Cytochrome P450 2K1-like protein

Overview
NameCytochrome P450 2K1-like protein
Smed IDSMED30008390
Length (bp)1550
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008390

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30008390SMESG000072689.1 SmedASXL_005943SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30008390SMESG000072689.1 dd_Smed_v6_18131_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2B6 (cytochrome P450 family 2 subfamily B member 6 [Source:HGNC Symbol;Acc:HGNC:2615])

HSP 1 Score: 188.348 bits (477), Expect = 5.662e-53
Identity = 139/443 (31.38%), Postives = 224/443 (50.56%), Query Frame = 2
Query:  182 KHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMH------KCVTSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFN-RDNPIFTFLSKMSLEFAERADIFQFIFFTLPIFDK-LPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVSLK 1486
            K+G +F + +G R + +L   + IR+A V+    F+GR K+          G++  +G+ W + + F +  M       + V   +  QEE  CL+EEL      +++ + + +  T NII   V  KRF+ +D      L+     F+  + +F  +F     F K  PG  R +       +  ++        +E+HR+ LD  S  +DLID +L+   + KS   S  S  ++ L  ++L LF AG ETTST L + FL M +Y  + E VY+EI   IG  R P + DR ++ YT+AV+ E+ R S + P+ + H V    +  GY IPKD+ V   +     DP+ +E+   F P HFL  DA G +K    +    F +GKR C+GE +AR E F+FFT+++Q F +  A+ V   + D   + C G+ + P + +
Sbjct:   61 KYGDVFTVHLGPRPVVMLCGVEAIREALVDKAEAFSGRGKIAMVDPFFRGYGVIFANGNRWKVLRRFSVTTMRDFGMGKRSVE--ERIQEEAQCLIEELRKSKGALMDPTFLFQSITANIICSIVFGKRFHYQDQEFLKMLNLFYQTFSLISSVFGQLFELFSGFLKYFPGAHRQVY------KNLQEINAYIGHSVEKHRETLD-PSAPKDLIDTYLLHMEKEKSNAHSEFSHQNLNL--NTLSLFFAGTETTSTTLRYGFLLMLKYPHVAERVYREIEQVIGPHRPPELHDRAKMPYTEAVIYEIQRFSDLLPMGVPHIVTQHTSFRGYIIPKDTEVFLILSTALHDPHYFEKPDAFNPDHFL--DANGALK--KTEAFIPFSLGKRICLGEGIARAELFLFFTTILQNFSM--ASPVAPEDIDLTPQEC-GVGKIPPTYQ 485          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2J2 (cytochrome P450 family 2 subfamily J member 2 [Source:HGNC Symbol;Acc:HGNC:2634])

HSP 1 Score: 184.882 bits (468), Expect = 1.237e-51
Identity = 138/440 (31.36%), Postives = 207/440 (47.05%), Query Frame = 2
Query:  179 RKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKC----VTSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKM--SLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVS 1480
            +K+G LF + +G     ++     I++A +    NF  R        +   +GL+   G  W   + F L  +        +  +  QEE   L E ++  N +  +    I     NII      +RF   +  F  L K+   + + E +   Q       I   LPG  + L         ++K +      I++HRK  +  +E  D ID +L  +   K T     SF +  LI S+L+LF AG ETTST L W+ L+MA Y +IQE V  EI   IG+ + P+   R+ + YT AV+ EV R+ +I PL +   V  D  + GY +PK +++ +N+   H DP  W     F P HFL+     N ++  ++    F IGKR C+GE LAR E FIFFTS+MQ+F     N  NE     +++   GI  SPVS
Sbjct:   73 KKYGNLFSLELGDISAVLITGLPLIKEALIHMDQNFGNRPVTPMREHIFKKNGLIMSSGQAWKEQRRFTLTALRNFGLGKKSLEERIQEEAQHLTEAIKEENGQPFDPHFKINNAVSNIICSITFGERFEYQDSWFQQLLKLLDEVTYLEASKTCQLYNVFPWIMKFLPGPHQTLFS------NWKKLKLFVSHMIDKHRKDWN-PAETRDFIDAYL--KEMSKHTGNPTSSFHEENLICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQPSTAARESMPYTNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDTFNPDHFLE-----NGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPN--NE---KLSLKFRMGITISPVS 493          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2U1 (cytochrome P450 family 2 subfamily U member 1 [Source:HGNC Symbol;Acc:HGNC:20582])

HSP 1 Score: 181.8 bits (460), Expect = 3.638e-50
Identity = 135/451 (29.93%), Postives = 220/451 (48.78%), Query Frame = 2
Query:  173 LARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLV-SIDGDLWHMHKAFV-----------LNVMHKCVTSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFT----FLSKMSLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEI-EEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSP 1474
            LAR +G +F   IG   + VL+++ ++R+A V+    F+ R ++    +VT   G+V +  G +W   + F            L++  K +  F   + E            +       +I     NII      +RF+  N  F     F+S+  LE    + +         + +  P +  L        R+  K    F ++I ++H++ LD ++  +D ID +L+   + +    S  SF +  L     +LFIAG +TT+  L W  L+M+   D+QE V++EI   IG  R P++ D+ Q+ YT+A + EV RL+ + PLAI H    +  + GY IPK +L+  N+W  H DP +WE+ ++FYP+ FL  D    IK   K+    FGIGKR C+GE LA+ME F+ F S+MQ    +FA ++ E      + G  G+  +P
Sbjct:  110 LARVYGSIFSFFIGHYLVVVLSDFHSVREALVQQAEVFSDRPRVPLISIVTKEKGVVFAHYGPVWRQQRKFSHSTLRHFGLGKLSLEPKIIEEFKYVKAEMQKH-------GEDPFCPFSIISNAVSNIICSLCFGQRFDYTNSEFKKMLGFMSR-GLEICLNSQVL--------LVNICPWLYYLPFGPFKELRQIEKDITSFLKKIIKDHQESLDRENP-QDFIDMYLLHMEE-ERKNNSNSSFDEEYLFYIIGDLFIAGTDTTTNSLLWCLLYMSLNPDVQEKVHEEIERVIGANRAPSLTDKAQMPYTEATIMEVQRLTVVVPLAIPHMTSENTVLQGYTIPKGTLILPNLWSVHRDPAIWEKPEDFYPNRFLD-DQGQLIK---KETFIPFGIGKRVCMGEQLAKMELFLMFVSLMQ----SFAFALPEDSKKPLLTGRFGLTLAP 534          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP1A2 (cytochrome P450 family 1 subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:2596])

HSP 1 Score: 180.259 bits (456), Expect = 7.295e-50
Identity = 123/431 (28.54%), Postives = 203/431 (47.10%), Query Frame = 2
Query:  170 KLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLV-SID-GDLWHMHKAFVLNVMHKCVTSFDNTQXXXXXXXXXXXXXNKKVIN-LSEVIR------------VYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSV 1417
            ++++++G + ++RIG   + VL+  DTIR+A V  G++F GR  L+ + ++T+   L  S D G +W   +    N ++    + D        L E +    K +I+ L E++             V   N+I      + F   +     L K + EF E A     + F  PI   LP     L  F    ++F       Q+ ++EH +  D +S   D+       +H  K    S       +++    ++F AGF+T +T + WS +++    +IQ  + KE+   IG+ER P + DR QL Y +A + E +R SS  P  I H    D  ++G++IPK   V  N W  + DP +WE   EF P  FL  D    I     +++  FG+GKR+CIGE LA+ E F+F   ++Q+ + +    V
Sbjct:   67 RMSQRYGDVLQIRIGSTPVLVLSRLDTIRQALVRQGDDFKGRPDLYTSTLITDGQSLTFSTDSGPVWAARRRLAQNALNTFSIASDPASSSSCYLEEHVSKEAKALISRLQELMAGPGHFDPYNQVVVSVANVIGAMCFGQHFPESSDEMLSLVKNTHEFVETASSGNPLDF-FPILRYLPNPA--LQRFKAFNQRFLW---FLQKTVQEHYQDFDKNSV-RDITGALF--KHSKKGPRASGNLIPQEKIVNLVNDIFGAGFDTVTTAISWSLMYLVTKPEIQRKIQKELDTVIGRERRPRLSDRPQLPYLEAFILETFRHSSFLPFTIPHSTTRDTTLNGFYIPKKCCVFVNQWQVNHDPELWEDPSEFRPERFLTADGTA-INKPLSEKMMLFGMGKRRCIGEVLAKWEIFLFLAILLQQLEFSVPPGV 487          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2F1 (cytochrome P450 family 2 subfamily F member 1 [Source:HGNC Symbol;Acc:HGNC:2632])

HSP 1 Score: 178.333 bits (451), Expect = 2.517e-49
Identity = 123/446 (27.58%), Postives = 210/446 (47.09%), Query Frame = 2
Query:  170 KLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSFDNTQXXXXXXXXXXXXXNKKV----INLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSK--------MSLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRS 1471
            KL++++G ++ + +G R + VL+ Y  +++A V+ G  F+GR         T  +G+    GD W + + F + ++        + +E  L     L +  +K      + + V+     NII   +   RF+ D+     + +        MS  + E  DIF        + D +PG  + +       + F+  +++    + +H+  LD  S   D I CFL K  + K     +  F    L+ ++  L   G +T ST L  +FL + +Y  +Q  V +EI   +G+ RLP +KDR  + YT AV+ EV R + I P+ + HRV  D    G+ IPK + V + +   H DP+ +   +EF P HFL  DA  + K  P      F  G+R C+GESLARME F++ T+++Q F +    +  +++      G   + R 
Sbjct:   57 KLSKEYGSMYTVHLGPRRVVVLSGYQAVKEALVDQGEEFSGRGDYPAFFNFTKGNGIAFSSGDRWKVLRQFSIQILRNFGMGKRSIEERILEEGSFLLAELRKTEGEPFDPTFVLSRSVSNIICSVLFGSRFDYDDERLLTIIRLINDNFQIMSSPWGELYDIFP------SLLDWVPGPHQRIF------QNFKCLRDLIAHSVHDHQASLDPRSP-RDFIQCFLTKMAEEKED--PLSHFHMDTLLMTTHNLLFGGTKTVSTTLHHAFLALMKYPKVQARVQEEIDLVVGRARLPALKDRAAMPYTDAVIHEVQRFADIIPMNLPHRVTRDTAFRGFLIPKGTDVITLLNTVHYDPSQFLTPQEFNPEHFL--DANQSFKKSPA--FMPFSAGRRLCLGESLARMELFLYLTAILQSFSLQPLGAPEDIDLTPLSSGLGNLPRP 483          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-23A1 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q27465])

HSP 1 Score: 182.57 bits (462), Expect = 5.008e-51
Identity = 140/468 (29.91%), Postives = 237/468 (50.64%), Query Frame = 2
Query:  164 YEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQA-LVVTNNSGLVSIDGDLWHMHKAFVLNVMHKC--------------VTSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERA-DIFQFI---FFTLPIFDKLP---GICRLLIDFTDRGRKFRKAQNIFQEEIEEHR---KRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFAN----------SVNEVEFDSAI--RGCD 1456
            ++   +++G +F + IG   + ++++  TI+K F+++ ++F+ RW+ F    ++  ++G+V IDG+ W   + F L+ +                 VTS  N        +E+   L+ K ++L   I V   NII+  +   RFN+DN   +++ ++     +++  + Q I   +   P+  K+P   G    L+   +   +F + Q      IE HR   K   ++ E EDL   ++I+  + K     VG F D QL    L+LF AG ETT T L+W+FL MA+   +Q+NV  E+ D IG+  +  ++ R +L Y QA ++E+ R+++I P+ ++  V  D  IDGY   K  L+   I     DP ++E  +EF P  FL  D   N+K     E   F IG+RQC+GESLAR E ++ F +++Q F+   A+          +V+ VE+   I  RG D
Sbjct:   82 FQSWKQQYGGIFTVWIGPIPLVMVSDLPTIKKYFIQHADSFSNRWRNFVTDSIMEGSNGIVQIDGNKWREQRRFALHTLRDFGVGKPLMEQMITLEVTSLMN-------HMEKSCGLDGKELHLCPSIAVCVGNIINNMLFGLRFNQDN---SYMHRLHQLLDDQSHTVMQPIMGAYIAFPVTSKIPIINGEWNRLMGIKNELLEFLETQ------IEGHRMNWKDEMIEQEPEDLTYAYMIEVEKRKRNGEDVGFFDDQQLKMLLLDLFFAGMETTVTTLKWAFLLMAKNQKVQKNVQAEL-DSIGQPMI-EIQHRTRLPYVQATINEIQRIANILPINLLRTVAEDIEIDGYNFKKGDLIIPQISILMNDPEIFENPEEFNPSRFLDED--NNVK--KIDEFLPFSIGRRQCLGESLARAELYLVFANLIQNFNFEVADDVTTERVLGLTVSPVEYSCKITRRGLD 527          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-33D1 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:O45659])

HSP 1 Score: 173.326 bits (438), Expect = 7.372e-48
Identity = 129/440 (29.32%), Postives = 222/440 (50.45%), Query Frame = 2
Query:  158 DYYEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGR-WKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSFDNTQXXXXXXXXXX-XXXNKKV---INLSEVIRVYTVNIISRFVLNKRF---NRDNPIFTFLSKMSLEFAERADIFQ-FIFFTLPIFDKL-PGICRLLIDFTDRGRKFRKAQNIF-QEEIEEHRKRLDLDS-EGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSA 1441
            D + K  ++ GP+F   +  R    + +Y+ +++ FV++G+ FA +         +  N G++  +G++W  H+ F L+ +       D  QE+ L  +EE  + +N  +   I+L  V+     N+I+  + NKRF    RD   FT+L  +     + A  F+ FI F +P   K+ PG         D+ +  ++  ++F  +++EEHRK +D D+ E  D ++ +L K+ + +   G   +F + QL     +L++AG +TT+  L W F F     D+Q  + +E+   IG +RL T  D+  L Y  A ++E  R ++I P  ++H    D  I+GY + K + V + I    +D  ++     F P  F++     N K     E+  F IGKRQC+GE LARME F+FF ++  R+DV    S N  + D +
Sbjct:   47 DIFHKWKKEFGPVFTFWLADRPFIFITSYEVMKETFVKDGDTFADKQLNQIDKKKLQRNYGVLDTNGEMWREHRRFTLSQLRDLGLGKDLMQEKILLEIEEQFKDINSHLGEEIDLPSVLDRGVGNVINLTLFNKRFETNQRDE--FTYLKSLIDGLRDVASEFRYFIQFLVPWSSKIIPGPT-----LGDKTKGMKEELDVFFVKQVEEHRKEIDFDTVESYDYVEAYL-KEQKKREADGDHETFCNKQLYAMCFDLWMAGLQTTTVTLTWGFSFYLHNADVQLKIREELDRVIGNDRLITTADKNCLPYLTAFINETQRCANIIPFNLLHVATRDTVIEGYPVKKGTGVIAQIGTVMSDEQIFPDAHCFNPGRFIE-----NGKLKKVDEVIPFSIGKRQCLGEGLARMELFLFFANIFNRYDVQLDFSGNLPDLDKS 473          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-14A1 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q27506])

HSP 1 Score: 169.474 bits (428), Expect = 1.493e-46
Identity = 116/422 (27.49%), Postives = 208/422 (49.29%), Query Frame = 2
Query:  161 YYEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQA--LVVTNNSGLVSIDGDLWHMHKAFVLNVMH-----KCVTSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISR--FVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDI-QLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFD 1396
            Y++ L++ +GP F + I    I VL +Y+ I+ AFV  G+ F  R        L V +++G+++ DGD W + +   L ++      + +      +     L++     +KK +++   I++   N+I+   F  + ++       TF+  +             +    P    +P +    I + +            +EE+    K+ D +SE E+ +  ++ +  Q    TG+ G   DI  L  + L+ ++AG ETTS  L W   FM +Y ++Q+ V KEI+D +G  RLP+M D+  + YTQAV+ EV R S++ P    H+   +  I G  +P  SLV + +W    +  V+E  + F P  +L++D     K   ++ +  F IGKR C+GE LARME F+ F++++Q+++
Sbjct:   50 YFDVLSKTYGPCFTIWIPFPAI-VLTDYEHIKDAFVNQGDTFTYRAHRSPETLLPVHDHTGILASDGDHWRLQRRTSLKILRDFGLGRNLMEEQVIRSVHEMLIQLENINDKKNVDVFWPIQLCVGNVINETLFGFHYKYEDSEKFKTFVKIVDKHLRHLQGKMPLLVSAFPWLKHVPIVGD--IGYHNIKNNISSYHTFIEEEVATQVKKYDGESEPENFVHAYMQQMKQ----TGNPG--LDITNLCATVLDFWLAGMETTSNSLRWHLAFMMKYPEVQDKVRKEILDNVGTARLPSMSDKPNMPYTQAVIHEVQRCSNMIPFLGSHQCKEETEIHGNRVPAGSLVFAQLWSVMRNDTVFEDPETFNPSRYLQSDGKTFDKAVLEKTI-PFSIGKRNCVGEGLARMELFLIFSALIQKYE 461          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-33C9 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:O16482])

