHDSFSFYIDEASPVGPEQPETVQNFVSVFGTVAKKLMRKWLATQTMNFTGQLGAGIRYFDLRISTKPRDPDNELYFAHGLFSAKVNEGLEEINAFLTDHHKEVVFLDFNHFYGMQKYHHEKLVQMLKDIYGNKMCPAIFAQEV-SLKYLWEKDYQVLVFYHSPVALEVPFLWPGQMMPAPWANTTDPEKLIQFLQASITERRKKGSFFISQVVLTPKASTVVKGVASGLRETITERALPAMMQWVRTQKPGESGINIVTADFVELGDFISTVIKLNY 312          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Human
Match: PLCXD2 (phosphatidylinositol specific phospholipase C X domain containing 2 [Source:HGNC Symbol;Acc:HGNC:26462])

HSP 1 Score: 202.601 bits (514), Expect = 2.489e-60
Identity = 114/336 (33.93%), Postives = 181/336 (53.87%), Query Frame = 1
Query:  187 IRLRMFKKILKFGNSLDRN-SWIKSQIKCCFHYYPLNA-WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFD-NNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIP-SLKDMWKSNHQVIVFYHCDNIHK-PFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLN 1179
            + +R  ++ L+ G     N S  K+  + C      NA WM++LP  L  LP++ +AIPGSHDSF+Y +   S V PD    IK   R+   L K+++ +W+ TQ+L    QL AGIRYFD+R +    D + EIY  H LF  ++   L+ I  FL  + +E++ LD  +FY   +  H  L   ++  F  KL P   +   +L+ +W+ N QV++FYHC    + PFLWPG  IP+PW  T ++ K++ FL     E   +  F+++Q +LTP        ++  LK+ +  +  PA   W++ ++ G   +N    DF D  D+  +V++LN
Sbjct:    2 LAVRKARRKLRMGTICSPNPSGTKTSSEVC------NADWMASLPPHLHNLPLSNLAIPGSHDSFSYWVDEKSPVGPDQTQAIKRLARI--SLVKKLMKKWSVTQNLTFREQLEAGIRYFDLRVSSKPGDADQEIYFIHGLFGIKVWDGLMEIDSFLTQHPQEIIFLDFNHFYAMDETHHKCLVLRIQEAFGNKLCPACSVESLTLRTLWEKNCQVLIFYHCPFYKQYPFLWPGKKIPAPWANTTSVRKLILFLETTLSERASRGSFHVSQAILTPRVKTIARGLVGGLKNTLVHRNLPAILDWVKTQKPGAMGVNIITSDFVDLVDFAATVIKLN 329          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Human
Match: PLCXD2 (phosphatidylinositol specific phospholipase C X domain containing 2 [Source:HGNC Symbol;Acc:HGNC:26462])

HSP 1 Score: 178.333 bits (451), Expect = 1.238e-51
Identity = 102/296 (34.46%), Postives = 160/296 (54.05%), Query Frame = 1
Query:  187 IRLRMFKKILKFGNSLDRN-SWIKSQIKCCFHYYPLNA-WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFD-NNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIP-SLKDMWKSNHQVIVFYHCDNIHK-PFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKK 1059
            + +R  ++ L+ G     N S  K+  + C      NA WM++LP  L  LP++ +AIPGSHDSF+Y +   S V PD    IK   R+   L K+++ +W+ TQ+L    QL AGIRYFD+R +    D + EIY  H LF  ++   L+ I  FL  + +E++ LD  +FY   +  H  L   ++  F  KL P   +   +L+ +W+ N QV++FYHC    + PFLWPG  IP+PW  T ++ K++ FL     E   +  F+++Q +LTP        ++  LK+ +  +
Sbjct:    2 LAVRKARRKLRMGTICSPNPSGTKTSSEVC------NADWMASLPPHLHNLPLSNLAIPGSHDSFSYWVDEKSPVGPDQTQAIKRLARI--SLVKKLMKKWSVTQNLTFREQLEAGIRYFDLRVSSKPGDADQEIYFIHGLFGIKVWDGLMEIDSFLTQHPQEIIFLDFNHFYAMDETHHKCLVLRIQEAFGNKLCPACSVESLTLRTLWEKNCQVLIFYHCPFYKQYPFLWPGKKIPAPWANTTSVRKLILFLETTLSERASRGSFHVSQAILTPRVKTIARGLVGGLKNTLVHR 289          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Human
Match: PLCXD2 (phosphatidylinositol specific phospholipase C X domain containing 2 [Source:HGNC Symbol;Acc:HGNC:26462])

HSP 1 Score: 177.563 bits (449), Expect = 2.442e-51
Identity = 102/294 (34.69%), Postives = 159/294 (54.08%), Query Frame = 1
Query:  187 IRLRMFKKILKFGNSLDRN-SWIKSQIKCCFHYYPLNA-WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFD-NNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIP-SLKDMWKSNHQVIVFYHCDNIHK-PFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMA 1053
            + +R  ++ L+ G     N S  K+  + C      NA WM++LP  L  LP++ +AIPGSHDSF+Y +   S V PD    IK   R+   L K+++ +W+ TQ+L    QL AGIRYFD+R +    D + EIY  H LF  ++   L+ I  FL  + +E++ LD  +FY   +  H  L   ++  F  KL P   +   +L+ +W+ N QV++FYHC    + PFLWPG  IP+PW  T ++ K++ FL     E   +  F+++Q +LTP        ++  LK+ + 
Sbjct:    2 LAVRKARRKLRMGTICSPNPSGTKTSSEVC------NADWMASLPPHLHNLPLSNLAIPGSHDSFSYWVDEKSPVGPDQTQAIKRLARI--SLVKKLMKKWSVTQNLTFREQLEAGIRYFDLRVSSKPGDADQEIYFIHGLFGIKVWDGLMEIDSFLTQHPQEIIFLDFNHFYAMDETHHKCLVLRIQEAFGNKLCPACSVESLTLRTLWEKNCQVLIFYHCPFYKQYPFLWPGKKIPAPWANTTSVRKLILFLETTLSERASRGSFHVSQAILTPRVKTIARGLVGGLKNTLV 287          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Celegans
Match: F38E9.1 (pep chromosome:WBcel235:X:16471058:16474819:1 gene:WBGene00018184.1 transcript:F38E9.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F38E9.1)

HSP 1 Score: 85.1149 bits (209), Expect = 2.058e-17
Identity = 85/328 (25.91%), Postives = 141/328 (42.99%), Query Frame = 1
Query:  289 LNAWMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDI--IKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAI-------------NKFDNNEIYSC---HSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYK-----LANILETIFSYKLAPYSE--IIPSLKDMWKSNHQVIVFYHCDNIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLE---DKEIGKGKINCSIVDFADSFDYVPSVLRLNFNH 1188
            ++ WM  LP S+   P+  I IPGSHDS  Y        A D   +  ++NF   F    KR++ RW  TQ L    QL  G+R+FDIR  +                D++   SC   H L++    K    +  FL +++ EV++L++ + Y  T++D  +      ++I E      L P      I +L ++ +   ++IV    D       +    + + WP+ +N   +L +L              + QGV+TP  +    ++  SLK   +        +WL+   D+EI  G +N  I D  D+ ++   V  LN N 
Sbjct:    1 MSDWMGRLPSSIREKPLCSICIPGSHDSGAYWFNLRMGYAHDQSFLRYVRNFRCNF---VKRIVERWGLTQSLPIDEQLQIGVRFFDIRLELALDINASARQNLAQDPDDSSRKSCFIVHGLYSIDCLKLAHQMVDFLVAHKEEVLILNVSHIYRMTEYDFRRFFLHPFSSIAERC-GISLCPTDVDLRIVTLDELIEKEFRIIVVGPSDQDMDGCCFRSAALQNKWPRKNNTSDLLVYLQAQIH-APVTPGLRVLQGVITPELSDIFRNLRSSLKKTFSLPMRGLLKEWLQRLDDEEI--GNLNILISDQVDT-EFCRLVYYLNINE 320          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Fly
Match: CG10747 (gene:FBgn0032845 transcript:FBtr0081341)

HSP 1 Score: 164.081 bits (414), Expect = 2.929e-46
Identity = 104/293 (35.49%), Postives = 156/293 (53.24%), Query Frame = 1
Query:  298 WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFDNNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIPSLKD-----MWKSNHQVIVFYHCDNIHKPF-LWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIG------KGKINCSIVDFA 1140
            WM +LP  L  L +  +AIPGSH+S TY I S S+++PDAE  I+ + R F    +R    W+KTQ      QL  G+RYFD+R A     +++ Y CH LFA +I + LL IR+F+D++  EVV+LDL++FY  T   H KL   L   F+++L  YS +  SLKD       +    V++ Y    I  P   WP Y  P+PWP   ++ K+  FL D+      Q   Y++Q ++TPT       +  +LKS  AK+       W++++  G      + ++N  + DF 
Sbjct:    6 WMRDLPSELRDLSIINLAIPGSHNSMTYGINSKSELSPDAEISIRRWHRFFPCFVRR----WSKTQSSGTLDQLELGVRYFDLRIAQK---DDKFYYCHGLFAMEIFEPLLEIRQFVDTHPEEVVILDLQHFYAMTVAHHQKLHKDLIQFFAHRL--YSTVDGSLKDCTLNRCLEMQRSVVIIYRRCPIPLPLRFWPSYAWPTPWPNKASVKKLQSFLEDSLLSRQPQQG-YVSQCLITPTGRYIAFRLFFTLKST-AKRVDKKLQPWIQEQIPGPFEPKDEPRVNVFLADFV 287          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Fly
Match: CG10747 (gene:FBgn0032845 transcript:FBtr0331618)

HSP 1 Score: 164.081 bits (414), Expect = 2.929e-46
Identity = 104/293 (35.49%), Postives = 156/293 (53.24%), Query Frame = 1
Query:  298 WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFDNNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIPSLKD-----MWKSNHQVIVFYHCDNIHKPF-LWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIG------KGKINCSIVDFA 1140
            WM +LP  L  L +  +AIPGSH+S TY I S S+++PDAE  I+ + R F    +R    W+KTQ      QL  G+RYFD+R A     +++ Y CH LFA +I + LL IR+F+D++  EVV+LDL++FY  T   H KL   L   F+++L  YS +  SLKD       +    V++ Y    I  P   WP Y  P+PWP   ++ K+  FL D+      Q   Y++Q ++TPT       +  +LKS  AK+       W++++  G      + ++N  + DF 
Sbjct:    6 WMRDLPSELRDLSIINLAIPGSHNSMTYGINSKSELSPDAEISIRRWHRFFPCFVRR----WSKTQSSGTLDQLELGVRYFDLRIAQK---DDKFYYCHGLFAMEIFEPLLEIRQFVDTHPEEVVILDLQHFYAMTVAHHQKLHKDLIQFFAHRL--YSTVDGSLKDCTLNRCLEMQRSVVIIYRRCPIPLPLRFWPSYAWPTPWPNKASVKKLQSFLEDSLLSRQPQQG-YVSQCLITPTGRYIAFRLFFTLKST-AKRVDKKLQPWIQEQIPGPFEPKDEPRVNVFLADFV 287          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Fly
Match: CG14945 (gene:FBgn0032402 transcript:FBtr0080295)

