SMED30008407
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30008407 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 3
Alignments
SMED30008407 aligns in the following genomic locations:
Homology
BLAST of SMED30008407 vs. Planmine SMEST
Match: SMESG000044531.1 (SMESG000044531.1) HSP 1 Score: 165.236 bits (417), Expect = 5.009e-49 Identity = 81/81 (100.00%), Postives = 81/81 (100.00%), Query Frame = 2 Query: 1079 ARDFSMKNWNLLTFQYVGVLASVSGSFGEQFSEDLKAQKRTGSRGSRSQWTTLIGNSVSVPRTLSTLIKSSWRNYAHSSQF 1321 ARDFSMKNWNLLTFQYVGVLASVSGSFGEQFSEDLKAQKRTGSRGSRSQWTTLIGNSVSVPRTLSTLIKSSWRNYAHSSQF Sbjct: 6 ARDFSMKNWNLLTFQYVGVLASVSGSFGEQFSEDLKAQKRTGSRGSRSQWTTLIGNSVSVPRTLSTLIKSSWRNYAHSSQF 86
BLAST of SMED30008407 vs. Planmine SMEST
Match: SMESG000043786.1 (SMESG000043786.1) HSP 1 Score: 62.3882 bits (150), Expect = 4.126e-11 Identity = 25/35 (71.43%), Postives = 30/35 (85.71%), Query Frame = -1 Query: 3 DFSHSEKPRSMTYTPTHVADRWRWAWERFRQEKCP 107 + SHSEKP MTY TH+ADRWRWAWE+F+QE+CP Sbjct: 2 NLSHSEKPSPMTYVSTHIADRWRWAWEQFQQERCP 36
BLAST of SMED30008407 vs. Planmine SMEST
Match: SMESG000071285.1 (SMESG000071285.1) HSP 1 Score: 58.9214 bits (141), Expect = 3.647e-10 Identity = 25/32 (78.12%), Postives = 28/32 (87.50%), Query Frame = -1 Query: 3 HSEKPRSMTYTPTHVADRWRWAWERFRQEKCP 98 +SEKP S +Y P H+ADRWRWAWERFRQEKCP Sbjct: 7 YSEKPDSRSYVPIHMADRWRWAWERFRQEKCP 38
BLAST of SMED30008407 vs. Planmine SMEST
Match: SMESG000018906.1 (SMESG000018906.1) HSP 1 Score: 58.9214 bits (141), Expect = 3.923e-10 Identity = 24/34 (70.59%), Postives = 29/34 (85.29%), Query Frame = -1 Query: 3 FSHSEKPRSMTYTPTHVADRWRWAWERFRQEKCP 104 +SE+ SM YTPTH+ADRWRWAWE+FRQE+CP Sbjct: 3 LPNSERSSSMAYTPTHIADRWRWAWEQFRQERCP 36
BLAST of SMED30008407 vs. Planmine SMEST
Match: SMESG000047003.1 (SMESG000047003.1) HSP 1 Score: 57.3806 bits (137), Expect = 1.485e-9 Identity = 25/34 (73.53%), Postives = 28/34 (82.35%), Query Frame = -1 Query: 3 FSHSEKPRSMTYTPTHVADRWRWAWERFRQEKCP 104 +S + SMTYTPTHVADRWRWAWE+FRQE CP Sbjct: 3 LPYSGRSSSMTYTPTHVADRWRWAWEQFRQEICP 36 The following BLAST results are available for this feature:
BLAST of SMED30008407 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30008407 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30008407 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30008407 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30008407 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30008407 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30008407 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30008407 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 0
BLAST of SMED30008407 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30008407 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30008407 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30008407 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30008407 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30008407 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 5
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30008407 ID=SMED30008407|Name=SMED30008407|organism=Schmidtea mediterranea sexual|type=transcript|length=1613bpback to top protein sequence of SMED30008407-orf-1 >SMED30008407-orf-1 ID=SMED30008407-orf-1|Name=SMED30008407-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=123bp MKNWNLLTFQYVGVLASVSGSFGEQFSEDLKAQKRTGSRGSRSQWTTLIGback to top Annotated Terms
The following terms have been associated with this transcript:
|