HSP 1 Score: 169.474 bits (428), Expect = 1.978e-46
Identity = 122/428 (28.50%), Postives = 209/428 (48.83%), Query Frame = 2
Query:  164 YEKLAR---KHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKL-FQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSFDNTQXXXXXXXXXXXXXNKKVI----NLSEVIRVYTVNIISRFVLNKRFNRDNP-----IFTFLSKMSLEFAERADIFQFIFFTLPIFDK-LPGICRLLIDFTDRGRKFRKA-QNIFQEEIEEHRKRLDLD-SEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDV 1399
            Y+  AR   K+G ++   +G R   ++++Y+ +++ F+++G  +A +  + FQ      + G+V  +G  W  H+ F ++         D  ++  +  +E++ +   K I    +L+++      N+I++ +   RF+         I  F +  S EFA  +   QF    LP     +PG   L     DR +K++K     F  +IE H+K +D +  E  D ++ FL K+ + +  +G   SF+  QL    L+L+ A   TTS  + W F +   Y D Q+ +++E+   IG ER     D+  L YT A ++E+ R +++ PL ++H    D  + GY IPK + V + I     D NV+     F P  FL  D     K    ++L  F +GKRQC+GE LARME F+F  +   R+ V
Sbjct:   48 YKAFARWTAKYGDIYTFWLGTRPYILVSSYEALKETFIKDGETYADKKPMAFQESFRGGSYGVVETNGPFWREHRRFAIHQFRDFGLGKDRMEQRIMLEVEDIFNNCDKTIGEGVDLTDIFDRAVGNVINQMLFGYRFDETRADEFRTIRAFFNFNSGEFASFSMRVQFF---LPWMGYIMPGPTIL-----DRFKKYQKGFTEFFGTQIENHKKEIDFELEENSDYVEAFL-KEQRKREASGDFESFSTKQLSNMCLDLWFAALMTTSNTMTWCFAYTLNYLDAQQKLHEELDRVIGSERHINTADKPNLPYTNAYINEIQRTANLVPLNLLHMTTRDTVLKGYNIPKGTGVVAQISTVMYDENVFPEPYIFKPERFLDDDG----KLKKVEQLVPFSVGKRQCLGEGLARMELFLFIANFFNRYRV 462          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-33A1 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q27470])

HSP 1 Score: 168.703 bits (426), Expect = 3.153e-46
Identity = 123/445 (27.64%), Postives = 219/445 (49.21%), Query Frame = 2
Query:  164 YEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGR--WKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSFDNTQXXXXXXXXXXXXXNKKV----INLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKM-SLEFAERADIFQFIFFTLPIFDKLPG-ICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLD-SEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRS 1471
            Y+   +K G ++ + +G     ++  Y  ++  FV +G+++  +  +      +   + G++  +G+ W  H+ F L+ +       +  +      +++++   KKV    +N+ E   +   NII++F+   RF +D+  F  L K+  L F  +  +  +  +T+   D LP  +  LL     R R        F E+IEEHR+ +D + S+ +D ++ F+ K+ + +   G   SF++ QL     ++++AG  TT+  + +   F     D Q  + KE+ + IG +R+ TMKD+  L YT A ++E  R +++ P+ + H V  D  + G  IPK + V   I    +DP ++E  + F P  +L  D +GN+K    +EL  F IGKR C+GE LARME F+F            ANS N  EF+    G   + R+
Sbjct:   51 YDAWTKKFGKIYTVWMGTDPAVIITGYKELKDTFVNDGHSYLDKMIYSKLNTSLRGGDYGVIDTNGNTWKEHRKFALHTLRDFGMGKEAMEASIQLEVDKIDEELKKVEGKEVNIQEHFDLAIGNIINQFLFGNRF-KDSSKFNELKKLLDLFFEVQGSLRVYFAYTV---DFLPQWMVELLTPDVSRVRD--GIYQFFDEQIEEHRQEIDFETSDSKDYVETFM-KEQKKREAEGDFASFSNEQLKNMCFDMWVAGMHTTTNTMGFLTAFALNNMDAQRKMQKELTEVIG-DRVVTMKDKLNLPYTNAFINEAQRCANLVPMNLPHAVTRDVQLLGCTIPKGTTVIHQISSVMSDPEIFEEPERFVPERYL--DESGNLK--KIEELVPFSIGKRVCLGEGLARMELFLF-----------TANSFNRYEFNCGSNGVPSLERT 472          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp18a1 (gene:FBgn0010383 transcript:FBtr0074610)

HSP 1 Score: 177.178 bits (448), Expect = 7.219e-49
Identity = 132/459 (28.76%), Postives = 223/459 (48.58%), Query Frame = 2
Query:  164 YEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGR--WKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHK-CVTSFDNTQXXXXXXXXXXX--------XXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIF---TFLSKMSLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFL--IKQHQLKSTTGSV--GSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVSLK 1486
            + +LA+++G LF  R+G +   V+++Y  IR+ F      F GR      Q L   N  G+++  G LW   + F+ + + +  +T   N +++    +            + + + +++S VI V   N+I   +++ RF+ D+P F    FL +  +          +I    P     P I           +   + Q  +Q+ I++H++  D ++   DL+D +L  I++ + + T   +  G   + QL+Q  ++LF AG ET  T L W  +FM R       V  E+   +G+ RLPT++D + L  T++ + E  R SSI PLA  H    D  ++GY IP  S V   I   H DPN+WE+ +EF P  F+ T+     K    +    FG+G+R C+G+ LARME F+FF S M  FD+    ++ E +   +++G  G   +P S K
Sbjct:   77 FMELAKQYGSLFSTRLGSQLTVVMSDYKMIRECF--RREEFTGRPDTPFMQTL---NGYGIINSTGKLWKDQRRFLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMMSTRFSIDDPKFRRFNFLIEEGMRLFGEIHTVDYI----PTMQCFPSISTAKNKI---AQNRAEMQRFYQDVIDDHKRSFDPNNI-RDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTEG----KVRKPEYFIPFGVGRRMCLGDVLARMELFLFFASFMHCFDI----ALPEGQPLPSLKGNVGATITPESFK 514          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp18a1 (gene:FBgn0010383 transcript:FBtr0074609)

HSP 1 Score: 177.178 bits (448), Expect = 7.219e-49
Identity = 132/459 (28.76%), Postives = 223/459 (48.58%), Query Frame = 2
Query:  164 YEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGR--WKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHK-CVTSFDNTQXXXXXXXXXXX--------XXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIF---TFLSKMSLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFL--IKQHQLKSTTGSV--GSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVSLK 1486
            + +LA+++G LF  R+G +   V+++Y  IR+ F      F GR      Q L   N  G+++  G LW   + F+ + + +  +T   N +++    +            + + + +++S VI V   N+I   +++ RF+ D+P F    FL +  +          +I    P     P I           +   + Q  +Q+ I++H++  D ++   DL+D +L  I++ + + T   +  G   + QL+Q  ++LF AG ET  T L W  +FM R       V  E+   +G+ RLPT++D + L  T++ + E  R SSI PLA  H    D  ++GY IP  S V   I   H DPN+WE+ +EF P  F+ T+     K    +    FG+G+R C+G+ LARME F+FF S M  FD+    ++ E +   +++G  G   +P S K
Sbjct:   77 FMELAKQYGSLFSTRLGSQLTVVMSDYKMIRECF--RREEFTGRPDTPFMQTL---NGYGIINSTGKLWKDQRRFLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMMSTRFSIDDPKFRRFNFLIEEGMRLFGEIHTVDYI----PTMQCFPSISTAKNKI---AQNRAEMQRFYQDVIDDHKRSFDPNNI-RDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTEG----KVRKPEYFIPFGVGRRMCLGDVLARMELFLFFASFMHCFDI----ALPEGQPLPSLKGNVGATITPESFK 514          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp303a1 (gene:FBgn0001992 transcript:FBtr0343812)

HSP 1 Score: 127.487 bits (319), Expect = 2.335e-31
Identity = 97/366 (26.50%), Postives = 166/366 (45.36%), Query Frame = 2
Query:  335 GLVSIDGDLWHMHKAFVL----------NVMHKCVTSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTM-KDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDV 1399
            G++  DG++W   + F+L          + M   V +      + L          +  I + ++  VY +N +   +  +R+   +P  T L +   E  +  D+   +F   P+   L  I      +       R       +EIE HR       E  DL+D +L  Q +        G F+D  L+   L++F+AG ETT+  L + F+ +    +IQE  ++EI + +G ER+P   +DR +L Y +A+  E  R+  +    I HR V D  + GY IPKD++V +   G   +P  +   + F P  +L     G++K    +  N FG G+ +C+G+ L R   F+F T+V+Q F +
Sbjct:  117 GVLLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPL---LRFIAPNFSGYNGFVESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDE---GNDEKGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYL---FDGHLKL--PEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKM 471          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp303a1 (gene:FBgn0001992 transcript:FBtr0080828)

HSP 1 Score: 127.487 bits (319), Expect = 2.335e-31
Identity = 97/366 (26.50%), Postives = 166/366 (45.36%), Query Frame = 2
Query:  335 GLVSIDGDLWHMHKAFVL----------NVMHKCVTSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTM-KDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDV 1399
            G++  DG++W   + F+L          + M   V +      + L          +  I + ++  VY +N +   +  +R+   +P  T L +   E  +  D+   +F   P+   L  I      +       R       +EIE HR       E  DL+D +L  Q +        G F+D  L+   L++F+AG ETT+  L + F+ +    +IQE  ++EI + +G ER+P   +DR +L Y +A+  E  R+  +    I HR V D  + GY IPKD++V +   G   +P  +   + F P  +L     G++K    +  N FG G+ +C+G+ L R   F+F T+V+Q F +
Sbjct:  117 GVLLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPL---LRFIAPNFSGYNGFVESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDE---GNDEKGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYL---FDGHLKL--PEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKM 471          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp305a1 (gene:FBgn0036910 transcript:FBtr0074925)

HSP 1 Score: 118.627 bits (296), Expect = 2.249e-28
Identity = 105/417 (25.18%), Postives = 186/417 (44.60%), Query Frame = 2
Query:  194 LFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLF--QALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYT------VNIISRFVLNKRFNR--DNPIFTFLSKMSLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRL--DLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGK---ERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDV 1399
            L  +++G   + V   ++ +++  V+    F GR   F  +   +    G+   DG LW+ H+ F +  M      +  +Q E    LE  E L +      + I   T      +N++   +  KR  R  D  +   L  M+     R+ +F      L  F  L  +      +    +   +    F + IEEHR++L  D      DLI  +L ++ + +S  G   +F + QL+ + L+ FIAG +TTS  +  + + +A   D+QE ++ ++   +     +  P +  R+   Y  A + EV R   I+P+    R +    + GY IPK++ +  ++   H D   W+   EF P  F+  D+AG    D  +    FG+G+R+C+G++LAR   F F   ++Q F V
Sbjct:   70 LVGLKLGREYVVVALGHEMVKE--VQLQEVFEGRPDNFFLRLRTMGTRKGITCTDGQLWYEHRHFAMKQMRN--VGYGRSQMEHHIELEAEELLGQLERTEEQPIEPVTWLAQSVLNVLWCLIAGKRIARQEDGTLRRLLDLMN----RRSKLFDICGGLLAQFPWLRHVAPDRTGYNLIQQLNTELYGFFMDTIEEHRRQLAKDPSPAESDLIYAYL-QEMKDRSAGGESSTFNETQLVMTILDFFIAGSQTTSNTINLALMVLAMRPDVQEKLFSQVTASVAAASTDAFPHLSRREAFDYMDAFIMEVQRFFHITPITGPRRALWATKLGGYDIPKNATILISLRSVHLDKEHWKDPLEFRPERFI--DSAGKCFKD--EYFMPFGMGRRRCLGDALARACIFSFLVRIVQHFSV 473          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2p10 (cytochrome P450, family 2, subfamily P, polypeptide 10 [Source:ZFIN;Acc:ZDB-GENE-040120-1])

HSP 1 Score: 198.364 bits (503), Expect = 7.280e-57
Identity = 134/417 (32.13%), Postives = 205/417 (49.16%), Query Frame = 2
Query:  164 YEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKL-FQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSFDNTQXXXXX----XXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFN-RDNPIFTFLSKMSLEFAERADIFQFIFFTLP-IFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRF 1393
            + + A K+G +F  R+    I VLN Y+ +++ + + G+N A R  L   + ++ +N GLV+  G  W   + F L  +        N +         L E + +   +  N   ++     N+I   V   RF   D+     L+K++        IF  ++   P +   LPG  + LI        +++  +  +E++ EHR   D  S   D IDCFL +  + K  T +   F    L   +L+LF+AG ETTST L W  L+M +Y +IQ  V +EI   +G  R P+  DR  + YT AV+ E+ R+ +I PL ++     D  I+ Y IPK +LV  ++     D + WE    F P HFL  DA G  K+  +     F +GKR C+GE LARME F+FFTSV+QRF
Sbjct:   62 FTEFAEKYGKIFSFRLFGSRIVVLNGYNLVKEVYTQQGDNLADRPTLPITSAIIGDNRGLVASSGYKWKHQRRFALTTLRNFGLGKKNLELSINFECGFLNEAISNEQGRPFNPRLLLNNAVSNVICVLVFGNRFEYSDHHFQNLLNKINESVYLEGSIFVHLYNMFPWLMQLLPGPHKKLITL------WQRVTDFVREKVNEHRADYD-QSSLRDYIDCFLAEMEKHKDDTAA--GFDVENLCMCTLDLFVAGTETTSTTLYWGLLYMIKYPEIQAKVQQEIDAVVGSSRQPSGSDRDNMPYTNAVIHEIQRMGNIIPLNVVRTTSEDTRIEKYSIPKGTLVIGSLTSVLFDESEWETPHSFNPGHFL--DAEG--KFRRRDAFLPFSLGKRVCLGEQLARMELFLFFTSVLQRF 465          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2p10 (cytochrome P450, family 2, subfamily P, polypeptide 10 [Source:ZFIN;Acc:ZDB-GENE-040120-1])

HSP 1 Score: 198.364 bits (503), Expect = 7.280e-57
Identity = 134/417 (32.13%), Postives = 205/417 (49.16%), Query Frame = 2
Query:  164 YEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKL-FQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSFDNTQXXXXX----XXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFN-RDNPIFTFLSKMSLEFAERADIFQFIFFTLP-IFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRF 1393
            + + A K+G +F  R+    I VLN Y+ +++ + + G+N A R  L   + ++ +N GLV+  G  W   + F L  +        N +         L E + +   +  N   ++     N+I   V   RF   D+     L+K++        IF  ++   P +   LPG  + LI        +++  +  +E++ EHR   D  S   D IDCFL +  + K  T +   F    L   +L+LF+AG ETTST L W  L+M +Y +IQ  V +EI   +G  R P+  DR  + YT AV+ E+ R+ +I PL ++     D  I+ Y IPK +LV  ++     D + WE    F P HFL  DA G  K+  +     F +GKR C+GE LARME F+FFTSV+QRF
Sbjct:   62 FTEFAEKYGKIFSFRLFGSRIVVLNGYNLVKEVYTQQGDNLADRPTLPITSAIIGDNRGLVASSGYKWKHQRRFALTTLRNFGLGKKNLELSINFECGFLNEAISNEQGRPFNPRLLLNNAVSNVICVLVFGNRFEYSDHHFQNLLNKINESVYLEGSIFVHLYNMFPWLMQLLPGPHKKLITL------WQRVTDFVREKVNEHRADYD-QSSLRDYIDCFLAEMEKHKDDTAA--GFDVENLCMCTLDLFVAGTETTSTTLYWGLLYMIKYPEIQAKVQQEIDAVVGSSRQPSGSDRDNMPYTNAVIHEIQRMGNIIPLNVVRTTSEDTRIEKYSIPKGTLVIGSLTSVLFDESEWETPHSFNPGHFL--DAEG--KFRRRDAFLPFSLGKRVCLGEQLARMELFLFFTSVLQRF 465          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2p8 (cytochrome P450, family 2, subfamily P, polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-061030-1])