HSP 1 Score: 56.9954 bits (136), Expect = 1.947e-8
Identity = 63/257 (24.51%), Postives = 110/257 (42.80%), Query Frame = 1
Query:  157 IICSYKYYSNIRLRMFKKILKFGNSLDRN------------SWIKSQ----IKCCFHYYPLNAWMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFDNNEIYSCHSLFAGQIKKDLLS-IRKFLDSYE-REVVLLDLKNF-YEFTK--HDHYKLANILETIFSYKLA-PYSEIIPSLKDMWKSNHQVIVFYHCDNIHKPF 861
            ++ + +    +  + F   L F  +L RN            S+I +Q     K C   +P   WM++L   +  + +  + IPG+HDS +Y                 NF  L   L + ++ ++A TQD D  GQL  G+RY DIR    +   +  +  H +   +  +++++ +R F+  YE  E+++  LK F   F K    H  L + L       +A P      SL+D+W     V + Y  + + + F
Sbjct:  136 VVAAIEPRQGLSTQWFTTGLPFDYALSRNATVQTACYGFWASYIDAQGNILAKTCLKVFP--RWMNDLKSKIGEMRLRDLFIPGTHDSGSYR---------------PNFDPL---LRESLVTKYALTQDDDIRGQLMHGVRYLDIRVGYYRNSPDPFFIYHGITKQRPLQEVINQVRDFV--YETNEIIIFGLKEFPVGFGKGLGVHRLLISYLRDQLKDLIAHPSLTWGASLRDIWARRQNVFLAYDHEAMVEEF 370          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Fly
Match: CG14945 (gene:FBgn0032402 transcript:FBtr0080294)

HSP 1 Score: 56.9954 bits (136), Expect = 1.947e-8
Identity = 63/257 (24.51%), Postives = 110/257 (42.80%), Query Frame = 1
Query:  157 IICSYKYYSNIRLRMFKKILKFGNSLDRN------------SWIKSQ----IKCCFHYYPLNAWMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFDNNEIYSCHSLFAGQIKKDLLS-IRKFLDSYE-REVVLLDLKNF-YEFTK--HDHYKLANILETIFSYKLA-PYSEIIPSLKDMWKSNHQVIVFYHCDNIHKPF 861
            ++ + +    +  + F   L F  +L RN            S+I +Q     K C   +P   WM++L   +  + +  + IPG+HDS +Y                 NF  L   L + ++ ++A TQD D  GQL  G+RY DIR    +   +  +  H +   +  +++++ +R F+  YE  E+++  LK F   F K    H  L + L       +A P      SL+D+W     V + Y  + + + F
Sbjct:  136 VVAAIEPRQGLSTQWFTTGLPFDYALSRNATVQTACYGFWASYIDAQGNILAKTCLKVFP--RWMNDLKSKIGEMRLRDLFIPGTHDSGSYR---------------PNFDPL---LRESLVTKYALTQDDDIRGQLMHGVRYLDIRVGYYRNSPDPFFIYHGITKQRPLQEVINQVRDFV--YETNEIIIFGLKEFPVGFGKGLGVHRLLISYLRDQLKDLIAHPSLTWGASLRDIWARRQNVFLAYDHEAMVEEF 370          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Zebrafish
Match: plcxd3 (phosphatidylinositol-specific phospholipase C, X domain containing 3 [Source:NCBI gene;Acc:541487])

HSP 1 Score: 229.95 bits (585), Expect = 2.678e-71
Identity = 109/299 (36.45%), Postives = 182/299 (60.87%), Query Frame = 1
Query:  298 WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFD-NNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAP--YSEIIPSLKDMWKSNHQVIVFYHCD-NIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLNF 1182
            WMS+LPD+L  +P+  +AIPGSHDSF++ I   S V P+  + ++NF  +FG +AK+++ +W  TQ ++   QL AGIR+FD+R +    D +NE+Y  H LF+  +++ L  I  FL S+ REVV LD  +FY      H KL  +L T+F  +L P  +++ + SLK +W+  +QV+VFYH    +  PFLWPG M+P+PW  T +  K++ FL  + K+   +  F+++Q VLTP  +  +  +   L+  + ++A P+  +W+  +  G+  +N    DF +  +++ +V+ LN+
Sbjct:   15 WMSSLPDTLHGIPLTNLAIPGSHDSFSFYIDEASPVGPEQPETVQNFVSVFGTVAKKLMRKWLATQTMNFTSQLEAGIRFFDLRISTKPRDPDNELYFAHGLFSATVREGLEQISTFLASHAREVVFLDFNHFYGVQNLHHEKLVQMLRTVFGDRLCPVVFAQEV-SLKYLWEKEYQVLVFYHNPMALEVPFLWPGQMMPAPWANTTDPEKLILFLQASVKDRRRKGTFFVSQVVLTPKASTVMKGVTSGLRETITERALPSMMQWIRSQRPGESGVNIITADFVELGEFISAVITLNY 312          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Zebrafish
Match: plcxd2 (phosphatidylinositol-specific phospholipase C, X domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-091204-217])

HSP 1 Score: 190.274 bits (482), Expect = 2.734e-56
Identity = 96/296 (32.43%), Postives = 167/296 (56.42%), Query Frame = 1
Query:  301 MSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFD-NNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIP-SLKDMWKSNHQVIVFYHCDNIHK-PFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLN 1179
            M +L  +LT++P+  +A+PGSHDSF++ +   + V PD +  +K+   +F  LAK+V+ +W+ TQ+L    QL  GIRYFD+R +    +  +EIY  H LF  +++  L  I  FL+ +++EVV LD  + Y   +  H  L  +L+ +F +KL     +   +L  +W++ +QV+VFYH  +    P +WPG  IP+PW  T +  K++ FL     E      F+++Q +LTP        +++ L++ + ++  P    W+E ++ GK  +N    DF +  D+  +V++LN
Sbjct:    1 MGSLCPALTSMPLKHLAVPGSHDSFSFWVDEQAPVGPDQKAYVKHLAAIFRFLAKKVMKKWSMTQNLTFREQLEGGIRYFDLRVSSKPGEAGHEIYFIHGLFGHKVRDGLNDINNFLNIHKKEVVFLDFNHHYAMGEEHHRYLIKMLQDVFGHKLCRIDVVEEITLNYLWENRYQVLVFYHHPSAEGCPVMWPGSKIPAPWANTTDTTKLIQFLETTLGERAKYGSFHVSQAILTPRVKTIARGLVQGLRNYLVERNLPTIMTWVEAQKPGKDGVNIITSDFVELVDFANTVIKLN 296          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Zebrafish
Match: plcxd2 (phosphatidylinositol-specific phospholipase C, X domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-091204-217])

HSP 1 Score: 149.443 bits (376), Expect = 1.273e-41
Identity = 78/239 (32.64%), Postives = 133/239 (55.65%), Query Frame = 1
Query:  352 IPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFD-NNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIP-SLKDMWKSNHQVIVFYHCDNIHK-PFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKK 1059
            I GSHDSF++ +   + V PD +  +K+   +F  LAK+V+ +W+ TQ+L    QL  GIRYFD+R +    +  +EIY  H LF  +++  L  I  FL+ +++EVV LD  + Y   +  H  L  +L+ +F +KL     +   +L  +W++ +QV+VFYH  +    P +WPG  IP+PW  T +  K++ FL     E      F+++Q +LTP        +++ L++ + ++
Sbjct:    9 ISGSHDSFSFWVDEQAPVGPDQKAYVKHLAAIFRFLAKKVMKKWSMTQNLTFREQLEGGIRYFDLRVSSKPGEAGHEIYFIHGLFGHKVRDGLNDINNFLNIHKKEVVFLDFNHHYAMGEEHHRYLIKMLQDVFGHKLCRIDVVEEITLNYLWENRYQVLVFYHHPSAEGCPVMWPGSKIPAPWANTTDTTKLIQFLETTLGERAKYGSFHVSQAILTPRVKTIARGLVQGLRNYLVER 247          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Zebrafish
Match: zgc:64065 (zgc:64065 [Source:ZFIN;Acc:ZDB-GENE-040426-1355])

HSP 1 Score: 146.362 bits (368), Expect = 8.698e-40
Identity = 98/303 (32.34%), Postives = 160/303 (52.81%), Query Frame = 1
Query:  289 LNAWMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQV-APDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFDNNEIYSCHSLFAGQ-IKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIPSLKDMWKSNHQVIVFYHCDNIHKPFLWP--GYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIV--DFADSFDYVPSVLRLN 1179
            L  WMS L ++ TT+P++ IAIPGSHD+  YS+   S V  PD+   +K    +F    + ++ +W   QD     QL+AG RYFD+R A  K ++++ +  H L+    +K+ +  ++ +L  + +EVV+L   +F E +   H  L N L+  F  KL P ++ +PSLKD W+S++QVI+ Y   NI  P LWP  GY     W    +  +++ FL DN K+    +  ++    LT      L ++  SLK      A P   +W++++  G G  + +I+  DF     +   V++LN
Sbjct:    7 LADWMSKLNETFTTVPLSHIAIPGSHDAMAYSLDMDSPVLEPDS---LKPMDNMFSAFLRPIVKKWGTAQDKTISEQLDAGTRYFDLRVA-GKPESSDFFFYHGLYTTMTVKEAMTELKTWLGQHSKEVVILAFSHFKEMSADQHTDLTNFLKEHFKTKLCPKAK-MPSLKDCWESSYQVILSYDDRNIEDPVLWPRIGYW----WADNSDPNEVISFL-DNKKQTGRPEGLFVAGLNLTFDANDMLQYLTTSLKE-KTMTAYPLLLEWVKEQHPGSGTQSINIIAGDFVGVNSFAHDVIQLN 298          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Zebrafish
Match: zgc:112023 (zgc:112023 [Source:NCBI gene;Acc:550368])

HSP 1 Score: 131.724 bits (330), Expect = 2.451e-34
Identity = 90/306 (29.41%), Postives = 148/306 (48.37%), Query Frame = 1
Query:  298 WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFDNNEI-YSCHSLFA-GQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIPSLKDMWKSNHQVIVFYHCDNIHKPF--LWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGK--INCSIVDFADSFDYVPSVLRLNFNHVNV 1197
            WMS +P  +  +P+  +AIPGSHDS TY +   S V+     +++   + F  + +  I +WA TQ+     QL+ GIR+ D+R A    D +E+ Y  H +++   +K+ L  + ++LD + +EVV++ L NF       H  L   L   F+ K+ P S + PSL++ W  ++QVI+ Y  D     +  LWP    P  W    +   ++ +L D   EG    +F      LT      L H  +SL+S M +++     KW+E +  G G+  +N    DF   F    + L +  N +  
Sbjct:   10 WMSKMPSHMWDIPLWNLAIPGSHDSMTYCLDKQSSVSNSTPRVVQVLDKYFPCIVRPCIMKWATTQEGAISNQLDLGIRFLDLRIAHKIKDPDEVFYFAHGVYSLLTVKEALTEVARWLDQHIKEVVIIALSNFEGMNLDQHKDLIQFLIATFNKKICPKS-VTPSLQECWNHSYQVILSYD-DESSTGYVELWP--QCPYWWANKSDPNLVISYLEDQKNEGRPGQFFAAGLN-LTEDARYVLCHPCQSLQS-MTRRSYSLLMKWVEQQRPGSGQACLNIICADFVGIFGSEFTQLVIGLNQIEA 309          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Xenopus
Match: PLCXD3 (phosphatidylinositol-specific phospholipase C, X domain containing 3 [Source:NCBI gene;Acc:100485500])