HSP 1 Score: 197.978 bits (502), Expect = 8.500e-57
Identity = 137/437 (31.35%), Postives = 212/437 (48.51%), Query Frame = 2
Query:  164 YEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMH------KCVTSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIF-TFLSKMSLEFAERADIFQFIFFTLP-IFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRG 1450
            + K A ++G +F  R+    I VLN Y+ +++ +++ G+N A R  L     +  + GL+   G  W   + F L+ +       K +    N +   L      E    +  +   ++     N+I   V   RF+  +  F T L  +S        I   ++   P + ++LPG  + +I        +RK  +  +E++ EHR   D  S   D IDCFL +  +LK  T +   F    L   SL+LF+AG ETTST L W  L+M +Y +IQ  V +EI   +G  R P++ DR  + YT AV+ E+ R+ +I+P+ +      D  I  Y IPK ++V SN+     D + WE    F P HFL  DA G  K+  +     F +GKR C+GE LARME F+FF+S++QRF  +    V E   D  + G
Sbjct:   62 FTKFAERYGNIFSFRLFGPRIVVLNGYNLVKEVYIKQGDNLADRPVLPLFYEIVGDKGLILSSGYKWKHQRRFALSTLRNFGLGKKSLEPSINVECGFLNEAISNE--QGRPFDPRLLLNNAVSNVICVLVFGNRFDYSDHHFQTLLKNISEAVYLEGSICNQLYNMFPWLMERLPGPHKTIITL------WRKVTDFVREKVNEHRVDYD-PSNPRDYIDCFLTEMEKLKDDTAA--GFDVENLCICSLDLFVAGTETTSTTLYWGLLYMIKYPEIQAKVQEEIDAVVGGSRQPSVSDRDNMPYTNAVIHEIQRMGNIAPINLARSTSEDTQIGNYSIPKGTMVTSNLTSVLFDESEWETPHSFNPGHFL--DAEG--KFRRRDAFLPFSLGKRVCLGEQLARMELFLFFSSLLQRFTFSPPAGV-EPSLDYKMGG 482          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2v1 (cytochrome P450, family 2, subfamily V, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-040912-139])

HSP 1 Score: 191.045 bits (484), Expect = 4.665e-54
Identity = 133/417 (31.89%), Postives = 207/417 (49.64%), Query Frame = 2
Query:  170 KLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSFDNTQ----XXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFN-RDNPIFTFLSKMSLEFAERADIFQFIFFTLP-IFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVN 1402
            K++  +G +F +R+G  +  V+N Y  ++K   + GN+F  R        ++   GL   +G  W  H+ F L+ +        + +    EE   L + +   N    N   +I     NII   V  +RF   D      LS +S     +  +F  ++   P + D LPG  + L     + R F K      EE+++HR   D  S   D IDC+L +  + K    +   F D  L  + L+LF+AG ETTST L W+F++M +Y +IQE V  EI   +G+ R P+M DR  + YT AV+ E+ R+ ++ PL++      D  ++GYFIPK + +  N+     D   W+    F P +FL  +A G  K++  +    F +GKR C GESLARME F+FFTS +Q F ++
Sbjct:   72 KMSDHYGNIFSLRLGSLNTVVVNTYSMVKKVLNDQGNSFMYRPVNDITERISKCQGLTFNNGYSWKQHRRFTLSTLKFFGVGKRSLEFIIMEEYKFLHQSIMDTNGLPFNPHYIINNGVSNIICSMVFGRRFEYTDQRFLNMLSLISKALKLQTSVFIQLYAAFPRLMDLLPGPHKELFSCFHQVRAFIK------EEVDKHRADWD-PSSPRDFIDCYLTEIEKKKDDLEA--GFHDEGLQYAVLDLFVAGTETTSTTLLWAFVYMMKYPEIQEKVQAEIDKVVGRYRRPSMDDRPCMPYTDAVIHEIQRMGNVVPLSVPRMTNEDTILEGYFIPKGTQIIPNLTSVLFDQTKWKTQHSFDPQNFL--NAQG--KFEKPEAFIPFSLGKRSCPGESLARMELFLFFTSFLQSFSLS 475          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2p6 (cytochrome P450, family 2, subfamily P, polypeptide 6 [Source:ZFIN;Acc:ZDB-GENE-040426-790])

HSP 1 Score: 189.504 bits (480), Expect = 3.015e-53
Identity = 138/448 (30.80%), Postives = 217/448 (48.44%), Query Frame = 2
Query:  167 EKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMH------KCVTSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFN-RDNPIFTFLSKMSLEFAERADIFQFIFFTLP-IFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVSLK 1486
            EKL+ K+G +  + +  +   +LN Y  +++ +++ G+N A R +L     +  ++GLV+  G  W   + F L+ +       K +    N +   L      E  N +  +   ++     N+I   V   RF+  D+   T L+ ++        I+  ++ + P I   LPG  +  I        + K  +  +E ++EHR   D  S   D +DCFL +  +LK  T +   F    L   +L+LF+AG ETTST L WS L+M +Y +IQ  V +EI   IG  R P++ DR  + YT AV+ E+ R  +I+ L +    V D  +  Y IPK ++V  N+     D + WE    F P HFL  DA G  K+  +     F +GKR C+GE LARME F+FFTS++Q F  +    V E  F+  +    G  R+P   K
Sbjct:   99 EKLSEKYGSVVSVHLFGQRTVILNGYKQVKEVYIQQGDNVADRPELPMIHDIAGDNGLVAPSGYKWKQQRRFALSTLRNFGLGKKSLEPSINLECHYLNEAISNE--NGRPFDPHLLLNNAISNVICVLVFGNRFDYSDHHFQTLLNNINEAMYLDGTIWAQLYNSHPRIMRLLPGPHKKNITL------WNKVIDFARERVKEHRVDYD-PSNPRDYVDCFLAEMEKLKDDTAA--GFDVENLCICTLDLFVAGTETTSTTLSWSLLYMIKYPEIQAKVQEEIDRVIGSSRQPSVSDRDNMPYTNAVIHEIQRFGNIAALNLPRAAVKDIQVGKYLIPKGTIVIGNLTSVLFDESEWETPHSFNPGHFL--DAEG--KFRRRDAFLPFSLGKRVCLGEQLARMELFLFFTSLLQHFTFSSPAGV-EPSFNYKL----GTTRAPKPFK 526          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: cyp2f1 (cytochrome P450 2K1 [Source:NCBI gene;Acc:100490476])

HSP 1 Score: 203.371 bits (516), Expect = 1.131e-58
Identity = 136/416 (32.69%), Postives = 219/416 (52.64%), Query Frame = 2
Query:  164 YEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKC----VTSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERA-DIFQFIFFTLP-IFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRF 1393
            + + ++K+GP+F +++G+    VL   D ++ A + +G+ F+GR K+     ++   G+V  DG+ W + + F L+ +        T  D   EE  CL+E  +S   K  + + ++     NII   +LN RF   +P    L K   E  + A      ++ T P I   +PG  + + +       F+K  N  +E   + R +LD++ +  DLID FL+KQ + KS++     F D  L     +LF AG ETTST L W  L M +Y DIQ+ V  EI   IG    P ++ RKQ+ YT AV+ E+ R +++ P+ + H +  D    GYF+PK + V   +     D + +++ +EFYP HFL  D+ GN  +   +    F +GKR C+GE+LA+ME F+FFT ++Q F
Sbjct:   55 FMEFSKKYGPVFSIQLGLNKAIVLCGADAVKDALINHGDEFSGRPKIPVFDQISKGYGVVFADGENWKVMRRFALSTLRDFGMGRKTIEDTIVEESGCLVETFKSHEAKPFDNTLILNAAVANIIVHILLNHRFEYQDPTLIKLIKSVSENVKIAGSPIVMLYNTYPSIMGWIPGSHKTVFE------NFQKLSNFLKETFTKRRDQLDVNDQ-RDLIDAFLVKQQEEKSSSKKF--FHDENLKVLLGDLFAAGMETTSTTLRWGILMMMKYPDIQKKVQDEIDRVIGSAE-PRLEHRKQIPYTDAVIHEIQRFANLVPIVLPHSITEDVTFRGYFLPKGTQVIPLLISVMQDKDYFQKPEEFYPEHFL--DSKGN--FVKNEAFLPFSVGKRSCVGETLAKMELFLFFTKLLQNF 456          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: cyp11a1 (cytochrome P450 family 11 subfamily A member 1 [Source:Xenbase;Acc:XB-GENE-960779])

HSP 1 Score: 201.06 bits (510), Expect = 1.170e-57
Identity = 136/427 (31.85%), Postives = 218/427 (51.05%), Query Frame = 2
Query:  164 YEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGR--WKLFQAL-VVTNNSG-LVSIDGDLWHMHKAFVLNVMHKCVTSFDNTQXXXXXXXXXX----XXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEF--AERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANS 1414
            +++L++++G +  +++  + + VLN ++ I++A ++   + A R  + L++ L  V NN G L++  G  W   + F L+ +        + +E        L    +S      +   +I     N+I   +  +RF  D+  F  L  +  E   AE   + Q I  +LP   K+PG+ RL   F  R    +  Q I    I EH++  D      D ID F+++  + K    S  +F D  L+ ++ +LF AG ETT+T L W  LFM  Y D+Q  V +EI   IG+ R PTM D  Q+ YT AV+ E+ R   I PL++ H    D +I G+FIPK +++ +N+     D  VWE+  +FYP HFL  D     K+  ++   AF  G+R C+GE LARME F+FF+S++QRF     + 
Sbjct:   67 FKQLSKQYGDVMSLQVFWKSMVVLNGFEVIKEALIQKSEDTADRPPFNLYEILGFVGNNKGVLLANYGQSWKDLRRFTLSTLKDFGMGKKSLEERVGEEAGYLCDAFQSEQGGPFDPHVLINTAVSNVICSIIFGERFEYDDHKFLKLLCLIEESIKAESGPVPQIIS-SLPWSSKVPGLARLF--FQPRIHMLQYLQEI----INEHKQTWD-SGHTRDFIDAFMLEMKKAKGVKDS--NFNDQNLLLTTADLFSAGSETTTTTLRWGLLFMLLYPDVQRKVQEEIDQVIGRTRKPTMGDVLQMPYTNAVIHEIQRYGDIIPLSVPHMAYRDTHIKGFFIPKGTVIMTNLSSVLKDEKVWEKPFQFYPEHFLDRDG----KFVKREAFMAFSAGRRVCLGEQLARMELFLFFSSLLQRFSFQIPDG 479          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: cyp11a1 (cytochrome P450 family 11 subfamily A member 1 [Source:Xenbase;Acc:XB-GENE-960779])

HSP 1 Score: 200.675 bits (509), Expect = 1.410e-57
Identity = 136/427 (31.85%), Postives = 218/427 (51.05%), Query Frame = 2
Query:  164 YEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGR--WKLFQAL-VVTNNSGLVSID-GDLWHMHKAFVLNVMHKCVTSF----DNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEF--AERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANS 1414
            +++L++++G +  +R+  +   VLN ++ I++A ++   + A R  + L++ L  V NN  +V  + G  W   + F L+ +           +  ++E   L +  +S      +   +I     N+I   +  +RF  D+  F  L  +  E   AE   + Q I  +LP   K+PG+ RL   F  R    +  Q I    I EH++  D      D ID F+++  + K    S  +F D  L+ ++ +LF AG ETT+T L W  LFM  Y D+Q  V +EI   IG+ R PTM D  Q+ YT AV+ E+ R   I PL++ H    D +I G+FIPK +++ +N+     D  VWE+  +FYP HFL  D     K+  ++   AF  G+R C+GE LARME F+FF+S++QRF     + 
Sbjct:   67 FKQLSKQYGDVMSLRVFWKSTVVLNGFEVIKEALIQKSEDTADRPPFNLYEILGFVGNNKAVVLANYGQSWKDLRRFTLSTLRDFGMGKKSLEERVRDEAGYLCDAFQSEQGGPFDPHVLINTAVSNVICSIIFGERFEYDDHKFLKLLCLIEESIKAESGPVPQIIS-SLPWSSKVPGLARLF--FQPRIHMLQYLQEI----INEHKQTWD-SGHTRDFIDAFMLEMKKAKGVKDS--NFNDQNLLLTTADLFSAGSETTTTTLRWGLLFMLLYPDVQRKVQEEIDQVIGRTRKPTMGDVLQMPYTNAVIHEIQRYGDIIPLSVPHMAYRDTHIKGFFIPKGTVIMTNLSSVLKDEKVWEKPFQFYPEHFLDRDG----KFVKREAFMAFSAGRRVCLGEQLARMELFLFFSSLLQRFSFQIPDG 479          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: slc35b2 (solute carrier family 35 member B2 [Source:Xenbase;Acc:XB-GENE-1009913])

HSP 1 Score: 200.29 bits (508), Expect = 1.833e-57
Identity = 148/444 (33.33%), Postives = 227/444 (51.13%), Query Frame = 2
Query:  164 YEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCV----TSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIFFTLPIFDKLPGICRLLI-DFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVS 1480
            Y +L +K+GP+FR++IG + + VL  Y+T++ A V     F+ R  +   L V    G++   G+ W + + F L+ +        T  D   EEC  L+E+ +S   K  + + ++     NII   VL  RF+  +P   FL  MSL   E   +      T+ +++  P + R L  +    G+   + Q   +E   +H+++LD++ +  +L+D FL+KQ + K   G+   F D  L      LF+AG ETTST + W  L M +Y +IQ+NV  EI   IG+ R P  + RK + YT AV+ E+ R  +I P+ + H    D    GYF+PK + V   +     D   +E+ KEFYP HFL  D+ GN  +   +    F  GKR C GE+LARME F+FFTS++Q F    A    E++   AI    GI   P+ 
Sbjct:   59 YLELWKKYGPIFRVQIGSQKMVVLCGYETVKDALVNYAEEFSERPVVPIFLDVVKEYGIIFSHGENWKVMRRFTLSTLRDFGMGRRTIEDRINEECDFLVEQFKSFKGKPFDNTMIMNAAVANIIVSIVLGHRFDYQDP--KFLRLMSL-INENLRLTGSP--TVMLYNVFPSVMRWLPGNHQTVGKNAAENQRFIRETFIKHKEKLDVNDQ-RNLVDAFLVKQQEKK---GNAVYFHDDNLTMLVSNLFVAGMETTSTSVRWGLLLMMKYPEIQKNVQNEIEKVIGQSR-PQTEHRKSMPYTDAVIHEIQRFGNIIPMNLPHATAQDVTFRGYFLPKGTFVIPLLTSVLYDQTRFEKPKEFYPQHFL--DSEGN--FVKNEAFLPFSAGKRSCAGENLARMELFLFFTSLLQNFTFQ-APPGEELDLTPAI----GITTPPLP 483          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: slc35b2 (solute carrier family 35 member B2 [Source:Xenbase;Acc:XB-GENE-1009913])

HSP 1 Score: 200.29 bits (508), Expect = 1.833e-57
Identity = 148/444 (33.33%), Postives = 227/444 (51.13%), Query Frame = 2
Query:  164 YEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCV----TSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIFFTLPIFDKLPGICRLLI-DFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVS 1480
            Y +L +K+GP+FR++IG + + VL  Y+T++ A V     F+ R  +   L V    G++   G+ W + + F L+ +        T  D   EEC  L+E+ +S   K  + + ++     NII   VL  RF+  +P   FL  MSL   E   +      T+ +++  P + R L  +    G+   + Q   +E   +H+++LD++ +  +L+D FL+KQ + K   G+   F D  L      LF+AG ETTST + W  L M +Y +IQ+NV  EI   IG+ R P  + RK + YT AV+ E+ R  +I P+ + H    D    GYF+PK + V   +     D   +E+ KEFYP HFL  D+ GN  +   +    F  GKR C GE+LARME F+FFTS++Q F    A    E++   AI    GI   P+ 
Sbjct:   59 YLELWKKYGPIFRVQIGSQKMVVLCGYETVKDALVNYAEEFSERPVVPIFLDVVKEYGIIFSHGENWKVMRRFTLSTLRDFGMGRRTIEDRINEECDFLVEQFKSFKGKPFDNTMIMNAAVANIIVSIVLGHRFDYQDP--KFLRLMSL-INENLRLTGSP--TVMLYNVFPSVMRWLPGNHQTVGKNAAENQRFIRETFIKHKEKLDVNDQ-RNLVDAFLVKQQEKK---GNAVYFHDDNLTMLVSNLFVAGMETTSTSVRWGLLLMMKYPEIQKNVQNEIEKVIGQSR-PQTEHRKSMPYTDAVIHEIQRFGNIIPMNLPHATAQDVTFRGYFLPKGTFVIPLLTSVLYDQTRFEKPKEFYPQHFL--DSEGN--FVKNEAFLPFSAGKRSCAGENLARMELFLFFTSLLQNFTFQ-APPGEELDLTPAI----GITTPPLP 483          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2b13 (cytochrome P450, family 2, subfamily b, polypeptide 13 [Source:MGI Symbol;Acc:MGI:88599])

HSP 1 Score: 199.519 bits (506), Expect = 2.122e-57
Identity = 141/436 (32.34%), Postives = 203/436 (46.56%), Query Frame = 2
Query:  173 LARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSFDNTQXXXXXXXXXXXXXNKKV----INLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIFFTL--PIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGI 1462
            L  KHG +F + +G R + VL    TIR+A V N   F+GR  +  A +V  + G+    G+ W   + F L  M +      + +E      + L    KK     ++ +   +  T NII   V  +RF+  +  F  L  +  +       F    F L   +    PG+ R +       +  ++  N     +E+HR  LD  SE  D ID +L++  + KS   +   F    L+ S L LF AG ETTST L   FL M  Y  + E V KEI   IG  RLPT+ DR ++ YT AV+ E+ R S I P    HRV  D    GY +PK++ V   +     DP  +E+   F P HFL  DA G +K    +    F  GKR C+GES+AR E F+FFTS++Q F V    +  +++      G   I
Sbjct:   58 LQEKHGDVFTVHLGPRPVVVLCGTQTIREALVNNAEAFSGRGTIAAAQLVMQDYGIFFSSGERWKTLRRFSLATMKEFGMGKRSVEERIKEEAQCLVEELKKYQGAPLDPTFFFQCVTANIICSIVFGERFDYTDEQFLRLLNLMYQIYSLLRSFSCQMFELFSGLLKYFPGVHRQI------AKNQQEILNFITHRVEKHRATLD-PSEPRDFIDTYLLRMEKEKSNHNT--EFHHQNLMMSVLSLFFAGTETTSTTLCCGFLLMLMYPHVAEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFSDIVPTGAPHRVTKDTMFRGYLLPKNTEVYPILSSALHDPQYFEQPDSFNPDHFL--DANGALKKS--EAFLPFSTGKRICLGESIARNELFLFFTSILQNFSVASPVASKDIDLTPKESGIGKI 480          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2b9 (cytochrome P450, family 2, subfamily b, polypeptide 9 [Source:MGI Symbol;Acc:MGI:88600])

HSP 1 Score: 197.978 bits (502), Expect = 8.421e-57
Identity = 140/451 (31.04%), Postives = 217/451 (48.12%), Query Frame = 2
Query:  170 KLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSFDNTQXXXXXXXXXXXXXNKKV----INLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIFFTL--PIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVSLKDYIFTR 1504
            +L  KHG +F + +G R + VL    TIR+A V++   F+GR  +  A +V  + G+    G  W   + F L  M +      + +E      + L    KK     ++ + + +  T NII   V  +RF+  +  F  L  +  +       F    F L        PG+ R ++      +K ++  +     +E+H+  LD  S   D ID +L++  + KS   +   F    L+ S L LF AG ETTS  L +  L M +Y  + E V KEI   IG  RLPT+ DR ++ YT AV+ E+ R S + P+ + H+V+ D    GY +PK++ V   +     DP  +E+  +F P HFL  DA G +K    +    F  GKR C+GES+AR E FIFFT+++Q F V  A+ V   + D   +   GI + P + + Y   R
Sbjct:   57 QLQEKHGDVFTVHLGPRPVVVLCGTQTIREALVDHAEAFSGRGTIAAAQLVMQDYGIFFASGQRWKTLRRFSLATMKEFGMGKRSVEERIKEEAQCLVEELKKYQGVPLDPTFLFQCITANIICSIVFGERFDYTDDQFLHLLNLMYKIFSLLSSFSGQMFELFSGFLKYFPGVHRQIV------KKQQELLDYIAHSVEKHKATLD-PSAPRDYIDTYLLRMEKEKSNHNT--EFHHQNLMMSVLSLFFAGTETTSATLHYGVLLMLKYPHVTEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFSDLVPIGLPHKVIKDTLFRGYLLPKNTEVYPVLSSALHDPQYFEQPDKFNPEHFL--DANGALKK--CEAFLPFSTGKRICLGESIARNELFIFFTTILQNFSV--ASPVAPKDIDLTPKE-SGIGKIPPAHQIYFLAR 491          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2b19 (cytochrome P450, family 2, subfamily b, polypeptide 19 [Source:MGI Symbol;Acc:MGI:107303])

HSP 1 Score: 191.815 bits (486), Expect = 1.840e-54
Identity = 136/451 (30.16%), Postives = 215/451 (47.67%), Query Frame = 2
Query:  170 KLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSFDNTQXXXXXXXXXXXXXNKKV----INLSEVIRVYTVNIISRFVLNKRFN-RDNPIFTFLSKMSLEFAERADIFQFIF-FTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVSLKDYIFTR 1504
            +L  K+G +F + +G R + +L   DTIR+A V     F+GR  +     +    G++   G+ W   + F L  M        + +E      + L    KK     +N +   +    NII   V  +RF+ +D+     L+ +   F+  + +   +F     I    PG  R +       +  ++  +     +E+HR  LD  S   D ID +L++  + KS   +   F    L+ S L LF AG ETTST L +SFL M +Y  + E V KEI   IG  RLPT+ DR ++ YT AV+ E+ R + ++P+ + H+V  D    GY IPK++ V   +     DP  +E+   F P HFL  DA G +K +  +    F  GKR C+GE +AR E F+FFT+++Q F +  A+ V     D  I    G  ++P   + +  +R
Sbjct:   58 QLQEKYGDVFTVHLGPRPVVMLCGTDTIREALVNQAEAFSGRGTVAVLDPIVQGYGVIFSSGERWKTLRRFSLATMRDFGMGKRSVEERIKEEAQCLVEELKKYKGAPLNPTFYFQCIVANIICSIVFGERFDYKDHQFLHLLNLIYQTFSLMSSLSSQVFELFSAILKYFPGAHRQI------SKNLQEILDYIGHSVEKHRATLD-PSAPRDFIDTYLLRMEKEKSNHHT--EFHHQNLVISVLSLFFAGTETTSTTLRYSFLIMLKYPHVAEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFTDLAPIGLPHKVTKDTLFRGYLIPKNTEVYPILSSALHDPRYFEQPDSFNPEHFL--DANGALKTN--EAFMPFSTGKRICLGEGIARNELFLFFTTILQNFSL--ASPVAPENID-LIPNNSGATKTPPQYQIHFLSR 492          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2b10 (cytochrome P450, family 2, subfamily b, polypeptide 10 [Source:MGI Symbol;Acc:MGI:88598])

HSP 1 Score: 187.578 bits (475), Expect = 6.241e-53
Identity = 138/421 (32.78%), Postives = 205/421 (48.69%), Query Frame = 2
Query:  170 KLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMH------KCVTSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFT-----FLSKMSLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDV 1399
            +L  K+G +F + +G R + +L   DTIR+A V     F+GR  +          G++  +G+ W   + F L  M       + V   +  QEE  CL+EEL       ++ + + +  T NII   V  +RF   +  F      F    SL  +  + +F+     L  F   PG  R +       +  ++  +     +E+HR  LD  S   D ID +L++  + KS   +   F    L+ S L LF AG ET+ST L + FL M +Y  + E V KEI   IG  RLPT+ DR ++ YT AV+ E+ R S + P+ + HRV  D    GY +PK++ V   +     DP  +E+   F P HFL  DA G +K    +    F  GKR C+GES+AR E F+FFTS++Q F V
Sbjct:   57 QLREKYGDVFTVHLGPRPVVMLCGTDTIREALVGQAEAFSGRGTVAVVEPTFKEYGVIFANGERWKTLRRFSLATMRDFGMGKRSVE--ERIQEEAQCLVEELRKSQGAPLDPTFLFQCITANIICSIVFGERFEYTDRQFLRLLELFYQTFSLISSFSSQMFELFSGFLKYF---PGAHRQI------SKNLQELLDYIGHSVEKHRATLD-PSVPRDFIDIYLLRMEKEKSNQHT--EFHHQNLMMSVLSLFFAGTETSSTTLRYGFLLMLKYPHVAEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFSDLIPIGVPHRVTKDTMFRGYLLPKNTEVYPILSSALHDPQYFEQPDSFNPDHFL--DANGALKKS--EAFLPFSTGKRICLGESIARNELFLFFTSILQNFSV 459          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2j6 (cytochrome P450, family 2, subfamily j, polypeptide 6 [Source:MGI Symbol;Acc:MGI:1270148])

HSP 1 Score: 187.578 bits (475), Expect = 8.106e-53
Identity = 139/444 (31.31%), Postives = 215/444 (48.42%), Query Frame = 2
Query:  167 EKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKC----VTSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKM--SLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVS 1480
            + L +K+G +F + +G     V+     I++A  +   N   R        ++N +GL+   G +W   + F L  +        +  +  QEE   L+E +     K  N    I     NII      +RF+  +  F  + ++   + + E   I Q       I   +PG  + +       R + K +      I++HRK  + D E  D ID FL +  +    T S   F +  LI S+L+LF AG ETTST L W+ L+MA Y ++QE V  EI   IG++R   + DR+ + YT AV+ EV R+ +I PL +   V  D N++G+ +PK ++V +N+   H DP  W     F P HFL+     N ++  ++    F +GKR C+GE LAR E FIFFTS+MQ+F   F   +NE +     R  +G+  SPVS
Sbjct:   69 QPLVKKYGNIFSLNLGDITSVVITGLPLIKEALTQMEQNIMNRPLSVMQERISNKNGLIFSSGQIWKEQRRFALMTLRNFGLGKKSLEERMQEEASHLVEAIREEEGKPFNPHFSINNAVSNIICSVTFGERFDYHDSRFQEMLRLLDEVMYLETTMISQLYNIFPWIMKYIPGSHQKVF------RNWEKLKLFVSCMIDDHRKDWNPD-EPRDFIDAFLKEMTKYPEKTTS---FNEENLICSTLDLFFAGTETTSTTLRWALLYMALYPEVQEKVQAEIDRVIGQKRAARLADRESMPYTNAVIHEVQRMGNIIPLNVPREVAMDTNLNGFHLPKGTMVLTNLTALHRDPKEWATPDVFNPEHFLE-----NGQFKKRESFLPFSMGKRACLGEQLARSELFIFFTSLMQKF--TFNPPINE-KLSPKFR--NGLTLSPVS 492          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|P24460|CP2BB_CANLF (Cytochrome P450 2B11 OS=Canis lupus familiaris OX=9615 GN=CYP2B11 PE=2 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 1.397e-57
Identity = 139/429 (32.40%), Postives = 207/429 (48.25%), Query Frame = 2
Query:  170 KLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSFDNTQXXXXXXXXXXXXXNKKVINLSE----VIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIFFTLPIFDKL----PGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEF 1432
            +L  K+G +F + +G R   +L   D IR+A V+N   F+GR K+     V    G+V  +G+ W   + F L  M        + +E      + L    +K   + +         T NII   V  KRF   +P   FL  M+L +   A I  F      +F       PG  R + +        ++ +      +E+HR+ LD  S   D ID +LI+  + K+   S   F    LI ++L LF AG ETTST L + FL M +Y  I E +YKEI   IG  RLP++ DR ++ YT AV+ E+ R   + P+ + H V  D    GY IPK + V   +     DP+ +E+   F P HFL  DA G +K +  +    F IGKR C+GE +ARME F+FFT+++Q F V    +  +++ 
Sbjct:   57 RLQEKYGDVFTVYLGPRRTVMLCGIDAIREALVDNAEAFSGRGKIAVVEPVFQGYGVVFANGERWKTLRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELRKTEGVLQDPTFFFHSMTANIICSIVFGKRFGYKDP--EFLRLMNLFYVSFALISSFSSQMFELFHSFLKYFPGTHRQVYN------NLQEIKAFIARMVEKHRETLD-PSAPRDFIDAYLIRMDKEKAEPSS--EFHHRNLIDTALSLFFAGTETTSTTLRYGFLLMLKYPHIAERIYKEIDQVIGPHRLPSLDDRAKMPYTDAVIHEIQRFGDLLPIGVPHMVTKDICFRGYIIPKGTEVFPILHSALNDPHYFEKPDVFNPDHFL--DANGALKKN--EAFIPFSIGKRICLGEGIARMELFLFFTTILQNFSVASPMAPEDIDL 470          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|P12790|CP2B9_MOUSE (Cytochrome P450 2B9 OS=Mus musculus OX=10090 GN=Cyp2b9 PE=1 SV=2)