HSP 1 Score: 229.565 bits (584), Expect = 5.328e-71
Identity = 108/299 (36.12%), Postives = 180/299 (60.20%), Query Frame = 1
Query:  298 WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFD-NNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAP--YSEIIPSLKDMWKSNHQVIVFYHCD-NIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLNF 1182
            WM++LP+ +  +P+  +AIPGSHDSF++ I   S V P+  + ++NF  +FG +AK+++ +W  TQ ++   QL AGIRYFD+R +    D +NE+Y  H LF+ ++ + L  I  +L  + +EVV LD  +FY   K+ H  L  +L  IF  K+ P  +++ +  LK +W+ N+Q++VFYH    +  PFLWPG M+P+PW  T +  K++ FL  +  E   +  F+I+Q VLTP  +  +  +   L+  + ++A PA   W+  ++ G+  IN    DF +  D++ +V+RLN+
Sbjct:   15 WMASLPERIHRVPLTSLAIPGSHDSFSFYIDEASPVGPEQPETVQNFVSVFGTVAKKLMRKWLATQTMNFTNQLEAGIRYFDLRISTKPRDPDNELYFAHGLFSAKVNEGLEEINAYLSDHTKEVVFLDFNHFYGMQKYHHENLVQMLRDIFGKKICPVIFAQEV-CLKYLWERNYQILVFYHSPVALEVPFLWPGQMMPAPWANTTDTEKLIQFLQSSITERRKKGSFFISQVVLTPKASTVVKGVASGLRETITERALPAMMHWVRTQKPGESGINIVTADFVELGDFISTVIRLNY 312          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Xenopus
Match: PLCXD2 (phosphatidylinositol-specific phospholipase C, X domain containing 2 [Source:NCBI gene;Acc:100496710])

HSP 1 Score: 190.66 bits (483), Expect = 3.725e-56
Identity = 103/299 (34.45%), Postives = 167/299 (55.85%), Query Frame = 1
Query:  298 WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFD-NNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKL--APYSEIIPSLKDMWKSNHQVIVFYHCDNIHK-PFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLNF 1182
            WM +LP SL++LP+  +AIPGSHDSF+Y +   S V PD    IK   ++   L KR++ +W+ TQ+L    QL +GIRYFD+R +    +   EIY  H L+  ++   L  I KFL  + +E+VLLD  +FY      H  L N+++ +F  KL  A   E I +L+ +W   +QV++FYH +  ++  +LW G  +P+PW  T N+ K++ FL     E   +  F+++Q +LTP     +  +   LK+ +  +  P    W++ ++ G   +N    DF +  D+  +V+RLN+
Sbjct:    9 WMGSLPTSLSSLPLANLAIPGSHDSFSYWVDEKSPVGPDQAATIKRIAKI--SLVKRLMKKWSVTQNLTFKEQLESGIRYFDLRVSSKPEEAGKEIYFIHGLYGIKVWDGLEEINKFLTQHNKEIVLLDFNHFYAMDHEHHLYLVNMMQEVFGSKLCTADCVENI-TLQYLWGKKYQVLIFYHYNLWNEYLYLWSGNKMPAPWANTTNVQKLIQFLETTLTERSKRGTFHVSQAILTPRVKTIVRGLKSGLKNTLVHRNLPVILNWVKMQKPGVMGVNIITSDFVELVDFAETVIRLNY 304          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Xenopus
Match: sncg (synuclein gamma [Source:Xenbase;Acc:XB-GENE-973674])

HSP 1 Score: 139.043 bits (349), Expect = 5.653e-37
Identity = 97/300 (32.33%), Postives = 154/300 (51.33%), Query Frame = 1
Query:  298 WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFD-NNEIYSCHSLFAG-QIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIPSLKDMWKSNHQVIVFYHCDNIHK--PFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIV--DFADSFDYVPSVLRLN 1179
            WMS LP+ L  +P+  I+IPGSHDS +Y +   S + P+   ++    +L   LA+  I RWAKTQ      QLNAG+RY D+R A    D +  +Y  H LF    +K+  L I  +L +   EVV+L  +   +FT   H  L   + ++F  KL P  + +P+L+ MW   +QVI+ Y  D + +   FLWP   +P  W  T ++  ++H+L +  +EG    +F      LT      + H   S+K++   K  P    W++++  GK +   +I+  D   S  +V +V+ LN
Sbjct:    6 WMSQLPEHLWDIPLYNISIPGSHDSMSYCLDKMSPLEPELPILLSVLDKLVPCLARATILRWAKTQ------QLNAGVRYLDLRIAHRPDDPSPALYFAHGLFTHITVKEAFLEILAWLLTNPTEVVILSCRRVQDFTLEHHLHLIYCIYSVFGSKLCPKHD-MPTLRLMWNMGYQVILSYD-DTMAQFYDFLWPS--VPYWWADTTSVSTLIHYLEERKQEGRPGGFFVAGLN-LTENFWYIVTHPFGSMKNMTIPKL-PVMYLWVQNQNPGKSRHATNIIAEDLIGSDCFVSAVIHLN 293          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Mouse
Match: Plcxd3 (phosphatidylinositol-specific phospholipase C, X domain containing 3 [Source:MGI Symbol;Acc:MGI:2442605])

HSP 1 Score: 235.343 bits (599), Expect = 2.153e-73
Identity = 111/299 (37.12%), Postives = 185/299 (61.87%), Query Frame = 1
Query:  298 WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFD-NNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAP--YSEIIPSLKDMWKSNHQVIVFYHCD-NIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLNF 1182
            WM+ LP+S+ ++P+  +AIPGSHDSF++ I   S V P+  + ++NF  +FG +AK+++ +W  TQ +   GQL AGIRYFD+R +    D +NE+Y  H LF+ ++ + L  I  FL  + +EVV LD  +FY   K+ H KL  +L+ I+  K+ P  +++ + SLK +W+ ++QV+VFYH    +  PFLWPG M+P+PW  T +  K++ FL  +  E   +  F+I+Q VLTP  +  +  +   L+  + ++A PA  +W+  ++ G+  IN    DF +  D++ +V++LN+
Sbjct:   15 WMATLPESIHSIPLTNLAIPGSHDSFSFYIDEASPVGPEQPETVQNFVSVFGTVAKKLMRKWLATQTMSFTGQLGAGIRYFDLRISTKPRDPDNELYFAHGLFSAKVNEGLEEINAFLTDHHKEVVFLDFNHFYGMQKYHHEKLVQMLKDIYGNKMCPAIFAQEV-SLKYLWEKDYQVLVFYHSPVALEVPFLWPGQMMPAPWANTTDPEKLIQFLQASITERRKKGSFFISQVVLTPKASTVVKGVASGLRETITERALPAMMQWIRTQKPGESGINIVTADFVELGDFISTVIKLNY 312          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Mouse
Match: Plcxd2 (phosphatidylinositol-specific phospholipase C, X domain containing 2 [Source:MGI Symbol;Acc:MGI:3647874])

HSP 1 Score: 195.667 bits (496), Expect = 5.538e-58
Identity = 110/336 (32.74%), Postives = 178/336 (52.98%), Query Frame = 1
Query:  187 IRLRMFKKILKFGNSLDRN-SWIKSQIKCCFHYYPLNA-WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFDNN-EIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIP-SLKDMWKSNHQVIVFYHCDNIHK-PFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLN 1179
            +  R  ++ L+ G     N S  K+  + C      NA WM++LP  L  +P++ +AIPGSHDSF+Y +   S V PD    +    R+   L K+++ +W+ TQ+L    QL AGIRYFD+R +    D + EIY  H LF  ++   L+ I  FL  + +E++ LD  +FY   +  H  L   ++  F  KL P   +   +L+ +W+  +QV++FYHC    + PFLWPG  IP+PW  T ++ K++ FL     E   +  F+++Q +LTP        ++  LK+ +  +  PA   W++ ++ G   +N    DF D  D+  +V+ LN
Sbjct:    2 LAFRKARRKLRMGTICSPNPSGTKTASEVC------NADWMASLPAHLHNVPLSNLAIPGSHDSFSYWVDEKSPVGPDQTQAVIRLARI--SLVKKLMKKWSVTQNLTFREQLEAGIRYFDLRVSSKPGDTDQEIYFIHGLFGIKVWDGLMEIDAFLTQHPQEIIFLDFNHFYAMDESHHKCLVLRIQEAFGNKLCPACSVESMTLRSLWEKKYQVLIFYHCPFYKQYPFLWPGKKIPAPWANTTSVQKLILFLETTLSERAPRGAFHVSQAILTPRVKTIARGLVGGLKNTLVHRNLPAILDWVKTQKPGAMGVNIITSDFVDLIDFATTVIELN 329          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Mouse
Match: Plcxd1 (phosphatidylinositol-specific phospholipase C, X domain containing 1 [Source:MGI Symbol;Acc:MGI:2685422])

HSP 1 Score: 132.494 bits (332), Expect = 4.395e-34
Identity = 89/300 (29.67%), Postives = 151/300 (50.33%), Query Frame = 1
Query:  298 WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTA-INKFDNNEIYSCHSLFAGQIKKDLLS-IRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIPSLKDMWKSNHQVIVFYHCDNIHKPF--LWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIV--DFADSFDYVPSVLRLN 1179
            WMS L   L  +P++ ++IPGSHD+ TY +   S+++  +  ++    R+   +   V+ +W+ TQ LD   QL+AG+RY D+R A   +     +   H ++   + +D L+ I ++L S+ REVV+L  +NF   T   H  LA  +  IF   L P  E +P+L+ +W    QVIV Y  +     +  LWP   IP  W        +L FL     +G   D  ++    +T      L+H ++SL+  M +++ P   +W+  ++ G+     +I+  DF D+  +V  V+ LN
Sbjct:   57 WMSQLCPQLWDVPLHHLSIPGSHDTMTYCLNRKSRISRASSWLLHLLGRVVPFITGPVVMKWSVTQTLDVTQQLDAGVRYLDLRIAHAPEGSTRNLCFVHMMYTKALVEDTLTEIAEWLQSHPREVVILACRNFEGMTCELHDYLAGCIVNIFGDMLCPSGE-VPTLRQLWAREQQVIVSYEDEATVSRYDQLWPA--IPYWWGNAVKTDVLLRFLETMKGQGR-PDGLFVAGINITENLCYILLHPVDSLEE-MTRRSLPLMTEWVCAQQPGQSPQCTNIIAGDFVDADGFVSKVISLN 351          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Mouse
Match: Plcxd1 (phosphatidylinositol-specific phospholipase C, X domain containing 1 [Source:MGI Symbol;Acc:MGI:2685422])

HSP 1 Score: 67.0106 bits (162), Expect = 1.983e-13
Identity = 31/86 (36.05%), Postives = 52/86 (60.47%), Query Frame = 1
Query:  298 WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTA 555
            WMS L   L  +P++ ++IPGSHD+ TY +   S+++  +  ++    R+   +   V+ +W+ TQ LD   QL+AG+RY D+R A
Sbjct:    7 WMSQLCPQLWDVPLHHLSIPGSHDTMTYCLNRKSRISRASSWLLHLLGRVVPFITGPVVMKWSVTQTLDVTQQLDAGVRYLDLRIA 92          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Mouse
Match: Plcxd1 (phosphatidylinositol-specific phospholipase C, X domain containing 1 [Source:MGI Symbol;Acc:MGI:2685422])

HSP 1 Score: 67.3958 bits (163), Expect = 2.757e-13
Identity = 31/86 (36.05%), Postives = 52/86 (60.47%), Query Frame = 1
Query:  298 WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTA 555
            WMS L   L  +P++ ++IPGSHD+ TY +   S+++  +  ++    R+   +   V+ +W+ TQ LD   QL+AG+RY D+R A
Sbjct:    7 WMSQLCPQLWDVPLHHLSIPGSHDTMTYCLNRKSRISRASSWLLHLLGRVVPFITGPVVMKWSVTQTLDVTQQLDAGVRYLDLRIA 92          
BLAST of PI-PLC X domain-containing protein 3 vs. UniProt/SwissProt
Match: sp|Q63HM9|PLCX3_HUMAN (PI-PLC X domain-containing protein 3 OS=Homo sapiens OX=9606 GN=PLCXD3 PE=1 SV=2)