HSP 1 Score: 197.978 bits (502), Expect = 5.890e-56
Identity = 140/451 (31.04%), Postives = 217/451 (48.12%), Query Frame = 2
Query:  170 KLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSFDNTQXXXXXXXXXXXXXNKKV----INLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIFFTL--PIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVSLKDYIFTR 1504
            +L  KHG +F + +G R + VL    TIR+A V++   F+GR  +  A +V  + G+    G  W   + F L  M +      + +E      + L    KK     ++ + + +  T NII   V  +RF+  +  F  L  +  +       F    F L        PG+ R ++      +K ++  +     +E+H+  LD  S   D ID +L++  + KS   +   F    L+ S L LF AG ETTS  L +  L M +Y  + E V KEI   IG  RLPT+ DR ++ YT AV+ E+ R S + P+ + H+V+ D    GY +PK++ V   +     DP  +E+  +F P HFL  DA G +K    +    F  GKR C+GES+AR E FIFFT+++Q F V  A+ V   + D   +   GI + P + + Y   R
Sbjct:   57 QLQEKHGDVFTVHLGPRPVVVLCGTQTIREALVDHAEAFSGRGTIAAAQLVMQDYGIFFASGQRWKTLRRFSLATMKEFGMGKRSVEERIKEEAQCLVEELKKYQGVPLDPTFLFQCITANIICSIVFGERFDYTDDQFLHLLNLMYKIFSLLSSFSGQMFELFSGFLKYFPGVHRQIV------KKQQELLDYIAHSVEKHKATLD-PSAPRDYIDTYLLRMEKEKSNHNT--EFHHQNLMMSVLSLFFAGTETTSATLHYGVLLMLKYPHVTEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFSDLVPIGLPHKVIKDTLFRGYLLPKNTEVYPVLSSALHDPQYFEQPDKFNPEHFL--DANGALKK--CEAFLPFSTGKRICLGESIARNELFIFFTTILQNFSV--ASPVAPKDIDLTPKE-SGIGKIPPAHQIYFLAR 491          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|P00178|CP2B4_RABIT (Cytochrome P450 2B4 OS=Oryctolagus cuniculus OX=9986 GN=CYP2B4 PE=1 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 5.020e-55
Identity = 143/432 (33.10%), Postives = 209/432 (48.38%), Query Frame = 2
Query:  170 KLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSF----DNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIFFTL-PIFDK-LPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIR 1447
            +L  K+G +F + +G R + VL   D IR+A V+    F+GR K+     +    G++  +G+ W   + F L  M           +  QEE  CL+EEL      +++ + +    T NII   V  KRF+  +P+F  L  +  +       F    F L P F K  PG  R +       R  ++      + +E+HR  LD  S   D ID +L++  + KS   S   F    LI + L LF AG ETTST L + FL M +Y  + E V KEI   IG  R P + DR ++ YT AV+ E+ RL  + P  + H V  D    GY IPK++ V   +     DP  +E    F P HFL  DA G +K +  +    F +GKR C+GE +AR E F+FFT+++Q F +  A+ V   + D   R
Sbjct:   57 RLREKYGDVFTVYLGSRPVVVLCGTDAIREALVDQAEAFSGRGKIAVVDPIFQGYGVIFANGERWRALRRFSLATMRDFGMGKRSVEERIQEEARCLVEELRKSKGALLDNTLLFHSITSNIICSIVFGKRFDYKDPVFLRLLDLFFQSFSLISSFSSQVFELFPGFLKHFPGTHRQIY------RNLQEINTFIGQSVEKHRATLD-PSNPRDFIDVYLLRMEKDKSDPSS--EFHHQNLILTVLSLFFAGTETTSTTLRYGFLLMLKYPHVTERVQKEIEQVIGSHRPPALDDRAKMPYTDAVIHEIQRLGDLIPFGVPHTVTKDTQFRGYVIPKNTEVFPVLSSALHDPRYFETPNTFNPGHFL--DANGALKRN--EGFMPFSLGKRICLGEGIARTELFLFFTTILQNFSI--ASPVPPEDIDLTPR 473          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|Q92088|CP2M1_ONCMY (Cytochrome P450 2M1 OS=Oncorhynchus mykiss OX=8022 GN=cyp2m1 PE=1 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 1.650e-54
Identity = 144/455 (31.65%), Postives = 222/455 (48.79%), Query Frame = 2
Query:  164 YEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSF----DNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKF----RKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVSLKDYIFTR 1504
            Y +L++K+G +F + +G + + V++ Y  I+ AFV  G  F+GR      + V+   G++   G      + F L  +           +  QEE   L++        V+N  E++     N+I   V   RF  D+P+F  + K         D + F   + PI        R++  F     +      KA+   QE+ E   K L++ SE +D I+ FL+K  + K    +   F +  ++ ++  LF AG ETTS+ L  SFL M +Y  IQE+V KEI + IG  R+PT+ DR ++ YT AV+ EV R   +SP ++ H+V+ D     Y IP+ ++V   +     DP +++   EF P +FL  D  G  K +      AFG+GKR C GE+LAR+E F+FFTSV+QRF         E+  + A   C    R P S   YI  R
Sbjct:   61 YMELSKKYGSVFTVWLGSKPVVVISGYQAIKDAFVTQGEEFSGRANYPVIMTVSKGYGVLVSSGKRSKDLRRFSLMTLKTFGMGRRSIEERVQEEAKMLVKAFGEYRDSVVNPKELLCNCVGNVICSIVFGHRFENDDPMFQLIQKA-------VDAY-FNVLSSPIGAMYNMFPRIVWCFPGNHHEMFAIVNKAKVYIQEQAEIRLKTLNI-SEPQDFIEAFLVKMLEEKDDPNT--EFNNGNMVMTAWSLFAAGTETTSSTLRQSFLMMIKYPHIQESVQKEIDEVIGS-RVPTVDDRVKMPYTDAVIHEVQRYMDLSPTSVPHKVMRDTEFYNYHIPEGTMVLPLLSSVLVDPKLFKNPDEFDPENFL--DENGVFKKN--DGFFAFGVGKRACPGEALARVELFLFFTSVLQRFTFTGTKPPEEINIEPA---CSSFGRLPRSYDCYIKLR 496          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|O55071|CP2BJ_MOUSE (Cytochrome P450 2B19 OS=Mus musculus OX=10090 GN=Cyp2b19 PE=2 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 1.287e-53
Identity = 136/451 (30.16%), Postives = 215/451 (47.67%), Query Frame = 2
Query:  170 KLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSFDNTQXXXXXXXXXXXXXNKKV----INLSEVIRVYTVNIISRFVLNKRFN-RDNPIFTFLSKMSLEFAERADIFQFIF-FTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVSLKDYIFTR 1504
            +L  K+G +F + +G R + +L   DTIR+A V     F+GR  +     +    G++   G+ W   + F L  M        + +E      + L    KK     +N +   +    NII   V  +RF+ +D+     L+ +   F+  + +   +F     I    PG  R +       +  ++  +     +E+HR  LD  S   D ID +L++  + KS   +   F    L+ S L LF AG ETTST L +SFL M +Y  + E V KEI   IG  RLPT+ DR ++ YT AV+ E+ R + ++P+ + H+V  D    GY IPK++ V   +     DP  +E+   F P HFL  DA G +K +  +    F  GKR C+GE +AR E F+FFT+++Q F +  A+ V     D  I    G  ++P   + +  +R
Sbjct:   58 QLQEKYGDVFTVHLGPRPVVMLCGTDTIREALVNQAEAFSGRGTVAVLDPIVQGYGVIFSSGERWKTLRRFSLATMRDFGMGKRSVEERIKEEAQCLVEELKKYKGAPLNPTFYFQCIVANIICSIVFGERFDYKDHQFLHLLNLIYQTFSLMSSLSSQVFELFSAILKYFPGAHRQI------SKNLQEILDYIGHSVEKHRATLD-PSAPRDFIDTYLLRMEKEKSNHHT--EFHHQNLVISVLSLFFAGTETTSTTLRYSFLIMLKYPHVAEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFTDLAPIGLPHKVTKDTLFRGYLIPKNTEVYPILSSALHDPRYFEQPDSFNPEHFL--DANGALKTN--EAFMPFSTGKRICLGEGIARNELFLFFTTILQNFSL--ASPVAPENID-LIPNNSGATKTPPQYQIHFLSR 492          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A4P8NYX5 (P450 2B-like protein OS=Dugesia japonica OX=6161 GN=p4502B PE=2 SV=1)

HSP 1 Score: 481.485 bits (1238), Expect = 5.176e-163
Identity = 240/454 (52.86%), Postives = 331/454 (72.91%), Query Frame = 2
Query:  158 DYYEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKC----VTSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVSLKDYIFTRR 1507
            +Y  KL++KHGP+FR+++GMRD+ +L+NYD I+KA V++G NF+GRW++    ++T++SG++  DG  W   ++FVL V+         S D  Q EC  LLEELESL  K+I+ S++I +YT NIIS+F++NKRF R+NP    + KM  E  ++ DI Q +    P  D     C L+I+FT + ++F + QN F+EEI+EH K +D +SEGEDL+D FLIKQ+QLK     VGSF D QLI+SSLELF AG+ETTST L WSFLFM+++ DIQ+ V+ EI++ IGKERLPTM D+K + YTQAVMDE++R+SS++PLA+IHR +ND NIDGYFIPK++L+  N++ CH D ++WE+   FYP HFL  D  GN+KY P+ EL  F IGKRQC+GESLARME+FIFFTS++QRF V     +NE E++ A+ G DGIIR  + + D+IFT++
Sbjct:   54 NYLLKLSKKHGPIFRIKLGMRDVLILSNYDIIKKALVDDGQNFSGRWRMKLISLITHDSGIIFKDGQDWSTQRSFVLKVLRDFGLGKSKSVDLVQNECSFLLEELESLEGKIIDFSKIIPIYTANIISKFIMNKRFERENPKIARIEKMLSEEIKKKDIIQLLHIMFPKCDTSGLFCELIINFTSKWKEFLEIQNYFKEEIDEHLKTIDFNSEGEDLMDRFLIKQNQLKQQNIDVGSFNDWQLIRSSLELFYAGYETTSTTLCWSFLFMSKHQDIQQKVHNEIIEIIGKERLPTMNDKKSMNYTQAVMDEIFRMSSVAPLALIHRTLNDANIDGYFIPKNTLIFPNLYACHFDRDIWEKPMIFYPEHFLTEDDNGNLKYTPRDELILFSIGKRQCLGESLARMEFFIFFTSILQRFRVKLVKELNEKEYEEALLGKDGIIRGSI-VNDFIFTKQ 506          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A2U8U473 (Cytochrome P450 2K1-like protein OS=Dugesia japonica OX=6161 GN=P450 PE=2 SV=1)

HSP 1 Score: 452.595 bits (1163), Expect = 1.121e-151
Identity = 229/452 (50.66%), Postives = 324/452 (71.68%), Query Frame = 2
Query:  158 DYYEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNV-----MHKCVTSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVSLKDYIF 1498
            +Y  +L+RKHGP+FR+R+GMRD+ +L NY TIRKA V++   F+GRWK+    VVT++SG+V  DG +W   ++F+L V     M K ++  D  Q ECL LL EL+SL  ++I+ S++I +YT NIIS+F++NKRF+R +P   F+     + ++++DI Q +    PIFDK   I +  +  T + + F K + +F +EIEEH+  LD +SEG+DLID FL++Q++L  +TG V SFTD QLI  + E+F AG+ETTST L WS LFM+RY DIQ+ VY+EI++ IG+ER+PTM D+K L YTQAVMDE+ RLSS++PL I HR  ND ++D YFIPK+SLV +N + CHTDP++W +  EFYP HFL       +KY P++EL  FGIGKRQCIGESLARMEYFIFF S++QR+ V+F+ ++++  F+  +RG +GIIR    +K++IF
Sbjct:   54 NYLLELSRKHGPIFRIRLGMRDVVILGNYQTIRKALVDDAQIFSGRWKMKLVSVVTHDSGIVFKDGPVWSTQRSFILKVLRDFGMGKSISQ-DIVQGECLFLLNELDSLQGEIIDFSKIIPIYTANIISKFIMNKRFDRSDPRIKFIEYAIFQTSKQSDIVQRLHLMFPIFDKSTIISKFNLWITSKLQLFSKVERVFHDEIEEHKTNLDYNSEGDDLIDRFLLEQNRLSQSTGIVESFTDKQLIFMTFEMFGAGYETTSTTLGWSMLFMSRYKDIQKKVYEEILNVIGEERMPTMNDKKSLNYTQAVMDEILRLSSVAPLGIFHRTFNDTSVDNYFIPKNSLVFANYYACHTDPDIWLKPVEFYPEHFLIKCENDELKYSPREELIPFGIGKRQCIGESLARMEYFIFFVSILQRYQVDFSENISDSLFEETLRGNEGIIRYS-KIKNFIF 503          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A1I8I1X1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013417g1 PE=3 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 1.007e-71
Identity = 148/455 (32.53%), Postives = 240/455 (52.75%), Query Frame = 2
Query:  179 RKHGPLFRMRIGMRDIFVLNNYDTIRKAFV--ENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMH----KCVTSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIFFTLPIFDKLPGICRLL----IDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNF-ANSVNEVEFDSAIRGCDGIIRSPVSLKDYIFTRRK 1510
            +++G L   R+G R   VLN+Y  +++A V  E G+ F+GR        +T+  G+VS +G+LW  H+ F L V+         + D+  +E   L ++  +  +  ++ +EV+     N+IS  +   R    +  F      + E  +  D+ +FI    P+  ++PG+ RLL    +D     R  +      Q +I+ HR +L   S   D +D FL++Q +L        +F D QL ++  ELF+AG +TTS  + W+ L+   Y + Q  V  EI  +IG++RLP  +DRK++ YT A +DEV R ++++P A++HR   D    GY I  D L+ +N++G H DP +W   + F P  FL  D     +Y P + L  FG+GKR C+GESLAR E F+F   ++Q+       +SV  +E D  I G DGI+ +P + +  IF+ R+
Sbjct:   73 KRYGDLVSYRLGARRFVVLNSYAAVKEALVSQEFGDVFSGRMNSNYINSLTHGKGIVSSEGELWREHRRFALKVLRDFGFARAGTEDSIHQELQDLRDQFNTAGEAGVDTTEVLCRAIANVISMMLFGYRAGSQDDRFEAFLAATQENLQGGDLARFIPVGFPLLYQIPGVMRLLELLGVDVYVVQRNLKVTHGFCQMQIDAHRAQLAGVSSPNDFLDAFLMEQEKLNGRKKD-HTFDDFQLKRTLTELFVAGTDTTSNTIRWALLYACLYPECQARVQAEIDAQIGRDRLPEHRDRKRMPYTLAFIDEVQRFATLAPFAVLHRCPRDVEFMGYDISSDDLIMTNLYGIHHDPELWSSPEAFQPERFLAVDTG---EYQPNEHLVPFGVGKRACLGESLARQELFLFIAGILQQHSARLHPDSVKNLE-DIKI-GSDGIVHAPGAHR-IIFSARQ 520          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A1I8HTI6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013417g2 PE=3 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 4.954e-71
Identity = 147/455 (32.31%), Postives = 238/455 (52.31%), Query Frame = 2
Query:  179 RKHGPLFRMRIGMRDIFVLNNYDTIRKAFV--ENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMH----KCVTSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIFFTLPIFDKLPGICRLL----IDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNF-ANSVNEVEFDSAIRGCDGIIRSPVSLKDYIFTRRK 1510
            +++G L   R+G R   VLN+Y  +++A    E G+ F+GR        +T+  G+VS +G+LW  H+ F L V+         + D+  +E   L ++  +  +  ++ +EV+     N+IS  +   R    +  F      + E  +  D+ +FI    P+  ++PG+ RLL    +D     R  +      Q +I+ HR +L   S   D +D FL++Q +L        +F D QL ++  ELF+AG +TTS  + W+ L+   Y + Q  V  EI  +IG+ RLP  +DRK++ YT A +DEV R ++++P A++HR   D    GY I  D L+ +N++G H DP +W   + F P  FL  D     +Y P + L  FG+GKR C+GESLAR E F+F   ++Q+       +SV  +E D  I G DGI+ +P + +  IF+ R+
Sbjct:   73 KRYGDLVSYRLGARRFVVLNSYAAVKEALASQEFGDVFSGRMNSNYINSLTHGKGIVSSEGELWREHRRFALKVLRDFGFARAGTEDSIHQELQDLRDQFNTAGEAGVDTTEVLCRAIANVISVMLFGYRAGSQDDRFEAFLAATQENLQGGDLARFIPVGFPLLYQIPGVMRLLELLGVDVYVVQRNLKVTHGFCQMQIDAHRAQLAGVSSPNDFLDAFLMEQEKLNGRKKD-HTFDDFQLKRTLTELFVAGTDTTSNTIRWALLYACLYPECQARVQAEIDAQIGRNRLPEHRDRKRMPYTLAFIDEVQRFATLAPFAVLHRCTRDVEFMGYDISSDDLIMTNLYGIHHDPELWSSPEAFQPERFLAVDTG---EYQPNEHLVPFGVGKRACLGESLARQELFLFIAGILQQHSARLHPDSVKNLE-DIKI-GSDGIVHAPGAHR-IIFSARQ 520          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A267GWC9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026100g2 PE=3 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 2.494e-67
Identity = 147/455 (32.31%), Postives = 241/455 (52.97%), Query Frame = 2
Query:  191 PLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRW-KLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSFDNTQXXXXXXXXXX-----XXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQF---IFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQ---EEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRF----DVNFANSVNEVEFDSAIRGCDGIIRSPVSLKDYIFTRR 1507
            PL  +  G+  +++LNN++   +A V+ G  F GR  ++ Q   + ++ G+VS +G+LW  ++ F L  +          +E  L    EL      +   + ++ ++++     N+I + V   R   ++P F  L  M     +R         +      F++   + +L++   +R R  + ++ + Q   E++ +H+   D+ SE  D ID  L  QHQ    +  +  F D++L  +  +LF+AG +TTS  L W  L+M    D+ E V++EI   +G ER+PTMKD+  L YT AV++EV RL ++ P+ + HR V D  I GY IP DS+V  NI+G H DP V+   ++F P  +L  DA G  ++ P + +  FG GKR C+GESLARME F+FFT +MQR+    D     S++E++ ++   G  G IR+P   K  +FT R
Sbjct:   62 PLVTLYYGLEPVYILNNFEAFDEAMVKQGQRFIGRPVRVLQKPTLGSDGGIVSTEGELWREYRRFSLKTLRDFGFGRQGGEEIILREAGELCEAIDSTPAGQALSTTDLLSPAVSNVICQLVFGARTATEDPRFPKLLDMFQSLTQRRAARHMNIMLGANYKYFEQFSFLAKLMLLRPERRRVIQLSRQLLQFCKEQVAKHKGDADMQSEPRDYIDAHL--QHQTNLESDRI--FNDLRLAMAIRDLFVAGTDTTSNTLRWGILYMIENPDVAEKVFEEIRVNVGTERMPTMKDKGSLHYTVAVLEEVQRLGTLVPMGVAHRCVEDSVICGYRIPADSVVVPNIYGIHRDPRVFPEPEKFKPERYL--DAEG--RFSPNESVVPFGSGKRACLGESLARMELFVFFTRLMQRYRFGLDPAERRSISEIKDNTENHG--GGIRAPAEHK-IVFTPR 505          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000041981.1 (cytochrome P450 2B4-like [Source:NCBI gene;Acc:103033589])

HSP 1 Score: 190.274 bits (482), Expect = 6.167e-54
Identity = 133/438 (30.37%), Postives = 216/438 (49.32%), Query Frame = 2
Query:  182 KHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSID-GDLWHMHKAFVLNVMH-----KCVTSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERA-DIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSP 1474
            K+G +  + +G   + VLNN  TI++AF++NGN +AGR        VTN  G++  + G+ W   + F L+ +      K        +E    + E L+   K    +  ++   + NII   V   R+  D+  F  L K+  E  + A      IF  +P     PG  + +    +        +N   E +EEHRK LD ++   D ID ++++  + +S   S  +F +  +I S+ +LF+AG +TT+  L W  ++M  + D+QE  +KEIV  +G +R P+M+DR +L YT A + E+ R + + P+ ++H+      + GY +PK + V  NI     D N W+    F P +FL  D  G +          F +G R C GE+LA+ E FIFFTS++QR   ++       E    + G  GI+RSP
Sbjct:   68 KYGEISSVYLGRDIVLVLNNLPTIKEAFIQNGNVYAGRSSFAILEWVTNGYGILMAEYGNSWRQQRRFALHTLRNFGLGKKTLEERVAEEARFLIKELLKHEGKPFYPIHPIMNAVS-NIICSIVFGDRYEYDDKRFAQLLKLINENIQLAGSTVGRIFNMVPFIKHFPGPHQKVWQNAN------SLKNFIHEAVEEHRKTLDPNNL-RDFIDAYIVEMSKQQSNEDS--TFHEDNMIMSTSDLFLAGTDTTAATLRWGLIYMMDHPDVQERCHKEIVQVLGFDRSPSMEDRAKLPYTHATIHEIQRCADLVPV-VMHQTTQATQLRGYHLPKGTKVMPNITAILADKNHWKHPDTFNPENFL--DEKGQLSKS--DHFLPFSLGPRVCAGETLAKAELFIFFTSLIQRLKFSWPPG----EPRPNMNGVMGIVRSP 486          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000010049.2 (cytochrome P450 2G1-like [Source:NCBI gene;Acc:103025252])

HSP 1 Score: 189.889 bits (481), Expect = 7.072e-54
Identity = 130/443 (29.35%), Postives = 211/443 (47.63%), Query Frame = 2
Query:  170 KLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMH------KCVTSF--DNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFN-RDNPIFTFLSKMSLEFAERADIFQFIFFTLP-IFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIR 1468
            K +  +GP+    +G +   VL  YD +++A ++N ++F GR  +   +      GLV  +G+ W   + F L  +       K +  +  + ++     + E           LS  +     N+I   V  +RF+  DN     L  +       +  +  ++   P + + LPG     ID  D  R+F   +      +++H++ LD D+   D IDCFLI+ +Q K    +   F    +  + + LF+AG ETTST + ++ + + ++ +IQE + KEI   IG+ER P M+DRK L +T AV+ EV R   + PL + H  V D    GY IPKD+++   +     D + WE    F P HFL  D  GN K +P      F  GKR C+GESLARME F+F  S++Q F  +     + ++    + G   + R
Sbjct:   56 KWSETYGPVMTAYLGPQRTVVLVGYDAVKEALIDNADDFVGRAPIPFVMRALKGYGLVISNGERWRQLRRFTLTTLRDFGMGRKTMEGWIQEESKHLLEAVRETKSVPFDPTFPLSRAVS----NVICALVFGQRFSYEDNNFLRLLQIIGGVLRFGSSSWGQLYNLFPRLVELLPGKQLHFIDDIDELRRFAMLK------VQKHQETLDPDNP-RDFIDCFLIRLNQEKDMPNT--EFHYDNMTATVMNLFLAGTETTSTTIRYALMLLIKHPEIQERMQKEIDSVIGQERSPMMEDRKSLPFTDAVIHEVQRYVDLVPLNVPHYAVRDITFRGYTIPKDTVILPMLHSVLRDKDHWESPWTFNPKHFL--DNNGNFKKNPA--FMPFSAGKRACVGESLARMELFMFIVSLLQNFTFSCPGGPDSMDTSPGVSGFANLPR 481          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000010639.2 (cytochrome P450 2M1-like [Source:NCBI gene;Acc:103041915])

HSP 1 Score: 189.889 bits (481), Expect = 7.982e-54
Identity = 127/452 (28.10%), Postives = 219/452 (48.45%), Query Frame = 2
Query:  161 YYEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSF-----------DNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFT-FLSKMSLEF-------AERADIFQFI--FFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGC 1453
            +Y + ++K+GP+F +      + V++ Y  ++ + +  G  F+GR      L V+N  G++  +GD W   + F       C+T+            +  +EE   L++   +      N  ++I     N+I   +L  RF  D+P+   F++ ++  F        +  +IF  I  FF   I D L  +              ++ +   + E+E   K LD  +  +D I+ FL++  + K    +   F    L+ +S  LF AG ETTS+ L    L+M ++ DIQ  V KEI + +G  R P++ DR+ + YT AV+ E+ R   ++P ++ H ++ND   + Y IPK ++V   +    +DP +W+    F P +FL      N ++       AFG+GKR C+GE++AR+E FIFFTS++Q F   F  +V + E D+    C
Sbjct:   60 HYLQFSKKYGPVFTLWFANTPVVVISGYQALKDSMIGMGEEFSGRANYPLLLKVSNGYGVLVSNGDRWKQLRRF-------CITTLKDFGMGRQSIEEKVREETSYLVQTFSTFGDSAFNPKDLISEAVCNVICSVMLGHRFESDDPLLKLFITAVNKYFHFLNSPTGQAYNIFPKIVSFFPGKIHDVLSAV--------------QETKASLKREVEARWKTLDPSAPPQDFIEAFLLRMEEEKHNPNT--EFNYENLLSTSWNLFSAGMETTSSTLRQGLLYMMKHPDIQAKVQKEIDEVLGPHRSPSIADRQNMPYTDAVVHEIQRSMDLTPTSVPHYMLNDTEFNNYLIPKGAIVLPLLSSVLSDPKLWKNPDCFDPENFLDE----NGRFKKNDGFVAFGMGKRACLGEAMARVELFIFFTSLLQHF--TFKATVLQEELDTTPLIC 482          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000007184.2 (cytochrome P450 2B4-like [Source:NCBI gene;Acc:103031531])

HSP 1 Score: 189.889 bits (481), Expect = 8.851e-54
Identity = 132/438 (30.14%), Postives = 216/438 (49.32%), Query Frame = 2
Query:  182 KHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLV-SIDGDLWHMHKAFVLNVMHKCVTSFDNTQXXXXXXX----XXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKM---SLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRS 1471
            K+G +  + +G +   +LN     ++AFV+NG  F+GR  L     V    G+V +  G+ W   + F L+ +        + +E          +E+     K       I     NII   V   RF  D+  F  L ++   ++ F+  + + Q IF  +PI    PG  + +       RKF        EE+E+HRK LD ++   D ID +L++ ++ +S   S  +F +  +++S+ +LFIAG ETT+  L W  ++M  + D+QE  ++EIV  +G +R P+M DR QL YT A + E+ R ++I PL ++H+      + GY IP  + + SN+    TD + W+    F P +FL  D  G  ++        F +G R C+GE+LAR E FIFFTS++Q+   ++         D    G  G++RS
Sbjct:   68 KYGEISSLYLGRKPTIILNTMQVAKEAFVQNGTIFSGRPSLPLVRWVNKGYGIVMATYGNSWRQQRRFALHTLRDFGLGKKSVEERVAEEAHFLIKEMLKQEGKAFYPIHPIMNSVSNIICSIVFGDRFEYDDRRFAKLLEIINENIRFSG-SPVAQ-IFNLVPIIKYFPGPHQKIWHNLQSLRKF------MSEEVEKHRKSLDPENL-RDFIDAYLVEMNKQESNEDS--TFHEENMLRSTTDLFIAGTETTANTLRWGLIYMMEHPDVQERCHEEIVRVLGFDRFPSMDDRAQLPYTHATVHEIQRYANIVPLGVVHQTTQPTKLRGYHIPAGTNIMSNLTAILTDKDHWKYPDTFNPENFL--DEKG--QFCKNDSFLPFSLGPRVCLGETLARTELFIFFTSLIQQLKFSWPQGAPPPNMD----GVVGLVRS 486          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000003264.2 (cytochrome P450 2B4-like [Source:NCBI gene;Acc:103033589])

HSP 1 Score: 189.119 bits (479), Expect = 1.913e-53
Identity = 132/448 (29.46%), Postives = 217/448 (48.44%), Query Frame = 2
Query:  182 KHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSID-GDLWHMHKAFVLNVMH-----KCVTSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERA-DIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVSLKDYIFTR 1504
            K+G +  + +G   + VLNN  TI++AF++NGN +AGR        VTN  G++  + G+ W   + F L+ +      K        +E    + E L+   K    +  ++   + NII   V   R+  D+  F  L K+  E  + A      IF  +P     PG  + +    +        +N   E +EEHRK LD ++   D ID ++++  + +S   S  +F +  +I S+ +LF+AG +TT+  L W  ++M  + D+QE  +KEIV  +G +R P+M+DR +L YT A + E+ R + + P+ ++H+      + GY +PK + V  NI     D N W+    F P +FL  D  G +          F +G R C GE+LA+ E FIFFTS++QR   ++         +    G  G++RSP        +R
Sbjct:   68 KYGEISSVYLGRDIVLVLNNLPTIKEAFIQNGNVYAGRSSFAILEWVTNGYGILMAEYGNSWRQQRRFALHTLRNFGLGKKTLEERVAEEARFLIKELLKHEGKPFYPIHPIMNAVS-NIICSIVFGDRYEYDDKRFAQLLKLINENIQLAGSTVGRIFNMVPFIKHFPGPHQKVWQNAN------SLKNFIHEAVEEHRKTLDPNNL-RDFIDAYIVEMSKQQSNEDS--TFHEDNMIMSTSDLFLAGTDTTAATLRWGLIYMMDHPDVQERCHKEIVQVLGFDRSPSMEDRAKLPYTHATIHEIQRCADLVPV-VMHQTTQATQLRGYHLPKGTKVMPNITAILADKNHWKHPDTFNPENFL--DEKGQLSKS--DHFLPFSLGPRVCAGETLAKAELFIFFTSLIQRLKFSWPPGAPRPNMN----GIVGLVRSPFPYNTVCHSR 496          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002462.1 (pep scaffold:Pmarinus_7.0:GL485824:2571:10389:-1 gene:ENSPMAG00000002249.1 transcript:ENSPMAT00000002462.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 175.252 bits (443), Expect = 1.185e-50
Identity = 118/330 (35.76%), Postives = 166/330 (50.30%), Query Frame = 2
Query:  518 NIISRFVLNKRFNRD-----NPIFTFLSKMSLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQ-ENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGN-IKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVSLK 1486
            NII   V   RF+ D     N +  F     +E   R  I  F    +P  +  PG  +L+       R   K    FQE I EHR+  +   +  DLID +L +    K +     +FTD  L+    +LFIAG ET+ST L W+ L+M  Y  IQ E   +EI + IG +R P   DR  L YT AV+ E  R+++++PL ++H    D    GY IPK + V  N+     D   W+   EF P HFL  D  G  +K D      AF  G R C+GE+LARME F+FFTS++QRF  ++ ++ +   F +A    +G+ R+PV  K
Sbjct:   16 NIICSIVFGNRFDYDDKRFRNLLHLFAENFRIEGGWRGKICIF----MPWLEDWPGPHQLIF------RNADKVNLFFQERIREHRQTREA-GQPRDLIDAYLDEME--KESQDPESTFTDGNLLNVVGDLFIAGTETSSTTLRWALLYMMAYPQIQAERCQREIDEVIGGDRSPNTTDRANLPYTDAVIHEAQRMANVAPLGVLHSTTTDVKFRGYNIPKGTKVLLNLTSVLHDETQWKTPNEFNPDHFL--DNTGQFVKPD---AFLAFSAGPRVCLGENLARMELFLFFTSLLQRFKFHWPDATSRPNFVAA----EGLSRAPVFYK 323          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011254.1 (pep scaffold:Pmarinus_7.0:GL479221:5463:6953:-1 gene:ENSPMAG00000010227.1 transcript:ENSPMAT00000011254.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 176.022 bits (445), Expect = 2.098e-49
Identity = 135/430 (31.40%), Postives = 204/430 (47.44%), Query Frame = 2
Query:  167 EKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGR--WKLFQALVVTNNSGL-VSIDGDLWHMHKAFVLNVMHKC----VTSFDNTQXXXXXXXXXXXXXNKKV---INLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAER--ADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVN 1420
            ++LA+K+G +  + +G   + +++ Y+ +++  V  G+ FA R    +F  L  T N G+ ++  GD W   + F L+ +        T  D    E   L+E  +         +NL+  +     NII   +   R++ DN  F  L+ + LE+  +  A+    +    P   KLPG  + +           K Q +  + + EHR   D      DLID +L +  + K    S  SFT   LIQ  +ELFI G ETTS  L W  LFM    DIQ   + EI   +G ER P M DR+ L Y  AV+ E+ R  ++ PL ++H    D   + Y  PK + V  N+     D   W+   +F P HFL  D    I+ D       F  G R C+GESLA+ME F+FFTS++Q F+  + NSV+
Sbjct:   64 QELAKKYGEVCTIMLGSTPVVLVSGYEAVKEVLVNRGHEFADRPITPIFTKL--TQNIGIALAPYGDPWKQQRRFALSTLRNFGFGKATIADKISIEAKYLIETFKQETSAFDPHLNLNNALG----NIICCLLNRNRYDYDNEQFQKLTHL-LEYLVQLQAEPLVILCNVFPFLLKLPGPWQKVFHI------HSKLQCLLNDIVSEHRATKD-QHNPRDLIDSYLAQIDKEKDNPNS--SFTHQSLIQILIELFIGGLETTSNTLRWGLLFMMMNPDIQARCHGEIDRVVGSERPPCMTDRRSLPYLDAVIHEIQRFGNVLPLGVLHATSKDVQFNDYLFPKGTHVMVNLMSALHDDIHWKTPNKFNPDHFLDKDGQC-IQSD---AFLPFSAGPRVCLGESLAKMEIFLFFTSLLQHFEFYWPNSVS 473          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: cyp17a1 (cytochrome P450, family 17, subfamily A, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-040213-2])