HSP 1 Score: 236.113 bits (601), Expect = 6.890e-73
Identity = 112/302 (37.09%), Postives = 187/302 (61.92%), Query Frame = 1
Query:  289 LNAWMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFD-NNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAP--YSEIIPSLKDMWKSNHQVIVFYHCD-NIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLNF 1182
            L  WM+ LP+S+ ++P+  +AIPGSHDSF++ I   S V P+  + ++NF  +FG +AK+++ +W  TQ ++  GQL AGIRYFD+R +    D +NE+Y  H LF+ ++ + L  I  FL  + +EVV LD  +FY   K+ H KL  +L+ I+  K+ P  +++ + SLK +W+ ++QV+VFYH    +  PFLWPG M+P+PW  T +  K++ FL  +  E   +  F+I+Q VLTP  +  +  +   L+  + ++A PA  +W+  ++ G+  IN    DF +  D++ +V++LN+
Sbjct:   12 LADWMATLPESMHSIPLTNLAIPGSHDSFSFYIDEASPVGPEQPETVQNFVSVFGTVAKKLMRKWLATQTMNFTGQLGAGIRYFDLRISTKPRDPDNELYFAHGLFSAKVNEGLEEINAFLTDHHKEVVFLDFNHFYGMQKYHHEKLVQMLKDIYGNKMCPAIFAQEV-SLKYLWEKDYQVLVFYHSPVALEVPFLWPGQMMPAPWANTTDPEKLIQFLQASITERRKKGSFFISQVVLTPKASTVVKGVASGLRETITERALPAMMQWVRTQKPGESGINIVTADFVELGDFISTVIKLNY 312          
BLAST of PI-PLC X domain-containing protein 3 vs. UniProt/SwissProt
Match: sp|Q8BLJ3|PLCX3_MOUSE (PI-PLC X domain-containing protein 3 OS=Mus musculus OX=10090 GN=Plcxd3 PE=1 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 1.046e-72
Identity = 111/299 (37.12%), Postives = 185/299 (61.87%), Query Frame = 1
Query:  298 WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFD-NNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAP--YSEIIPSLKDMWKSNHQVIVFYHCD-NIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLNF 1182
            WM+ LP+S+ ++P+  +AIPGSHDSF++ I   S V P+  + ++NF  +FG +AK+++ +W  TQ +   GQL AGIRYFD+R +    D +NE+Y  H LF+ ++ + L  I  FL  + +EVV LD  +FY   K+ H KL  +L+ I+  K+ P  +++ + SLK +W+ ++QV+VFYH    +  PFLWPG M+P+PW  T +  K++ FL  +  E   +  F+I+Q VLTP  +  +  +   L+  + ++A PA  +W+  ++ G+  IN    DF +  D++ +V++LN+
Sbjct:   15 WMATLPESIHSIPLTNLAIPGSHDSFSFYIDEASPVGPEQPETVQNFVSVFGTVAKKLMRKWLATQTMSFTGQLGAGIRYFDLRISTKPRDPDNELYFAHGLFSAKVNEGLEEINAFLTDHHKEVVFLDFNHFYGMQKYHHEKLVQMLKNIYGNKMCPAIFAQEV-SLKYLWEKDYQVLVFYHSPVALEVPFLWPGQMMPAPWANTTDPEKLIQFLQASITERRKKGSFFISQVVLTPKASTVVKGVASGLRETITERALPAMMQWIRTQKPGESGINIVTADFVELGDFISTVIKLNY 312          
BLAST of PI-PLC X domain-containing protein 3 vs. UniProt/SwissProt
Match: sp|A6QNU9|PLCX3_BOVIN (PI-PLC X domain-containing protein 3 OS=Bos taurus OX=9913 GN=PLCXD3 PE=2 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 4.209e-72
Identity = 110/299 (36.79%), Postives = 186/299 (62.21%), Query Frame = 1
Query:  298 WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFD-NNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAP--YSEIIPSLKDMWKSNHQVIVFYHCD-NIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLNF 1182
            WM+ LP+S+ ++P+  +AIPGSHDSF++ I   S V P+  + ++NF  +FG +AK+++ +W  TQ ++  GQL AGIRYFD+R +    D +NE+Y  H LF+ ++ + L  I  FL  + +E+V LD  +FY   K+ H KL  +L+ I+  K+ P  +++ + SLK +W+ ++QV+VFYH    +  PFLWPG M+P+PW  T +  K++ FL  +  E   +  F+I+Q VLTP  +  +  +   L+  + ++A PA  +W+  ++ G+  IN    DF +  D++ +V++LN+
Sbjct:   15 WMATLPESIHSIPLTNLAIPGSHDSFSFYIDEASPVGPEQPETVQNFVSVFGTVAKKLMRKWLATQTMNFTGQLGAGIRYFDLRISTKPRDPDNELYFAHGLFSAKVNEGLEEINAFLTDHHKELVFLDFNHFYGMQKYHHEKLVQMLKDIYGNKMCPAIFAQEV-SLKYLWEKDYQVLVFYHSPVALEVPFLWPGQMMPAPWANTTDPEKLIQFLQASITERRKKGSFFISQVVLTPKASTVVKGVASGLRETITERALPAMMQWVRTQKPGESGINIVTADFVELGDFISTVIKLNY 312          
BLAST of PI-PLC X domain-containing protein 3 vs. UniProt/SwissProt
Match: sp|Q58EK3|PLCX3_DANRE (PI-PLC X domain-containing protein 3 OS=Danio rerio OX=7955 GN=plcxd3 PE=2 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 2.022e-70
Identity = 109/299 (36.45%), Postives = 182/299 (60.87%), Query Frame = 1
Query:  298 WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFD-NNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAP--YSEIIPSLKDMWKSNHQVIVFYHCD-NIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLNF 1182
            WMS+LPD+L  +P+  +AIPGSHDSF++ I   S V P+  + ++NF  +FG +AK+++ +W  TQ ++   QL AGIR+FD+R +    D +NE+Y  H LF+  +++ L  I  FL S+ REVV LD  +FY      H KL  +L T+F  +L P  +++ + SLK +W+  +QV+VFYH    +  PFLWPG M+P+PW  T +  K++ FL  + K+   +  F+++Q VLTP  +  +  +   L+  + ++A P+  +W+  +  G+  +N    DF +  +++ +V+ LN+
Sbjct:   15 WMSSLPDTLHGIPLTNLAIPGSHDSFSFYIDEASPVGPEQPETVQNFVSVFGTVAKKLMRKWLATQTMNFTSQLEAGIRFFDLRISTKPRDPDNELYFAHGLFSATVREGLEQISTFLASHAREVVFLDFNHFYGVQNLHHEKLVQMLRTVFGDRLCPVVFAQEV-SLKYLWEKEYQVLVFYHNPMALEVPFLWPGQMMPAPWANTTDPEKLILFLQASVKDRRRKGTFFVSQVVLTPKASTVMKGVTSGLRETITERALPSMMQWIRSQRPGESGVNIITADFVELGEFISAVITLNY 312          
BLAST of PI-PLC X domain-containing protein 3 vs. UniProt/SwissProt
Match: sp|B2RXA1|PLCX2_MOUSE (PI-PLC X domain-containing protein 2 OS=Mus musculus OX=10090 GN=Plcxd2 PE=2 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 3.874e-57
Identity = 110/336 (32.74%), Postives = 178/336 (52.98%), Query Frame = 1
Query:  187 IRLRMFKKILKFGNSLDRN-SWIKSQIKCCFHYYPLNA-WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFDNN-EIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIP-SLKDMWKSNHQVIVFYHCDNIHK-PFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLN 1179
            +  R  ++ L+ G     N S  K+  + C      NA WM++LP  L  +P++ +AIPGSHDSF+Y +   S V PD    +    R+   L K+++ +W+ TQ+L    QL AGIRYFD+R +    D + EIY  H LF  ++   L+ I  FL  + +E++ LD  +FY   +  H  L   ++  F  KL P   +   +L+ +W+  +QV++FYHC    + PFLWPG  IP+PW  T ++ K++ FL     E   +  F+++Q +LTP        ++  LK+ +  +  PA   W++ ++ G   +N    DF D  D+  +V+ LN
Sbjct:    2 LAFRKARRKLRMGTICSPNPSGTKTASEVC------NADWMASLPAHLHNVPLSNLAIPGSHDSFSYWVDEKSPVGPDQTQAVIRLARI--SLVKKLMKKWSVTQNLTFREQLEAGIRYFDLRVSSKPGDTDQEIYFIHGLFGIKVWDGLMEIDAFLTQHPQEIIFLDFNHFYAMDESHHKCLVLRIQEAFGNKLCPACSVESMTLRSLWEKKYQVLIFYHCPFYKQYPFLWPGKKIPAPWANTTSVQKLILFLETTLSERAPRGAFHVSQAILTPRVKTIARGLVGGLKNTLVHRNLPAILDWVKTQKPGAMGVNIITSDFVDLIDFATTVIELN 329          
BLAST of PI-PLC X domain-containing protein 3 vs. TrEMBL
Match: A0A1S2ZDE2 (PI-PLC X domain-containing protein 3 OS=Erinaceus europaeus OX=9365 GN=PLCXD3 PE=4 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 9.228e-72
Identity = 114/299 (38.13%), Postives = 184/299 (61.54%), Query Frame = 1
Query:  298 WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFD-NNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAP--YSEIIPSLKDMWKSNHQVIVFYHCD-NIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLNF 1182
            WM+ LPDS+ + P+  +AIPGSHDSF++ I   S V P+  + ++NF  +FG +AK+++ +W  TQ ++  GQL AGIRYFD+R +    D NNE+Y  H LF+ ++ + L  I  FL  + REVV LD  +FY   K+ H KL  +L+ I+  K+ P  +++ + SLK +W+  +QV+VFYH    +  PFLWPG M+P+PW  T +  K++ FL  +  E   +  F+I+Q VLTP  +  +  +   L+  + ++A PA  +W+  ++ G+  IN    DF +  D++ +V++LN+
Sbjct:   15 WMATLPDSIHSTPLTNLAIPGSHDSFSFYIDEASPVGPEQPETVQNFVSVFGTVAKKLMRKWLATQTMNFTGQLGAGIRYFDLRISTKPRDPNNELYFAHGLFSAKVNEGLEEIHAFLSEHPREVVFLDFNHFYGMQKYHHEKLVQMLKDIYGNKMCPAIFAQEV-SLKYLWEKEYQVLVFYHSPVALEVPFLWPGQMMPAPWANTTDPEKLIQFLQASITERRKKGSFFISQVVLTPKASTVVKGVASGLRETITERALPAMMQWVRTQKPGESGINIVTADFVELGDFISTVIKLNY 312          
BLAST of PI-PLC X domain-containing protein 3 vs. TrEMBL
Match: A0A2I3GGC5 (Phosphatidylinositol specific phospholipase C X domain containing 3 OS=Nomascus leucogenys OX=61853 GN=PLCXD3 PE=4 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 2.320e-71
Identity = 113/302 (37.42%), Postives = 187/302 (61.92%), Query Frame = 1
Query:  289 LNAWMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFD-NNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAP--YSEIIPSLKDMWKSNHQVIVFYHCD-NIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLNF 1182
            L  WM+ LP+S+ ++P+  +AIPGSHDSF++ I   S V P+  + ++NF  +FG +AK+++ +W  TQ ++  GQL AGIRYFD+R +    D +NE+Y  H LF+ ++ + L  I  FL  + +EVV LD  +FY   K+ H KL  +L+ I+  K+ P  +++ + SLK +W+ +HQV+VFYH    +  PFLWPG M+P+PW  T +  K++ FL  +  E   +  F+I+Q VLTP  +  +  +   L+  + ++A PA  +W+  ++ G+  IN    DF +  D++ +V++LN+
Sbjct:   12 LADWMATLPESMHSIPLTNLAIPGSHDSFSFYIDEASPVGPEQPETVQNFVSVFGTVAKKLMRKWLATQTMNFTGQLGAGIRYFDLRISTKPRDPDNELYFAHGLFSAKVNEGLEEINAFLTDHHKEVVFLDFNHFYGMQKYHHEKLVQMLKDIYGNKMCPAIFAQEV-SLKYLWEKDHQVLVFYHSPVALEVPFLWPGQMMPAPWANTTDPEKLIQFLQASITERRKKGSFFISQVVLTPKASTVVKGVASGLRETITERALPAMMQWVRTQKPGESGINIVTADFVELGDFISTVIKLNY 312          
BLAST of PI-PLC X domain-containing protein 3 vs. TrEMBL
Match: F7BFZ2 (Phosphatidylinositol specific phospholipase C X domain containing 3 OS=Monodelphis domestica OX=13616 GN=PLCXD3 PE=4 SV=2)

HSP 1 Score: 237.654 bits (605), Expect = 5.696e-71
Identity = 113/299 (37.79%), Postives = 185/299 (61.87%), Query Frame = 1
Query:  298 WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFD-NNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAP--YSEIIPSLKDMWKSNHQVIVFYHCD-NIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLNF 1182
            WM+ LP+S+ ++P+  +AIPGSHDSF++ I   S V P+  + ++NF  +FG +AK+++ +W  TQ ++  GQL AGIRYFD+R +    D +NE+Y  H LF+ ++ + L  I  FL  + REVV LD  +FY   K+ H KL  +L+ IF  K+ P  ++  + SLK +W+ ++QV+VFYH    +  PFLWPG M+P+PW  T +  K++ FL  +  E   +  F+I+Q VLTP  +  +  +   L+  + ++A PA  +W+  ++ G+  IN    DF +  D++ +V++LN+
Sbjct:   15 WMATLPESIHSIPLTNLAIPGSHDSFSFYIDEASPVGPEQPETVQNFVSVFGTVAKKLMRKWLATQTMNFTGQLGAGIRYFDLRISTKPRDPDNELYFAHGLFSAKVNEGLEEINAFLTDHHREVVFLDFNHFYGMQKYHHEKLVQMLKDIFGNKMCPAIFAHEV-SLKYLWEKDYQVLVFYHSPVALEVPFLWPGQMMPAPWANTTDPEKLIQFLQASITERRKKGSFFISQVVLTPKASTVVKGVASGLRETITERALPAMMQWVRTQKPGESGINIVTADFVELGDFISTVIKLNY 312          
BLAST of PI-PLC X domain-containing protein 3 vs. TrEMBL
Match: W5UEI5 (PI-PLC X domain-containing protein 3 OS=Ictalurus punctatus OX=7998 GN=plcxd3 PE=2 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 1.093e-70
Identity = 112/299 (37.46%), Postives = 179/299 (59.87%), Query Frame = 1
Query:  298 WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFD-NNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAP--YSEIIPSLKDMWKSNHQVIVFYHCD-NIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLNF 1182
            WM+NLP +L TLP+  +AIPGSHDSF++ I   S V P+  + ++NF  +FG +AK+++ +W  TQ ++   QL AGIR+FD+R +    D  NE+Y  H LF+  +++ L  I  FL S+ RE+V LD  +FY      H KL  +L T+F  +L P  ++E + SLK +W+  +QV+VFYH    +  PFLWPG M+PSPW  T +  K++ FL  +  E   +  F+++Q VLTP  +  +  +   L+  + ++A P   +W+  +  G+  +N    DF +  D++ +V+ LN+
Sbjct:   15 WMANLPANLHTLPLTNLAIPGSHDSFSFYIDEASPVGPEQPETVQNFVSVFGAVAKKLMRKWLATQTMNFSSQLEAGIRFFDLRISTKPRDPENELYFAHGLFSATVREGLEQISAFLSSHAREIVFLDFNHFYGVQNLHHEKLVQMLRTVFGDRLCPVVFAEEV-SLKYLWEKEYQVLVFYHSPMALEVPFLWPGQMMPSPWANTTDPEKLIQFLQTSVTERRRKGTFFVSQVVLTPKASTVMKGVTSGLRETITERALPGMMQWIRSQRPGESGVNIITADFVELGDFISAVITLNY 312          
BLAST of PI-PLC X domain-containing protein 3 vs. TrEMBL
Match: A0A5F5XMC8 (Phosphatidylinositol specific phospholipase C X domain containing 3 OS=Felis catus OX=9685 GN=PLCXD3 PE=4 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 1.121e-70
Identity = 112/299 (37.46%), Postives = 186/299 (62.21%), Query Frame = 1
Query:  298 WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFD-NNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAP--YSEIIPSLKDMWKSNHQVIVFYHCD-NIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLNF 1182
            WM+ LPDS+ ++P+  +AIPGSHDSF++ I   S V P+  + ++NF  +FG +AK+++ +W  TQ ++  GQL AGIRYFD+R +    D +NE+Y  H LF+ ++ + L  I  FL  + +EVV LD  +FY   K+ H KL  +L+ I+  K+ P  +++ + SLK +W+ ++QV+VFYH    +  PFLWPG M+P+PW  T +  K++ FL  +  E   +  F+I+Q VLTP  +  +  +   L+  + ++A PA  +W+  ++ G+  IN    DF +  D++ +V++LN+
Sbjct:   15 WMATLPDSIHSIPLTNLAIPGSHDSFSFYIDEASPVGPEQPETVQNFVSVFGTVAKKLMRKWLATQTMNFTGQLGAGIRYFDLRISTKPRDPDNELYFAHGLFSAKVNEGLEEINAFLTDHHKEVVFLDFNHFYGMQKYHHEKLVQMLKDIYGNKMCPAIFAQEV-SLKYLWEKDYQVLVFYHSPVALEVPFLWPGQMMPAPWANTTDPEKLIQFLQASITERRKKGSFFISQVVLTPKASTVVKGVASGLRETITERALPAMMQWVRTQKPGESGINIVTADFVELGDFISTVIKLNY 312          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Cavefish
Match: plcxd3 (phosphatidylinositol specific phospholipase C X domain containing 3 [Source:NCBI gene;Acc:103039082])

HSP 1 Score: 228.794 bits (582), Expect = 5.513e-71
Identity = 108/299 (36.12%), Postives = 180/299 (60.20%), Query Frame = 1
Query:  298 WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFD-NNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAP--YSEIIPSLKDMWKSNHQVIVFYHCD-NIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLNF 1182
            WM++LP +L T+P+  +AIPGSHDSF++ I   S V P+  + ++NF  +FG +AK+++ +W  TQ ++   QL AGIR+FD+R +    D +NE+Y  H LF+  +++ L  I  FL S+ REVV LD  +FY      H KL  +L T+F  +L P  ++E + +LK +W+  +QV+VFYH    +  PFLWPG M+P+PW  T +  K++ FL  +  +   +  F+++Q VLTP  +  +  +   L+  + ++A P   +W+  +  G+  +N    DF +  D++ +V+ LN+
Sbjct:   15 WMASLPANLHTVPLTNLAIPGSHDSFSFYIDEASPVGPEQPETVQNFVSVFGTVAKKLMRKWLATQTMNFSSQLEAGIRFFDLRISTKPRDPDNELYFAHGLFSATVREGLEQISTFLASHAREVVFLDFNHFYGVQNLHHEKLVQMLRTVFGDRLCPVVFAEEV-NLKYLWEKEYQVLVFYHNPMALEVPFLWPGQMMPAPWANTTDPDKLIQFLQASVTDRRHKGTFFVSQMVLTPKASTVMKGVASGLRETITERALPGMMQWIRSQRPGESGVNIITADFVELGDFISAVITLNY 312          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Cavefish
Match: plcxd2 (PI-PLC X domain-containing protein 2-like [Source:NCBI gene;Acc:103047596])

HSP 1 Score: 199.904 bits (507), Expect = 8.332e-60
Identity = 98/297 (33.00%), Postives = 168/297 (56.57%), Query Frame = 1
Query:  298 WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKF-DNNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIP-SLKDMWKSNHQVIVFYHCDNIHK-PFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLN 1179
            WM +L  +LT +P+ ++A+PGSHDSF++ +   + V PD +  +K+   +F  LAK+V+ +W+ TQ+L    QL+ GIRYFD+R +     + +E+Y  H LF  +++  LL I  FL ++ +EVV LD  + Y   +  H  L N+L+ +F  KL   + +   +L  +W+  +QV+VFYH  +    P +WPG  IP+PW  T +  K++ FL     E      F+++Q +LTP     +  ++  L++ + ++  P    W+E ++ G   +N    DF +  D+  +V+RLN
Sbjct:   15 WMGSLCPTLTAMPLKFLAVPGSHDSFSFWVDEEAPVGPDQKAFVKHLATIFRLLAKKVMKKWSMTQNLTFREQLDGGIRYFDLRVSSKPGEEGHELYFIHGLFGHKVRDGLLDINAFLSAHRKEVVFLDFNHHYAMDEEHHRYLINMLQEVFGSKLCKINAVEEITLDYLWEKKYQVLVFYHHSSAEGCPVMWPGNKIPAPWANTTDTTKLIQFLETTLGERAKYGSFHVSQAILTPRVKTVVGGLVRGLRNYLVERNLPIIMTWVEAQKPGVNGVNIITSDFVELVDFANTVIRLN 311          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Cavefish
Match: plcxd2 (PI-PLC X domain-containing protein 2-like [Source:NCBI gene;Acc:103047596])

HSP 1 Score: 181.03 bits (458), Expect = 8.856e-53
Identity = 91/278 (32.73%), Postives = 154/278 (55.40%), Query Frame = 1
Query:  355 PGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFD-NNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIP-SLKDMWKSNHQVIVFYHCDNIHK-PFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLN 1179
            PGSHDSF++ +   + V PD +  +K+   +F  LAK+V+ +W+ TQ+L    QL+ GIRYFD+R +    +  +E+Y  H LF  +++  LL I  FL ++ +EVV LD  + Y   +  H  L N+L+ +F  KL   + +   +L  +W+  +QV+VFYH  +    P +WPG  IP+PW  T +  K++ FL     E      F+++Q +LTP     +  ++  L++ + ++  P    W+E ++ G   +N    DF +  D+  +V+RLN
Sbjct:   29 PGSHDSFSFWVDEEAPVGPDQKAFVKHLATIFRLLAKKVMKKWSMTQNLTFREQLDGGIRYFDLRVSSKPGEEGHELYFIHGLFGHKVRDGLLDINAFLSAHRKEVVFLDFNHHYAMDEEHHRYLINMLQEVFGSKLCKINAVEEITLDYLWEKKYQVLVFYHHSSAEGCPVMWPGNKIPAPWANTTDTTKLIQFLETTLGERAKYGSFHVSQAILTPRVKTVVGGLVRGLRNYLVERNLPIIMTWVEAQKPGVNGVNIITSDFVELVDFANTVIRLN 306          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Cavefish
Match: plcxd1 (phosphatidylinositol-specific phospholipase C, X domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-131127-240])