HSP 1 Score: 173.711 bits (439), Expect = 2.453e-48
Identity = 119/446 (26.68%), Postives = 214/446 (47.98%), Query Frame = 2
Query:  161 YYEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGD---LWHMHKAFVLNVMHKCVTSFDNTQXXXXXXXXXXXXXNKKVINLSEV---IRVYTVNIISRFVLNKRFNRDNPIFT-------FLSKMSLEFAERA-DIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIK----QHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAI 1444
            +  +LAR +G ++ +R+G  DI VLNN ++I++  ++   +FAGR + +    +T     +++ GD   +W   +   L+ +H CV +    +         +E L + +   +++   I +   N+I       ++++ +  F         L ++    A RA D F       P+    P        + D     RK   +   +I  H+ +        D+ D FL+K        + +    G  T+ ++  S ++ FIAG ETT+T++EW+  ++  + ++Q+ +Y+E+  K+     P++ DR +L+Y  A + E+ RL  ++PLAI HR + D ++ G+FI K S V +N+W  H D   W+    F P  FL        + +P   L  FG GKR C+GESLA+ E F+F   V++R  +  A S  ++    AI
Sbjct:   67 HLTQLARTYGAVYCLRVGGEDIVVLNNVESIKEMLIKKSADFAGRPQTYAGGKITGGGKDIAL-GDYSAVWRRQRRAALSALH-CVGTARTEEIVQGEAQRLVEDLTQYIGRPTDIHTDISMRVCNVICSVAFGTKYDKHDTEFLDIHCCLDSLVRLWGSPAIRALDCF-------PVLRLFPNPA-----WRDLMAAVRKRDEVVWRQILLHKAKPSSSPS-SDMTD-FLLKFTRHSRNEEESEARGGILTEERVHLSIMDTFIAGVETTATLIEWALAYLVLHPEVQDQIYEEMEQKLQPGLGPSLADRDKLLYLDATIKEILRLCPVAPLAIPHRALRDSSVGGFFICKGSTVIANLWAAHRDHAHWDNPSVFQPGRFLGESLE---RRNPASLLLPFGAGKRVCLGESLAKAEIFLFLGHVLRRLRLQPAGSPPDLSGQLAI 493          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001876.1 (pep scaffold:Pmarinus_7.0:GL477372:10316:22460:-1 gene:ENSPMAG00000001674.1 transcript:ENSPMAT00000001876.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.474 bits (428), Expect = 6.068e-47
Identity = 126/419 (30.07%), Postives = 200/419 (47.73%), Query Frame = 2
Query:  167 EKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKL--FQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHK--CVTSFDNTQXXXXXXXXXXXXXNK--KVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAE-RADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIF-QEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAF-GIGKRQCIGESLARMEYFIFFTSVMQRFD 1396
            +KL+  +GP++ + +G   + VL   + I++A V     F  R ++  F+   + N  GL+   G  W   + F L ++      T     +             NK  K  +    I     N+I       R++ +N  F  L  +  E  E   + +  IF + P+    PG  +       R  K +   N F Q  IEEH     +  E  D +D F+ K+  ++ +     +F+DI LI ++  LF+AG ETTS  L+W  L M  Y  +QE V +EI   +G  R P   DR  + YT A + E+ R ++I P+A  H    D  + GYF+PK + V + I     + ++WE  ++F P HFL  D  GN  Y+ + +  AF  +G R C+G++LARME F+FFT+++QRF 
Sbjct:   66 DKLSETYGPIYSVSLGQTRVVVLVGNEIIKEALVTQAEMFIDRPEIPVFKK-SLGNYEGLLLSHGWQWRARRRFTLMMLRNFGMGTKSIEEKIAEEAEFLVRAIENKQEKPFDAHSEINKSAANVICSITFGDRYDWNNKTFVKLMDIITENVELSGNDWSQIFNSFPVLKYFPGPHQ-------RINKNKVVLNAFIQARIEEH-DMARIQGEPRDYLDAFIDKR--IEDSMNPDTAFSDIALINTTANLFVAGSETTSATLKWGILLMLTYPKVQEQVQEEIDRVVGSNRRPACADRACMPYTNATVHEIQRYANILPMAFPHATTCDTKLRGYFLPKGTQVIALIHSALREKSLWEAPEQFNPGHFLDID--GNF-YN-RNDFMAFSAVGPRICLGKNLARMEVFLFFTALLQRFS 469          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011205.1 (pep scaffold:Pmarinus_7.0:GL477378:108537:110066:1 gene:ENSPMAG00000010178.1 transcript:ENSPMAT00000011205.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.229 bits (404), Expect = 1.572e-43
Identity = 119/445 (26.74%), Postives = 202/445 (45.39%), Query Frame = 2
Query:  167 EKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLV-SIDGDLWHMHKAFVLNVMHK---CVTSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFT-FLSKMSLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVSLK 1486
            +++ +++G +  + +G   +  ++ Y  +++  V  G+ FA R        V    G++ +  G  W  H+ F L+ +       +S + T +  +  L E         +    +     NII   V  KR+   +  F  FL  +      ++ +   +    P     PG  +++     + ++F +  +I  E    H  R  +      LID +L    QL+       SF++  LI  +L+LFIAG ETTST L W  L+M  + +IQ   ++EI   +G +RLP M+DR  L Y  AV+ E+ R S+I P    H    D     Y IPK +++  N+    +D N W+   EF P +FL  D     K+        F  G R C+GE+LA+ME F+FF S++Q F+  + + V+       ++    I ++P S K
Sbjct:   77 DEVTKQYGEVCSVMVGKISMVFVSGYQAVKEVLVHQGHEFADRPNTPFNKKVNGGLGIIFAPYGKYWMQHRRFTLSTLRNFGLGKSSIEQTIQAEVGFLIEAFKQKGSAFDPHYDLNSAVGNIICSMVKGKRYEYSDKQFQDFLHLVENNLQLQSGLLGTLCNIFPFLMDFPGPQQIIFKSMAKSKQFIR--DIISER---HATRDPIKPMC--LIDAYL---SQLEKEDNPNSSFSEQSLIMLALDLFIAGAETTSTTLRWGLLYMMMHPEIQAQCHEEIDKIVGSDRLPCMEDRHSLPYLDAVIHEIQRFSNIVPFGAPHATTADVKFRQYLIPKGTIIMVNMKSVLSDENHWKTPYEFSPENFLDEDG----KFVKPDAFLPFSAGPRVCLGENLAKMELFLFFASLLQHFEFYWPDLVSAPTLGYILQ----ITKAPKSYK 503          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Yeast
Match: DIT2 (N-formyltyrosine oxidase; sporulation-specific microsomal enzyme involved in the production of N,N-bisformyl dityrosine required for spore wall maturation, homologous to cytochrome P-450s; SWAT-GFP and mCherry fusion proteins localize to the endoplasmic reticulum and vacuole respectively [Source:SGD;Acc:S000002810])

HSP 1 Score: 48.1358 bits (113), Expect = 1.963e-6
Identity = 68/276 (24.64%), Postives = 112/276 (40.58%), Query Frame = 2
Query:  611 RADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDI----QLIQSSLELFIAGFETTSTILEWSFLFMARY-NDIQENVYKE---IVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLA-IIHRVVND-CNIDG-YFIPKDSLVQSNIWGCHTDPNVW-ERHKEFYPHHF---LKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRF 1393
            +  IF   F T P  D LP           R + F+   + F+E +    KR+      ++L++ +  +Q    ++        +I    QL  + + + +AG E    +   S   +A+Y N+ QE + KE   I D  G   LP +          A + EV R+    PL+ II+R     C +     IPK   V  N +G   DP  W     +F P  +   ++T          +  +  F  G+R C+GE LA  E  I    ++++F
Sbjct:  209 KKQIFHPFFLTFPFLDVLP--------IPSRKKAFKDVVS-FRELL---VKRVQ-----DELVNNYKFEQTTFAASDLIRAHNNEIIDYKQLTDNIVIILVAGHENPQLLFNSSLYLLAKYSNEWQEKLRKEVNGITDPKGLADLPLL---------NAFLFEVVRM--YPPLSTIINRCTTKTCKLGAEIVIPKGVYVGYNNFGTSHDPKTWGTTADDFKPERWGSDIETIRKNWRMAKNRCAVTGFHGGRRACLGEKLALTEMRISLAEMLKQF 456          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO48191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK60])

HSP 1 Score: 174.481 bits (441), Expect = 5.647e-49
Identity = 117/425 (27.53%), Postives = 207/425 (48.71%), Query Frame = 2
Query:  170 KLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSID--GDLWHMHKAFVLNVMHKCVTSFDNTQXXXXXXXXXXXXXNKKVINLSEV--------IRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRG-RKFRKA-QN---IFQEEIEEHRKRLDLDSEG--EDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRF 1393
            +LA+ +G +FR+++G   I V+N+ +  R+A V   N+FAGR  L+ A +++ N   ++    G LW   +     + H  +  F +  +     +        K ++L E         + +  +NII  FV   R++ D+P F  +   + +F +        F    + D  P +  L     ++G R+ ++A QN   + Q++ +EH   L     G   DL D  L+  ++      +    T+  +I +  ++F AG ETT+T + WS +++ R   +QE ++++I + +G++R P + DR+ L   +A + EV R SS+ PL   H    D ++ GY +PKD++V  N+W  H DP  W    EF P  FL  D  G            F  G+R C+ ESL +M+ F+F + ++ +F
Sbjct:   14 ELAKSYGEVFRLKVGSHRIVVVNSIEAAREALVRRANDFAGRPMLYTASLISRNGTDIAFGDFGPLWKQQR----KIAHSALRMFGSGLKPLEEKITVEADELIKRLSLVEGRAHNPKDDVNLAVLNIICSFVFGSRYDMDDPEFHTVVDYTEQFVQG-------FRAASLVDYFPWLRHL----PNKGLRQIKEACQNRDVVLQKKYQEH---LVTYEHGVIRDLTDA-LLSANKASQEESAYLPMTEDHIIMTMNDIFSAGLETTATSILWSLVYLIRNPKVQEQLHQQIDEVVGRDRAPELSDRENLPLIEATIAEVLRSSSLVPLLFPHSTTTDTHLRGYEVPKDTIVLFNVWNMHHDPQRWSNPDEFDPTRFL--DDKGKFICPATLSYLPFSAGRRVCLAESLGKMQLFLFISRLLHKF 417          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO48207 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK94])

HSP 1 Score: 162.155 bits (409), Expect = 4.490e-44
Identity = 130/455 (28.57%), Postives = 215/455 (47.25%), Query Frame = 2
Query:  164 YEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQAL--VVTNNSGLVSID-GDLWHMHKAFVLNVMHKCVTSFDNTQXXXXXXXXXXXXXNK------KVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIFFTLPIFDKL-PGICRLLIDFTDRGRKF----RKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFL-IKQHQLKSTTGSVGSFTDIQLIQSSLE-LFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVS 1480
            + +L + +G ++R+ +G +   VL+  D I++A V    NFAGR  L   L   +    GL  +D G+ W + +     + H  +  +   + + +   E LE  N+      K  ++++   +   N+I   +   R+  D+P F       L   E  D    I F   +   + P +  +L  F+++ R      ++   I + + +EH K  D ++   D  D  L  KQ   +    S     +  +I + L  LFIAG ETTST L W+ +++    D+QE ++KEI D IG++  P +  RK+L   +A   E  RL++++PLAI H+      + G+ IP+ + V +N+W  H DP VW+    F    FL  D  G  K         FG G R C+GE LAR E F+F + ++QRF+  F N     E  S + G  G++  P+ 
Sbjct:   51 FTELEKTYGKVYRLYLGHKLAIVLSG-DAIKEALVRQPRNFAGRPVLNPQLKSALNRGPGLTVMDYGETWKLFR----KLGHSTIKVYGENRLQDVIKDEVLELCNRLESSAGKPFDITQQSGIAVTNVICTKLFGTRYQIDDPEF-------LRVYEIHDKLSRIGFGGNLVTNIFPSLASIL-PFSEKQRDLIQIGQERYEILERKYQEHVKTFDPENI-RDYTDALLKAKQDAEQEDKSSKEHLQESTIIMAGLATLFIAGSETTSTTLGWAVIYLLHNPDVQERLHKEIDDVIGRDAFPQLSKRKELPVLEAFTAETLRLANLAPLAIPHKARERSTLQGFEIPEGTTVFANLWSLHHDPTVWKDPFTFNLDRFL--DEEGKFKAPVGGTFLPFGAGPRVCLGEVLARSELFLFLSRMLQRFE--FVNPPG-CELPS-MEGDLGVVLHPMP 485          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO43314 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYZ4])

HSP 1 Score: 153.295 bits (386), Expect = 1.067e-40
Identity = 116/438 (26.48%), Postives = 196/438 (44.75%), Query Frame = 2
Query:  167 EKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQAL--VVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSFDNTQXXXXXXXXXXXXXNKKVINL----SEVIRVYTVNIISRFVLNKRFNRDNPIFT-FLSK--MSLEFAER-ADIFQFIFFTLPIFDKLP---------------GICRLLIDFTDRGRKF----RKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRF 1393
            + L + +G +F ++ G        +   +++  V    ++AGR   +  L   +     +VS DG  W +H+    + + + ++     +        +L    K   +L    S+ +R    ++I        FN  +P F  FL      +E AE  A I    FF  PI   LP               G+ R+L+D   +G+K     + A+++    ++E   RL  D+E E+     L  ++                L+    ++FIAG+ETTST L W+  F+  Y + QE +++++   +G +R+PT+ DR QL   QA + EV RL ++ P AI H  + D  + GY +PKD++V  +    H DP  WE    F PH  L      N     +     F  G+R C GESLA++E F+F + ++ +F
Sbjct:   71 KSLYKNYGRVFALQAGSFKTVFAASPKAVKEVLVTRSGDYAGRPPFYSFLEGTLGGKDLIVSNDGPAWKLHRKLFTSALRRYLSDTPLLESRIADQTTKLLKYFKDRQHLPFDPSDQLRSCVADVICGITFGDMFNSSHPEFDRFLGDHVFLIEDAEHNAQIALLDFF--PIAQYLPFKAYKITREKDEYIFGVLRMLLD---QGKKTYDDTQPARDLMTAILQE---RLKADAENEEQKQVLLADEY----------------LLNQLGDMFIAGYETTSTSLRWAITFLVNYPEYQEEIHQQLDQVVGPDRMPTLADRPQLAIIQATIMEVLRLGNVVPNAIPHYTLKDTWLCGYRVPKDTIVIVDTMAVHLDPTCWENPTRFDPHRHLTEKGELNTS---QGNFLPFSAGRRVCAGESLAKVELFLFLSWMLHKF 481          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO40930 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5T4])

HSP 1 Score: 151.754 bits (382), Expect = 2.147e-40
Identity = 109/421 (25.89%), Postives = 201/421 (47.74%), Query Frame = 2
Query:  170 KLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDG--DLWHMHKAFVLNVMHKCVTSF-DNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKM------SLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSL-ELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKER--LPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFD 1396
            +LA+ +G ++ + +  +   ++ +    R+  VE  +  AGR   F    VTN S  ++       + + K    + M +      D    +   +L  +++L+    +   ++ + T+N+++       +  D+P F  L +M      S+      D+F F+   LPI        +LL   T      +     F ++++ H    D  S   DL D ++    + +    SV     I+ I   + ++ + G ET+ST + W   ++A Y ++Q  +++++ D IG+++  + T+KDR +L Y +AV+ E  R+S+  PLAI H+   D  I+GYFIPKD+ V  N+WG H DP  W     F P  FL  D     K+   ++L  FG G+R C GE +A+M+ F+  + +++  +
Sbjct:   57 ELAKIYGSVYTLYLNGQRSVIVCSAKAAREGLVERKDAIAGRPYSFTLDYVTNGSKNITFSDFCPTFLLKKRIAQSSMRRYYPQVEDKVNNQLEEVLARIKALDGTAFDPHHLLSLVTLNLVTSMTFGTNYTLDDPEFLLLVQMIDDSTRSIGSMSTLDMFPFLMH-LPI-----RTSKLLKSIT------KTVNEYFMKQVQRHIDSNDGKSI-RDLTDGYIKGLTEAEKEDASVHEVNSIEHIAMVMADMIVPGSETSSTTMGWMIAYLAVYPEVQARLHQQLDDVIGRDKNTVITLKDRDRLPYVEAVIAETMRISTAVPLAIPHKATCDTTINGYFIPKDTTVIFNLWGVHLDPTEWADPHVFNPARFLDEDG----KFIKSEKLLPFGAGRRVCPGEKIAKMQLFLMTSRLLRHLE 460          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO28446 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6F9])

HSP 1 Score: 150.599 bits (379), Expect = 4.121e-40
Identity = 126/467 (26.98%), Postives = 213/467 (45.61%), Query Frame = 2
Query:  170 KLARKHGPLFRMRI-GMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSF-----DNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLD----------SEG--EDLIDCFLIKQHQL-KSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVV-NDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVSLKDYIFTRRK 1510
            KLA+ +G +F ++I   R +FV +          +  N+ AGR + F   +++  +  + + GD +  H  +   ++H  +  +     +N   E   L  +L       I+  EV  +   NIIS F+L K +  D+P F      +LEF  +      +  +  I DK P +  L I           +++ F + + E R RL LD          SE    DL D FL  + ++ +    ++G  TD  +     ++++ G ETTST L W   ++  Y  +Q  +  +I D IG  R P + D+  L Y +A + EV R++++ P+ + H+   N+  + GY IPKD+++  N+W  H DP  W    +F P  F+  D  G  +   ++    F  G+R C+GESLA++E F+  T ++Q+F +             A      I R+P   K     RRK
Sbjct:   21 KLAKTYGDIFMLKIFNDRFVFVSSGAGAREVLMGKRMNDLAGRPQTFTFNLLSRGAKDIVL-GD-YSRHLVWRRKIVHLGLRMYFPKLEENIAWEVSKLEGKLMEDIGAAIHSKEVFLLLITNIISSFLLGKSYEPDDPDFL----TTLEFIRKG---SQVPVSGSILDKFPFLYHLPI-----------SESRFYKNVVEPRDRL-LDKFFLEHKSTFSEDCIRDLTDAFLKAKLEVEREDKKAIGEVTDDHITMLMTDVYVGGLETTSTTLSWLAAYLINYPLVQTRLQTDIDDVIG-SRWPVLADKPNLPYMEATIAEVLRIATVLPMGVPHKATTNNVPLMGYNIPKDTIIVMNLWAIHHDPREWPNPDKFDPDRFINED--GKFEVPGQRSYLPFSAGRRVCVGESLAKIELFLVMTRLLQQFTLETLPGQGPPSVGEA---SGNITRAPKPFKFRAMPRRK 460          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: ENSORLT00000020799.2 (cytochrome P450 2J6 [Source:NCBI gene;Acc:101155419])