HSP 1 Score: 118.627 bits (296), Expect = 1.871e-29
Identity = 89/322 (27.64%), Postives = 157/322 (48.76%), Query Frame = 1
Query:  286 PLNAWMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPD--AEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFD-NNEIYSCHSLFAG-QIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIPSLKDMWKSNHQVIVFY--HCDNIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGK--GKINCSIVDFADSFDYVPSVLRLNFNHVNVSHENLLKKGS 1227
            P+++WM +LP++L  +P+  +AIPGSH++ TY +    +   D    D+++   +    L +  + +WA TQ+     QL+ G+RY D+R A    D ++++Y  H ++    ++  L  I+ +LD++ +EVV+L   +F   ++  H  L + ++++F  KL P    I +L+++W   +QVIV Y  +  N H+  LW    IP  W        ++       K       F++    LT        H  ESLK  M     PA   W+ +++ G   G +N    DF     ++P+V+ LN        ENLL + +
Sbjct:   18 PMDSWMGHLPNALWDVPLCNLAIPGSHNAITYCLDKNDRSPVDLTQPDMLQKLDKYMKPLIRPFVYKWAITQECTVREQLDGGVRYCDLRIAHRPNDSSSDLYFYHGVYTTITVETVLKEIKVWLDAHPKEVVILSFSHFLGLSQELHALLISNIKSVFDSKLCPKMVDI-TLRNLWNQGYQVIVSYEHNVANCHRE-LWSH--IPYWWANKCKAEALIEEFERRKKHAR-PGGFFVTGINLTEDLKYICSHPTESLKD-MVMSTYPALLGWVREQKPGSNTGSLNIIAGDFVTESQFIPTVIALN--------ENLLSRST 325          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Cavefish
Match: zgc:112023 (PI-PLC X domain-containing protein 1-like [Source:NCBI gene;Acc:103027817])

HSP 1 Score: 112.464 bits (280), Expect = 2.007e-27
Identity = 84/288 (29.17%), Postives = 136/288 (47.22%), Query Frame = 1
Query:  298 WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTA--INKFDNNEIYSCHSLFA-GQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIPSLKDMWKSNHQVIVFYH--CDNIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIG--KGKINCSIVDFA 1140
            WMS LP  L    +  +AIPGSHD+ TY +   S V      I+K    +   + +  +  W  TQ+L    QL++GIR+ D+R A   N FD N  Y  H +++   +K+ L  +  +L+ + +EVV++ L  F       H KL + L+++F  KL P +E  P+LK  W   +QVI+ Y     + H+  LWP +     W    +   ++ +L D  +       F++    LT      L H+ +S+K+ M  +A      W++ +  G  K   N    DF 
Sbjct:   19 WMSQLPAQLHAAALWDLAIPGSHDTMTYCLDQHSPVLQSQPRILKVLDHIVPCIIRPCVNNWGTTQELIISTQLDSGIRFLDLRIAHKANDFDQN-FYFAHGIYSLVTVKEALTDVSLWLEQHAKEVVMIALSAFEGVNPTQHRKLIDFLKSLFEKKLCPKTE-EPTLKKCWTRGYQVILSYADPSGSGHRE-LWPAW--DYWWANDSDPSMVISYLEDRKENEGRPGCFFVAGLNLTEDTRYVLRHLGQSMKT-MTLRAYSLLMDWVKQQRPGCQKTCFNVICADFV 300          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Sea Lamprey
Match: zgc:112023 (zgc:112023 [Source:NCBI gene;Acc:550368])

HSP 1 Score: 75.8702 bits (185), Expect = 8.855e-16
Identity = 36/113 (31.86%), Postives = 65/113 (57.52%), Query Frame = 1
Query:  298 WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFDNNEI----YSCHSLFAGQIKKD 624
            WM+ LP++L  +P+  +AIPGSHD+ T+ + + S + P    I+    ++   + + +I  ++ TQD    GQL+ G+RYFD+R A  + D  EI    +  ++    Q++K+
Sbjct:    3 WMAGLPEALWDIPLCHLAIPGSHDTMTFDLDATSSLEPSQPQILHTLLQVVPCITRPIIYSYSHTQDFGVSGQLDIGVRYFDLRIAHYEKDPAEILRYTHGFYTTLTVQVRKE 115          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Nematostella
Match: EDO43542 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYL5])

HSP 1 Score: 174.481 bits (441), Expect = 1.135e-50
Identity = 101/300 (33.67%), Postives = 158/300 (52.67%), Query Frame = 1
Query:  301 MSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFDNNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIP--SLKDMWKSNHQVIVFYHCDNI--HKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHF--QDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKG-KINCSIVDFADSFDYVPSVLRLN 1179
            M  LP      P+  + IPG+HDS ++S++  + ++P     +K   ++FG LAK VI RW+KTQ+LD   QL  G RY D+R A+N   N +  + H L+ G+I+  L  ++ F+  + +EVV+LD  +FY      H KL+ +++ +F  +L P  +I    +L D W     VIV Y   ++    P  W G  I SPW  T  L  +++FL +   E H   +  F+I QG+L+P     L H+  SLK+ +A KAT     WL+   +      N  I DF D  ++  +V+ +N
Sbjct:    1 MEKLPKHKQMSPLQELVIPGTHDSCSFSVSVDNDLSPSEPKWMKLLVKIFGKLAKWVIYRWSKTQELDLGQQLIRGCRYIDMRVALNP-TNGDFQTVHGLYGGRIRNLLQPVKAFVTDHPKEVVILDFNHFYNMDASAHQKLSGVIKGLFGDRLLPPGKIGVQMTLNDAWDMGKNVIVTYDYSDVIEDNPEFWSGSDIYSPWANTSKLATLINFL-NTETESHSLPKGSFHIAQGLLSPNTKVLLAHLTSSLKATLALKATQGITSWLKSVALSNAHTFNIIIADFVDYDEFAETVVGMN 298          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Nematostella
Match: EDO43434 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYB9])

HSP 1 Score: 169.088 bits (427), Expect = 7.257e-49
Identity = 97/300 (32.33%), Postives = 157/300 (52.33%), Query Frame = 1
Query:  301 MSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFDNNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSE--IIPSLKDMWKSNHQVIVFYHCDNIHK--PFLWPGYMIPSPWPQTDNLGKMLHFLSDN-YKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGK-GKINCSIVDFADSFDYVPSVLRLNF 1182
            M NLP+      +N + IPGSHDS T+ +    +V PD   +I N   +FG  AK V+  W+ TQ L+ + QL AG+RY D+R A+ + + N++   H L+   + + L  +++F     +EVV+LD  +FY      H +LA+ L  +F   L    E  +  +L+D+W     VI+ YH  ++++  P  WP     SPWP   +  +++ FLS    K     + F+I QGVLTP  +  + +M  +LK  +A K       WL+     K  K N  I DF +  +++P+V+ +N+
Sbjct:    1 MENLPNEKQLCRLNDLVIPGSHDSGTFYLNQDLEVGPDEPQMIHNLVTVFGKFAKSVVHGWSVTQSLNIYEQLYAGVRYIDLRVAL-RAEENDVRIVHGLYGCLVNEILRDVKRFNAERPKEVVILDFNHFYNMDSEAHQRLADTLLGMFGETLRAPGEDPLNVTLQDLWACEQSVIIVYHDYDVYECYPCFWPPNYFYSPWPNVSDRKQLMDFLSTKCLKSDCPNNAFHITQGVLTPQTSTVVGNMTGTLKDCLAVKCNIHLTGWLKALCDSKYHKFNIIITDFVEHGEFIPTVISMNY 299          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Nematostella
Match: EDO44749 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUT4])

HSP 1 Score: 72.0182 bits (175), Expect = 2.544e-13
Identity = 50/157 (31.85%), Postives = 76/157 (48.41%), Query Frame = 1
Query:  280 YYPLNAWMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFDNNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIF 750
            +YPL  WM  LP    +LP+ ++AIPGSH+SFTY+++S  ++AP   D  +    L    +K  I  W+ TQ  +   QL  GIRY D R   +  D       H L+   I++ L  I+ F  +  +      + + +E    D   LA + E  F
Sbjct:  697 FYPLR-WMEQLPQDQHSLPLQFLAIPGSHNSFTYTLSSRREIAPSFMD-YQTLRFLLSLKSKPTIYNWSITQRWNVTRQLRHGIRYLDARVVFHTKDQT-FRIVHGLYGRTIRELLKDIKDFTSAPTQRGCHPCVNSLWEDKLCDSKTLAGLSENNF 850          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Medaka
Match: plcxd3 (phosphatidylinositol specific phospholipase C X domain containing 3 [Source:NCBI gene;Acc:101163824])

HSP 1 Score: 220.32 bits (560), Expect = 1.182e-67
Identity = 102/302 (33.77%), Postives = 181/302 (59.93%), Query Frame = 1
Query:  298 WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFD-NNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAP--YSEIIPSLKDMWKSNHQVIVFYHCD-NIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLNFNHV 1191
            WM++LP ++  +P+  +AIPGSHDSF++ I   S V P+  + ++NF  +FG +AK+++ +W  TQ ++   Q+ AGIR+FD+R +    D +NE++  H LF+  +++ L  I  FL ++ REVV LD  +FY      H KL  +L  +F  KL P  +++ + +L+ +W+  +QV+VFYH    +  PFLWPG M+P+PW  T +  K++ FL  +  +   +  F+++Q VLTP  +  +  +   L+  + ++A P   +W+  +  G+  IN    DF +  +++ +V+ LN++H+
Sbjct:   15 WMASLPPNMHRIPLTNLAIPGSHDSFSFYIDEASPVGPEQPETVQNFVSVFGTVAKKLMRKWLATQTMNFISQMEAGIRFFDLRISTKPRDPDNELFFAHGLFSATVREGLEQISSFLSAHAREVVFLDFNHFYGVQNLHHEKLVAMLREVFGDKLCPVVFAQEV-TLQYLWEKEYQVLVFYHHPMALEVPFLWPGQMMPAPWANTTDPEKLVQFLQASVTDRRRKGSFFVSQVVLTPKASTVMKGVASGLRETITERALPGMMQWIRSQRPGESGINIITADFVELGEFISAVITLNYHHL 315          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Medaka
Match: plcxd2 (PI-PLC X domain-containing protein 2 [Source:NCBI gene;Acc:101160856])

HSP 1 Score: 210.305 bits (534), Expect = 6.608e-64
Identity = 107/297 (36.03%), Postives = 165/297 (55.56%), Query Frame = 1
Query:  298 WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFD-NNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIP-SLKDMWKSNHQVIVFYHCDNIHK-PFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLN 1179
            WM +LP  L+ +P+  +A+PGSHDSFT+ +   + VAPD +  +K    +F  LAK+V+ +W+ TQ+L    QL+AGIRYFD+R +    +  NEIY  H LF  +++  LL I  FL  + +EVV LD  ++Y      H  L ++L+ +F  KL     +   +L  MW+  +QVIVFYH  +    P +WPG  IP+PW  T    K++ FL    KE   Q  F++ Q +LTPT       ++  L+S + ++  P    W+E ++ G   +N    DF +  D+   V++LN
Sbjct:   15 WMGSLPSRLSAMPLKCLAVPGSHDSFTFWVDVHAPVAPDQKAYVKYLATMFSVLAKKVMVKWSMTQNLTFREQLDAGIRYFDLRVSSKPGELGNEIYFIHGLFGHKVRDGLLEINTFLTRHRKEVVFLDFNHYYAMEAEHHVHLISMLQQVFGSKLCKNCAVESITLDYMWEKKYQVIVFYHHPSAQSIPVMWPGNKIPAPWANTTEPNKLIQFLEMTLKERAKQGSFHVTQAILTPTVNTVAKGLVWGLRSYLVERNLPTIMSWIESQKPGVDGVNIITSDFVELTDFANVVIKLN 311          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Medaka
Match: si:dkey-66a8.7 (PI-PLC X domain-containing protein 1 [Source:NCBI gene;Acc:101170419])

HSP 1 Score: 132.494 bits (332), Expect = 1.197e-34
Identity = 90/299 (30.10%), Postives = 150/299 (50.17%), Query Frame = 1
Query:  298 WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFD-NNEIYSCHSLFAG-QIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIPSLKDMWKSNHQVIVFYHCDNIHK-PFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIV--DFADSFDYVPSVLRLN 1179
            WMS LP+ L  +P+N +AIPGSHD+ +Y +   S +     D  +   RLF    +  I +WA TQD     QL+ GIRYFD+R A    D ++++Y  H ++    + + L S+  +L  + +EVV+L   +F       H      L+ +F  KL P  E   SL+ +WKS +QVI+ Y    I + P LWP   IP  W  ++    ++ +L  +  +G   + F+++   LT   +    +  ESL+++  +  +    KW++++  G G  + +I+  DF         V+ LN
Sbjct:    8 WMSALPEQLWDIPLNQLAIPGSHDAMSYCLDITSPLVRSESDCFRLLDRLFYCFTRPFIFKWATTQDKTIEEQLSMGIRYFDLRIAHKPQDSSSDLYFTHVIYTHVTVLETLQSVAAWLKLHPKEVVILACSHFEGIDDRFHESFIVCLKNLFGSKLCPREESDLSLRSLWKSGYQVILSYESQLIARHPELWPA--IPYWWANSNTAQGVISYLEWHKDQGR-PESFFVSGLNLTAARSYITKNPKESLRTLTFRNWS-CERKWVQEQVPGSGSTSLNIIAGDFVGPLPLCSLVIELN 302          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Medaka
Match: plcxd1 (PI-PLC X domain-containing protein 1 [Source:NCBI gene;Acc:101168615])

HSP 1 Score: 124.79 bits (312), Expect = 1.030e-31
Identity = 89/305 (29.18%), Postives = 148/305 (48.52%), Query Frame = 1
Query:  286 PLNAWMSNLPDSLTTLPMNWIAIPGSHDSFTYSI--TSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFDNN-EIYSCHSLFAG-QIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIPSLKDMWKSNHQVIVFY-HCDNIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIG--KGKINCSIVDFADSFDYVPSVLRLN 1179
            P+  WMS+LP +L  +P+  +AIPGSH++ TY +     S V P   D+++   +    L +  + +W+ TQ+     QL+ G+RY D+R A    D++ ++Y  H ++    ++  L+ I ++LD++ +EVV+L   +F   ++  H +L   + +IFS KL P  E + +L+ +W   +QVIV Y H        LWP   IP  W        ++       ++G     F      LT        H  ESLK ++     P    WL ++  G   G +N    DF     +VP+V+ LN
Sbjct:   18 PMEGWMSHLPCALWDIPLYHLAIPGSHNAITYCLDMNDRSPVDPMQPDMLQKLDKYMKPLIRPFVYKWSITQEYTIKQQLDCGVRYCDLRIAHRPNDSSTDLYFYHGVYTTLTVETVLMEINEWLDAHPKEVVILSFSHFLGLSQELHVQLITTIRSIFSAKLCPEMEEL-TLRKLWTLGYQVIVSYEHSIVSSHSDLWPH--IPYWWANKCKAEALIEEFERRKQQGRPGGLFVTGIN-LTEDLKYICTHPTESLKDVVL-STYPTLLSWLREQTPGFRVGSLNIIAGDFVTESHFVPTVVSLN 317          
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Medaka
Match: ENSORLT00000036242.1 (PI-PLC X domain-containing protein 1 [Source:NCBI gene;Acc:101161710])

HSP 1 Score: 115.161 bits (287), Expect = 3.019e-28
Identity = 81/289 (28.03%), Postives = 142/289 (49.13%), Query Frame = 1
Query:  298 WMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFDNNEIYSCHSLFA-GQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIPSLKDMWKSNHQVIVFYHCDN----IHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIG--KGKINCSIVDFAD 1143
            WMS LP+ L  +P+  +A+PGSHD+ ++ +   S V      +++    L     +  I RWA TQ      Q + GIR+FD+R A N   ++ ++  H ++    +K+ L  +  +L+++ +E+V++   +F   T  DH  L   +  +F+ KL   S+ +P+L+  W   +QVI+ Y  DN    +  P LW    IP  +  T N  K++ +L     +G     FY++   LT       +H  ++++  M   A P   +W ED++ G    +IN    DF +
Sbjct:   15 WMSRLPEELHDVPLWNLALPGSHDTMSFCLDISSPVLRSESFLLRLTDLLLPCCTRPCIYRWATTQQSILADQGDLGIRFFDLRIAKNPASSSNLFFAHGIYTLLTVKEALKELAMWLEAHPKEIVIISCSHFDTMTNEDHVHLVEFIHILFNLKLC-SSKNVPTLRSCWSKGYQVIISY--DNEAMLLEHPELWRA--IPYWYADTPNPKKVISYLETQKLKGRPAG-FYVSGLNLTEDATYVALHPCQTMRK-MTMDALPLLLRWTEDQQPGPEPDRINIVCCDFVN 296          
BLAST of PI-PLC X domain-containing protein 3 vs. Planmine SMEST
Match: SMESG000075551.1 (SMESG000075551.1)

HSP 1 Score: 724.546 bits (1869), Expect = 0.000e+0
Identity = 347/349 (99.43%), Postives = 348/349 (99.71%), Query Frame = 1
Query:  199 MFKKILKFGNSLDRNSWIKSQIKCCFHYYPLNAWMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFDNNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIPSLKDMWKSNHQVIVFYHCDNIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLNFNHVNVSHENLLKKGSIRSCSQ 1245
            MFKKILKFGNSLDRNSWIKSQIKCCFHYYPLNAWMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFDN+EIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIPSL DMWKSNHQVIVFYHCDNIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLNFNHVNVSHENLLKKGSIRSCSQ
Sbjct:    1 MFKKILKFGNSLDRNSWIKSQIKCCFHYYPLNAWMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFDNSEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIPSLNDMWKSNHQVIVFYHCDNIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLNFNHVNVSHENLLKKGSIRSCSQ 349          
BLAST of PI-PLC X domain-containing protein 3 vs. Planmine SMEST
Match: SMESG000075551.1 (SMESG000075551.1)

HSP 1 Score: 711.835 bits (1836), Expect = 0.000e+0
Identity = 343/349 (98.28%), Postives = 344/349 (98.57%), Query Frame = 1
Query:  199 MFKKILKFGNSLDRNSWIKSQIKCCFHYYPLNAWMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFDNNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIPSLKDMWKSNHQVIVFYHCDNIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLNFNHVNVSHENLLKKGSIRSCSQ 1245
            MFKKILKFGNSLDRNSWIKSQIKCCFHYYPLNAWMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFDN+EIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIPSL DMWKSNHQVIVFYHCDNIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLNFNH    HENLLKKGSIRSCSQ
Sbjct:    1 MFKKILKFGNSLDRNSWIKSQIKCCFHYYPLNAWMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFDNSEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIPSLNDMWKSNHQVIVFYHCDNIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLNFNH----HENLLKKGSIRSCSQ 345          
BLAST of PI-PLC X domain-containing protein 3 vs. Planmine SMEST
Match: SMESG000075551.1 (SMESG000075551.1)

HSP 1 Score: 640.188 bits (1650), Expect = 0.000e+0
Identity = 309/315 (98.10%), Postives = 310/315 (98.41%), Query Frame = 1
Query:  301 MSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFDNNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIPSLKDMWKSNHQVIVFYHCDNIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLNFNHVNVSHENLLKKGSIRSCSQ 1245
            MSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFDN+EIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIPSL DMWKSNHQVIVFYHCDNIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLNFNH    HENLLKKGSIRSCSQ
Sbjct:    1 MSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFDNSEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIPSLNDMWKSNHQVIVFYHCDNIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLNFNH----HENLLKKGSIRSCSQ 311          
BLAST of PI-PLC X domain-containing protein 3 vs. Planmine SMEST
Match: SMESG000060459.1 (SMESG000060459.1)

HSP 1 Score: 397.512 bits (1020), Expect = 6.733e-137
Identity = 183/302 (60.60%), Postives = 235/302 (77.81%), Query Frame = 1
Query:  274 FHYYPLNAWMSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFDNNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIPSLKDMWKSNHQVIVFYHCDNIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYKEGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLN 1179
            F  +P N WMSNLP++LT LP+N+IAIPG+HDSFT+SITS S VAPDAEDIIK  T LFG LAK +IARW+KTQDL+  GQL++GIRYFD+R A N  D +EIYSCHSLFA  IK D L+I+ FLD + +EVVL+D+ +FY F  ++HY+L   LET+F  KL PY+  IPSL D+WK+  +V VFYH +++ +P+LWPGY IPSPW  TD L K++ +L++NYK     DYFY++QGVLTPT    + H+  SLKS+MA K+TPAF KWL+DK  GKGK+NCSIVDFA++ DYVPS+++LN
Sbjct:    5 FKDHPYNEWMSNLPETLTILPLNYIAIPGTHDSFTHSITSSSSVAPDAEDIIKKLTSLFGSLAKSIIARWSKTQDLNTFGQLDSGIRYFDVRVAKNSKDKDEIYSCHSLFAYPIKTDFLNIKDFLDVHPKEVVLIDINHFYNFGMNEHYRLLRHLETVFGNKLVPYTYQIPSLDDIWKTKGRVFVFYHSNDVQRPYLWPGYFIPSPWANTDELSKLMTYLTENYKRDRPSDYFYVSQGVLTPTAGDIVKHVFSSLKSVMANKSTPAFIKWLDDKAAGKGKVNCSIVDFAENVDYVPSMMQLN 306          
BLAST of PI-PLC X domain-containing protein 3 vs. Planmine SMEST
Match: SMESG000037587.1 (SMESG000037587.1)

HSP 1 Score: 248.825 bits (634), Expect = 3.874e-79
Identity = 129/295 (43.73%), Postives = 181/295 (61.36%), Query Frame = 1
Query:  301 MSNLPDSLTTLPMNWIAIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQDLDPHGQLNAGIRYFDIRTAINKFDNNEIYSCHSLFAGQIKKDLLSIRKFLDSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIPSLKDMWKSNHQVIVFYHCDNIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYK-EGHFQDYFYINQGVLTPTPAAYLIHMME-SLKSIMAKKATPAFGKWLEDKEIGKGKINCSIVDFADSFDYVPSVLRLN 1179
            M NLP++L  LP+  +AIPGSHDSFTYSI   S ++PDA+ II    +LFG  AK ++ RWA TQDL+   QL  GIRYFDIR A N+  N  IY+CHSL+   I  DL  I++FL    +E+V LD  ++Y F+K +H    NIL+ +F   L  +   +PSL  +W+ N +V +FY  +   K ++WPG  IPSPW  TDN+  ++ FL  NYK   H  D FY+ QG+LTPT    + H+   +L++ +AKK  P F +WL     G    NC I++F +  D+V +++ LN
Sbjct:    1 MENLPNTLIKLPICDLAIPGSHDSFTYSIKRSSDISPDADAIIIYLIKLFGRYAKSLVYRWAVTQDLNTLEQLEKGIRYFDIRLAFNE-KNGIIYTCHSLYGQPILNDLKIIKEFLQINTKEIVFLDFNHYYNFSKMEHLLFLNILQDVFGDLLVTFFYPLPSLLKLWEINQRVFIFYRFECNGKNWIWPGDFIPSPWGNTDNVNCLIVFLDLNYKNRRHEVDRFYVTQGILTPTAKTIIKHLFTGNLRNTLAKKLAPKFMRWLSTTCCGPCNTNCVIINFFNDTDFVSNIIDLN 294          
The following BLAST results are available for this feature:
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLCXD31.435e-7337.09phosphatidylinositol specific phospholipase C X do... [more]
PLCXD31.435e-7337.09phosphatidylinositol specific phospholipase C X do... [more]
PLCXD22.489e-6033.93phosphatidylinositol specific phospholipase C X do... [more]
PLCXD21.238e-5134.46phosphatidylinositol specific phospholipase C X do... [more]
PLCXD22.442e-5134.69phosphatidylinositol specific phospholipase C X do... [more]
back to top
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
F38E9.12.058e-1725.91pep chromosome:WBcel235:X:16471058:16474819:1 gene... [more]
back to top
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG107472.929e-4635.49gene:FBgn0032845 transcript:FBtr0081341[more]
CG107472.929e-4635.49gene:FBgn0032845 transcript:FBtr0331618[more]
CG149451.947e-824.51gene:FBgn0032402 transcript:FBtr0080295[more]
CG149451.947e-824.51gene:FBgn0032402 transcript:FBtr0080294[more]
back to top
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plcxd32.678e-7136.45phosphatidylinositol-specific phospholipase C, X d... [more]
plcxd22.734e-5632.43phosphatidylinositol-specific phospholipase C, X d... [more]
plcxd21.273e-4132.64phosphatidylinositol-specific phospholipase C, X d... [more]
zgc:640658.698e-4032.34zgc:64065 [Source:ZFIN;Acc:ZDB-GENE-040426-1355][more]
zgc:1120232.451e-3429.41zgc:112023 [Source:NCBI gene;Acc:550368][more]
back to top
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
PLCXD35.328e-7136.12phosphatidylinositol-specific phospholipase C, X d... [more]
PLCXD23.725e-5634.45phosphatidylinositol-specific phospholipase C, X d... [more]
sncg5.653e-3732.33synuclein gamma [Source:Xenbase;Acc:XB-GENE-973674... [more]
back to top
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plcxd32.153e-7337.12phosphatidylinositol-specific phospholipase C, X d... [more]
Plcxd25.538e-5832.74phosphatidylinositol-specific phospholipase C, X d... [more]
Plcxd14.395e-3429.67phosphatidylinositol-specific phospholipase C, X d... [more]
Plcxd11.983e-1336.05phosphatidylinositol-specific phospholipase C, X d... [more]
Plcxd12.757e-1336.05phosphatidylinositol-specific phospholipase C, X d... [more]
back to top
BLAST of PI-PLC X domain-containing protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q63HM9|PLCX3_HUMAN6.890e-7337.09PI-PLC X domain-containing protein 3 OS=Homo sapie... [more]
sp|Q8BLJ3|PLCX3_MOUSE1.046e-7237.12PI-PLC X domain-containing protein 3 OS=Mus muscul... [more]
sp|A6QNU9|PLCX3_BOVIN4.209e-7236.79PI-PLC X domain-containing protein 3 OS=Bos taurus... [more]
sp|Q58EK3|PLCX3_DANRE2.022e-7036.45PI-PLC X domain-containing protein 3 OS=Danio reri... [more]
sp|B2RXA1|PLCX2_MOUSE3.874e-5732.74PI-PLC X domain-containing protein 2 OS=Mus muscul... [more]
back to top
BLAST of PI-PLC X domain-containing protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S2ZDE29.228e-7238.13PI-PLC X domain-containing protein 3 OS=Erinaceus ... [more]
A0A2I3GGC52.320e-7137.42Phosphatidylinositol specific phospholipase C X do... [more]
F7BFZ25.696e-7137.79Phosphatidylinositol specific phospholipase C X do... [more]
W5UEI51.093e-7037.46PI-PLC X domain-containing protein 3 OS=Ictalurus ... [more]
A0A5F5XMC81.121e-7037.46Phosphatidylinositol specific phospholipase C X do... [more]
back to top
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plcxd35.513e-7136.12phosphatidylinositol specific phospholipase C X do... [more]
plcxd28.332e-6033.00PI-PLC X domain-containing protein 2-like [Source:... [more]
plcxd28.856e-5332.73PI-PLC X domain-containing protein 2-like [Source:... [more]
plcxd11.871e-2927.64phosphatidylinositol-specific phospholipase C, X d... [more]
zgc:1120232.007e-2729.17PI-PLC X domain-containing protein 1-like [Source:... [more]
back to top
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zgc:1120238.855e-1631.86zgc:112023 [Source:NCBI gene;Acc:550368][more]
back to top
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO435421.135e-5033.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434347.257e-4932.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447492.544e-1331.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PI-PLC X domain-containing protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plcxd31.182e-6733.77phosphatidylinositol specific phospholipase C X do... [more]
plcxd26.608e-6436.03PI-PLC X domain-containing protein 2 [Source:NCBI ... [more]
si:dkey-66a8.71.197e-3430.10PI-PLC X domain-containing protein 1 [Source:NCBI ... [more]
plcxd11.030e-3129.18PI-PLC X domain-containing protein 1 [Source:NCBI ... [more]
ENSORLT00000036242.13.019e-2828.03PI-PLC X domain-containing protein 1 [Source:NCBI ... [more]
back to top
BLAST of PI-PLC X domain-containing protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075551.10.000e+099.43SMESG000075551.1[more]
SMESG000075551.10.000e+098.28SMESG000075551.1[more]
SMESG000075551.10.000e+098.10SMESG000075551.1[more]
SMESG000060459.16.733e-13760.60SMESG000060459.1[more]
SMESG000037587.13.874e-7943.73SMESG000037587.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008425 ID=SMED30008425|Name=PI-PLC X domain-containing protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1424bp
TCCGATCTCACACACAAGCATAGTACACACAGGCATTGTATGCAATTGTA
TGCAATTAATCTTTGTCACGTGAATCAATAATTGATTTGATGAAATTTAA
AATAGCGATTGTTAATATTTTTTAGAAATTTAAGATCAATTTTGTATGAC
TTATTAATAATTTGTTCATATAAATATTATTCAAATATACGTTTAAGGAT
GTTTAAAAAAATTCTAAAATTTGGAAATTCCCTTGACAGAAATTCATGGA
TTAAATCTCAAATCAAATGCTGTTTTCATTATTATCCCTTAAATGCGTGG
ATGTCGAATCTTCCAGACAGTTTGACAACCTTGCCAATGAATTGGATTGC
CATTCCAGGAAGTCACGACTCATTTACTTATAGTATAACATCCTGTTCAC
AAGTGGCTCCGGATGCAGAGGATATTATTAAGAATTTTACTCGTTTATTT
GGTGGTTTGGCGAAAAGGGTAATTGCCCGCTGGGCTAAAACACAAGACTT
AGATCCCCATGGTCAACTAAATGCGGGAATCAGATATTTTGACATCCGTA
CCGCAATCAATAAATTTGACAATAACGAGATTTATTCCTGTCACAGTCTT
TTTGCTGGACAAATCAAAAAGGATTTGTTGAGTATAAGGAAATTCCTCGA
TTCCTATGAAAGAGAGGTGGTTCTTTTAGATCTGAAGAACTTCTATGAGT
TTACTAAGCATGACCATTACAAATTAGCAAATATTCTAGAAACAATATTT
TCTTACAAACTGGCGCCATATTCGGAAATCATTCCAAGTCTCAAGGATAT
GTGGAAATCCAATCATCAAGTCATAGTATTCTATCATTGTGACAACATCC
ACAAACCATTTCTATGGCCTGGATATATGATTCCATCTCCTTGGCCTCAG
ACGGATAACCTTGGGAAAATGTTGCACTTTCTTTCAGACAATTATAAGGA
AGGTCATTTTCAAGACTATTTCTATATTAATCAGGGAGTATTGACCCCGA
CACCAGCGGCCTATCTAATACACATGATGGAATCTCTCAAATCTATTATG
GCCAAAAAAGCCACTCCAGCCTTCGGGAAATGGTTGGAAGACAAAGAGAT
TGGAAAAGGCAAAATTAATTGCTCAATAGTTGATTTTGCTGACAGTTTTG
ATTACGTTCCATCAGTGTTGAGGCTCAACTTCAATCACGTAAATGTTTCG
CACGAGAATTTATTGAAAAAGGGCTCAATCAGATCCTGTAGTCAATAAAA
ATTTGAATCGATTTGTGATTATGATAAAATATTTATTTTGTATTTATTAT
ATTTAAACCAGACATGCTCAAAGCAGTGGATCATTTTCATTGACAAAATA
CTTCTGATTTGTTTCTGATTTGTACACTTCGATTCACAGAGGGAAAAATA
ATAAAATGAATATTTCAAAAAAAA
back to top

protein sequence of SMED30008425-orf-1

>SMED30008425-orf-1 ID=SMED30008425-orf-1|Name=SMED30008425-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=350bp
MFKKILKFGNSLDRNSWIKSQIKCCFHYYPLNAWMSNLPDSLTTLPMNWI
AIPGSHDSFTYSITSCSQVAPDAEDIIKNFTRLFGGLAKRVIARWAKTQD
LDPHGQLNAGIRYFDIRTAINKFDNNEIYSCHSLFAGQIKKDLLSIRKFL
DSYEREVVLLDLKNFYEFTKHDHYKLANILETIFSYKLAPYSEIIPSLKD
MWKSNHQVIVFYHCDNIHKPFLWPGYMIPSPWPQTDNLGKMLHFLSDNYK
EGHFQDYFYINQGVLTPTPAAYLIHMMESLKSIMAKKATPAFGKWLEDKE
IGKGKINCSIVDFADSFDYVPSVLRLNFNHVNVSHENLLKKGSIRSCSQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000909PLipase_C_PInositol-sp_X_dom
IPR017946PLC-like_Pdiesterase_TIM-brl
Vocabulary: molecular function
TermDefinition
GO:0008081phosphoric diester hydrolase activity
GO:0003674molecular_function
GO:0004871signal transducer activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006629lipid metabolic process
GO:0007165signal transduction
GO:0016042lipid catabolic process
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000909Phosphatidylinositol-specific phospholipase C, X domainSMARTSM00148plcx_3coord: 41..213
e-value: 0.0044
score: -39.5
IPR017946PLC-like phosphodiesterase, TIM beta/alpha-barrel domain superfamilyGENE3DG3DSA:3.20.20.190coord: 27..331
e-value: 2.1E-28
score: 101.5
IPR017946PLC-like phosphodiesterase, TIM beta/alpha-barrel domain superfamilySUPERFAMILYSSF51695PLC-like phosphodiesterasescoord: 31..328
NoneNo IPR availablePANTHERPTHR13593:SF32PI-PLC X DOMAIN-CONTAINING PROTEIN 2coord: 32..331
NoneNo IPR availablePANTHERPTHR13593UNCHARACTERIZEDcoord: 32..331