HSP 1 Score: 209.534 bits (532), Expect = 5.962e-61
Identity = 146/433 (33.72%), Postives = 210/433 (48.50%), Query Frame = 2
Query:  158 DYYEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSFDNTQXXXXXXXXXXXXXNKKV----INLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIF------FTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEV 1426
            + + KLA ++G L+ +R G R   VLN +  +++A V  G++   R  L     +    G++  +G  W   + F L+ +        + +   L          K+     ++   +I     NII   V   RFN  +  F    K+ L F     I   I+      FTL I   LPG  + L         +R+ Q+   EE++EH+K  D  S+  D ID +L +  + K   GS  +F +  LI   L+LF+AG ETTST L W+FL+MA+Y +IQE V  EI   IGK R P M+DR +L YT AV+ EV R+ +I PL++ H    D  + G+ IPK  L+  N+     D   WE    F P HFL  D     K+  +     F  GKR C+GE+LARME F+FFTS MQ F  +    V  V
Sbjct:   87 ESFSKLAAEYGDLYSLRFGQRWTVVLNGHKALKEALVTKGDSVVDRPHLPLQDEIAKGLGVIFSNGANWTEQRRFALSTLRYFGFGKKSLEPVILNEFAHCAEELKRFKGEPLDPHLIINNTVSNIICHLVFGHRFNYGDKKF---KKLMLLFDRALQIEASIWAQLYNSFTL-IMRCLPGPHKTLQHI------WREVQDFIGEELKEHKKSWD-PSDARDYIDFYLTEIQKTKGQEGS--TFDEENLIMCVLDLFVAGSETTSTTLRWAFLYMAKYPEIQEKVQAEIHKVIGKSRPPCMEDRAELPYTDAVIHEVQRIGNIVPLSLPHATNKDVQLGGFTIPKGVLIIPNLTSVLFDEKEWETPHAFNPGHFLNKDG----KFVKRGAFIPFSAGKRLCLGENLARMELFLFFTSFMQHFSFSMPAGVEPV 502          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: cyp2n13 (cytochrome P450 2J6 [Source:NCBI gene;Acc:101156965])

HSP 1 Score: 195.282 bits (495), Expect = 8.483e-56
Identity = 134/456 (29.39%), Postives = 217/456 (47.59%), Query Frame = 2
Query:  161 YYEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGR--WKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSFDNTQXX--XXXXXXXXXXXNKKVINLSE--VIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAE-RADIFQFIFFTLP-IFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVSLKDYIFTR 1504
            Y+ K+A  +G +F +R+G +    ++ Y  +++A V    NF  R   ++       N++GL   +G+ W   + F L+ +       +  ++         + +  N+K    S   +      NII + V+ KRF+ D+  F  + K   E  +    I+  ++ + P +   LPG    +       R ++  Q+   +EI+ H++ LD ++   D ID F+I+    K     +G F D  L   SL+LF+AG ETTST L W+ +++ ++ D+Q  V +EI   IG+ RLP+M DR  L YT AV+ E+ R+ +I PL  +     D  + GYFIPK + +   +     D   WE    F P HFL  D     K+  K+    F  GKR C+GE LARME F+F   ++Q+F  +    V     + +  G  G  R P   K Y   R
Sbjct:   61 YFSKMAESYGNVFSVRLGSQATVFVSGYKMVKEALVTQAENFVDRPFSEIGGRFYEGNSNGLFFSNGEKWKKQRRFALSTLRTFGLGKNTMEQSICEEIRHLQQQIENEKGGPFSPAGLFNNAVSNIICQLVMGKRFDYDDNNFQVMMKYISEAVQLEGSIWGILYESFPGLMKHLPGSHNKIF------RNYKIVQDFLAQEIKIHKQDLDPNNP-RDYIDSFIIEME--KHQNSDLG-FNDANLAFCSLDLFVAGTETTSTTLMWALIYLIKHPDVQVKVQQEIDRVIGQNRLPSMADRPNLPYTDAVVHEIQRIGNIVPLNGLRVAAKDTTLGGYFIPKGTALMPMLTSVLFDKTEWETPDTFNPEHFLDADG----KFVKKEAFLPFSAGKRVCLGEGLARMELFLFLVGLLQKFSFSVPEGV-----ELSTEGITGTTRVPHPYKVYAKVR 497          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: ENSORLT00000018818.2 (cytochrome P450 2J2 [Source:NCBI gene;Acc:101157767])

HSP 1 Score: 194.512 bits (493), Expect = 1.545e-55
Identity = 140/451 (31.04%), Postives = 218/451 (48.34%), Query Frame = 2
Query:  164 YEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWK--LFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMH------KCVTSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIFFTL-P-IFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVSLK 1486
            +++ A K+G +F + I      VLN    +++A ++ G++F  R +  LF  L+   N G+V  +G  W   + F L+ +       K +  +   QEEC  + +       K  +   ++     NII   V  +RF   +  +  + +   E  +    F  + + + P +  + PG  + L    D+   F K +      IEEH++ LD  +  +D ID FLI   +++   G    F    L   +L+LF AG ETT+T L W  LFM  Y DIQE V+ EI   IG  R P+M D++ + YT AV+ E+ R+  I P+ +      D  +D Y IPK +++   +     D +VWE    F P HFL  D      +  ++    FG GKR C+GE LARME F+FFTS +QRF  +F+ +  E      + G  G IRSP S +
Sbjct:   65 FKEFAAKYGNVFSLNIFGGKTVVLNGTKLLKEALIQKGDDFVDRPQIPLFSDLI--ENKGIVMTNGIQWKHQRRFALHTLRNFGLGKKTMEKY--IQEECHYITQAFAEHQGKPFDAQPLLNSAVSNIICCLVFGERFEYSDKEYQQILQDLTEVVKLQGSFSALAYNVFPWLMKRFPGPLQKLFTLVDKIMDFVKIK------IEEHKENLD-PACPKDYIDSFLI---EMEKNQGEDFGFDIKNLCACTLDLFGAGSETTTTTLYWGLLFMIHYPDIQEEVHAEIDAVIGSSRQPSMADKENMPYTDAVIHEIQRMGDIVPIGVARMASRDTMLDNYTIPKGTMIMPALHTVLHDESVWETPHSFNPQHFLNQDGT----FKKREAFFPFGAGKRVCLGEQLARMELFLFFTSFLQRF--SFSTAGGE---KPPLEGRMGTIRSPKSYR 492          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: ENSORLT00000034003.1 (cytochrome P450 2F3 [Source:NCBI gene;Acc:101157144])

HSP 1 Score: 193.356 bits (490), Expect = 4.247e-55
Identity = 130/436 (29.82%), Postives = 212/436 (48.62%), Query Frame = 2
Query:  170 KLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSFDNT----QXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEF-----AERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRG 1450
            +L++ +GP+  + +G +    L  YD +++A V+  ++F GR  L      T   G+   +G+ W   + F L  +              QEE   +   + SL  K  + + ++     N+I   V  +RFN D+  F  L KM  E        +  ++    +   + ++LPG    +  + +  R F K      ++I+EH+  LD  S   D IDCFL++  Q K    S   F    L+ + L LF+AG ETTS+ + ++   + ++  IQE + +EI   IG+ER P+M+DRK L +T AV+ EV R   ++P ++ H  + D +  GY IPKD+++   +     +  +W     F P +FL  D  GN K +P      F  GKR C+GESLARME F+F  S++Q F  +  N  + +  D    G
Sbjct:   57 ELSKTYGPVMTIYMGWQRAVALVGYDAVKEALVDQADDFVGRAPLPFLYRATRGYGIGISNGERWRQLRRFALTTLRDFGMGRKGMEQWIQEESRHIRAHINSLKGKPFDPTFLLSCAVSNVICCLVYGERFNYDDKQFLELLKMISEILGFNGGPKGAMYNLFPW---LMERLPGHQHTIFGYIEDIRNFAK------KKIQEHKDTLD-PSSPRDFIDCFLLRMDQEKDNPTS--EFHYENLVSTVLNLFLAGTETTSSTIRYALSVLIKHPKIQEKMQEEIDSVIGRERCPSMEDRKSLPFTDAVIHEVQRFMDLAPFSLPHYSLKDISFRGYTIPKDTMIFPMLHSVLREDKLWSSPWSFNPQNFL--DQNGNFKKNPG--FVPFSAGKRACVGESLARMELFVFIVSLLQNFTFSAPNGPDSINLDPEYSG 476          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: ENSORLT00000001518.2 (cytochrome P450 2F3-like [Source:NCBI gene;Acc:101156755])

HSP 1 Score: 192.586 bits (488), Expect = 6.544e-55
Identity = 129/440 (29.32%), Postives = 214/440 (48.64%), Query Frame = 2
Query:  170 KLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSFDNT----QXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAE-RADIFQFIFFTLP-IFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRS 1471
            +L++ HGP+  + +G +    L  YD +++A V+  ++F GR  L      T   G+   +G+ W   + F L  +              QEE   +  ++ +   K  + + ++     N+I   V  +RFN D+  F  L ++  E     +     ++   P + ++LPG    +  + +  RKF K       +I+EH+ +LD  S   D IDCFL++  Q K    S   F    L+ + L LF+AG ETTS+ + ++   + ++  IQE + +EI   IG+ER P+M++RK L +T AV+ EV R   ++P ++ H  + D +  GY IPKD+++   +     +  +W     F P +FL  D  GN K +P      F  GKR C+GESLARME F+F  S +Q F  +  N  + +       G   + RS
Sbjct:   57 ELSKTHGPVMTIYMGWQRAVALVGYDAVKEALVDQADDFVGRAPLPFLYRATRGYGIGISNGERWRQLRRFALTTLRDFGMGRKGMEQWIQEESRHIRAKINTFKGKPFDPTFILSCTVSNVICCLVYGERFNYDDKQFLELLQIISEVPRFNSSPMGAMYNLFPWLMERLPGRQHTIFGYIEDIRKFAK------NKIQEHKDKLD-PSSPRDFIDCFLLRMDQEKDNPTS--EFHYENLVSTVLNLFLAGTETTSSTIRYALSVLIKHPKIQEKMQEEIDSVIGRERCPSMEERKSLPFTDAVIHEVQRFMDLTPFSLPHYSLKDISFRGYTIPKDTMIFPMLHSVLREDKLWSSPWSFNPQNFL--DQNGNFKKNPG--FVPFSAGKRACVGESLARMELFLFIVSFLQDFTFSAPNGPDSINLVPEYSGLANLPRS 483          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000072689.1 (SMESG000072689.1)

HSP 1 Score: 900.582 bits (2326), Expect = 0.000e+0
Identity = 470/473 (99.37%), Postives = 471/473 (99.58%), Query Frame = 2
Query:   92 MIPIEXXXXXXXXXXXXXXXXXDYYEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVSLKDYIFTRRK 1510
            MIPIEKGLPLVGVLLKLKYPVLDYYEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSFDNTQEECLCLLEELESLNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRF VNFA SVNE+EFDSAIRGCDGIIRSPVSLKDYIFTRRK
Sbjct:    1 MIPIEKGLPLVGVLLKLKYPVLDYYEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSFDNTQEECLCLLEELESLNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFHVNFAKSVNEIEFDSAIRGCDGIIRSPVSLKDYIFTRRK 473          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000072733.1 (SMESG000072733.1)

HSP 1 Score: 514.227 bits (1323), Expect = 1.746e-179
Identity = 260/483 (53.83%), Postives = 345/483 (71.43%), Query Frame = 2
Query:   68 RSRRKDSRMIPIEXXXXXXXXXXXXXXXXXDYYEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHK----CVTSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVSLKDYIFTR 1504
            R   K  + +PIEKG PL+G+L  L +P+L+YYE+L +KHGP+F M++G+R IFVLN+Y  IR A ++N +NF+GRW+LFQ+L+ T N+G+VS DGD  H+H+ F++ VMH+     + S  N Q EC  LLE LE    + I +S++I  Y  NII++F++NK F+  +P    +  +  E A   DIFQF++FTLPI D+ P +C  L+ FT R   F K   I Q+EIEEHRK  D+ +EGEDLID FL+KQ QLKS+  SV SFTD QL++  LELF+AG+ETTSTI  WS  FM++Y +IQ  V++EI+D IG ERLPT  DRK L YT AVMDE+ RLSS+ PLA+IHR  ND  ++ YFIPKDSLV  N++ CH DPNVWE+ +EFYP HFL     GNIKY PK +LN FG+GKRQCIGESL RM+YFIFF S++QRF V+FA+ V E +F  A+R  +GI+R P S+ +++F R
Sbjct:   23 RPIPKGLQKVPIEKGFPLIGILPLLTFPILEYYERLIKKHGPVFGMKMGLRTIFVLNDYRAIRNALIDNKDNFSGRWRLFQSLLGTQNAGIVSTDGDQTHIHRRFIIKVMHEFGMGTLRSLTNIQTECTALLECLEKCQGERIQVSDIIPTYMANIITKFLMNKTFSVGDPKLNLIKNILTEIARTKDIFQFLYFTLPILDRFPRVCDFLMSFTTRKDLFNKVHRILQQEIEEHRKTFDVKNEGEDLIDRFLMKQDQLKSSEESVKSFTDFQLVRHLLELFLAGYETTSTIFHWSLFFMSKYQEIQSKVHQEIIDSIGTERLPTNNDRKDLTYTTAVMDEILRLSSVLPLALIHRTTNDTEVNSYFIPKDSLVLINLYACHVDPNVWEKPREFYPEHFLSPKENGNIKYVPKDQLNPFGMGKRQCIGESLGRMQYFIFFVSILQRFQVSFADPVTESQFQEALRANEGIVRYP-SINEFVFNR 504          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000072744.1 (SMESG000072744.1)

HSP 1 Score: 481.871 bits (1239), Expect = 1.072e-166
Identity = 258/485 (53.20%), Postives = 359/485 (74.02%), Query Frame = 2
Query:   71 SRRKDSRMIPIEXXXXXXXXXXXXXXXXXDYYEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMH-----KCVTSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVSLKDYIFTRRK 1510
            S  K  ++IP EKGLP VGVL +++ P+L YYE+L +KHG +F +R GMRD+ +LN+Y T++ AFV++G+N++GRW+L  +L+  NNSG+  IDG  W   + F+L V+H     K V S++  ++EC  LLEELE+L  K ++ S++I +YTVNIIS+F +NKRF+R +     ++ +    A++ D+ QF FF LPIFDK+P +C  +I  T R + F      FQEE++EHRK LDL+SEGEDLID FLIKQHQLK++TGS+  FTD QL++ SLEL IAG ETT+T LEWSFLFM++Y  IQ+ V++EIV+ IGKER PT  DRK L YTQAVMDE++R+SS++PLA++HR +ND +I+GY++PKD+LV SN++ CH D  VWE+ KEFYP  FL TD  G+IKY   + LNAFG+GKR+C GESLA+ME FIFFTS+MQRF+V F+  V++  ++ A+ G DG++R    +  +IFT+R+
Sbjct:   24 SISKGLKIIPTEKGLPFVGVLHQMETPILKYYERLIKKHGSVFAVRYGMRDVIILNDYQTVKSAFVDDGSNYSGRWRLVSSLLAANNSGIAFIDGQNWQTQRTFMLKVLHDFGMGKSV-SYEIVRQECFNLLEELETLQGKRVDASDLIHLYTVNIISKFTMNKRFSRGDDKLRNINDLITHVAKQKDLLQFWFFALPIFDKMPLLCDWIISRTHRIKHFDAVHKYFQEEVDEHRKSLDLNSEGEDLIDRFLIKQHQLKASTGSIEGFTDFQLLRMSLELLIAGLETTTTTLEWSFLFMSKYTIIQQKVHEEIVNIIGKERFPTTNDRKDLNYTQAVMDEIFRVSSVAPLALVHRAMNDSSINGYYVPKDALVFSNLYACHFDEKVWEKPKEFYPERFLSTDINGDIKYTANENLNAFGMGKRRCAGESLAKMEAFIFFTSIMQRFEVRFSEDVSDALYEEALIGNDGLVRCS-KINKFIFTKRE 506          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000049728.1 (SMESG000049728.1)

HSP 1 Score: 481.1 bits (1237), Expect = 7.031e-163
Identity = 232/453 (51.21%), Postives = 337/453 (74.39%), Query Frame = 2
Query:  161 YYEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMH-----KCVTSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVSLKDYIFTR 1504
            YYE+L +KHG +F +R GMRD+ +LN+Y T++ AFV +G+N++GRWK+ Q+L+++ N+G+  IDG++W   + F+L V H     K V S++  ++EC  L++ELE+L  K +++S++I++YTVNIIS+F++NKRF+R    +  LS +S    ++ D FQF+F+TLP+FDK+  +C  ++  T+R   F     + QEE++EHRK LDL+SEGED ID FLIKQHQLK++TGS   FTD QL++ S+EL +AG ETT T L WSFLFM++Y +IQ+ V+ EI+  +GKER PT+ DRK L YTQAVMDEV R+SS++PLA +HR + D +++GY++PKDSLV SN++ C+ D  VW++ KEFYP HFL TD  G I Y P + LN FG+GKR+C+GESLARME F+FFTS+MQRF+V FA  V+E  ++ A+ G +G++RS   +K++IF +
Sbjct:   54 YYERLIKKHGSVFAVRFGMRDVIILNDYQTVKSAFVHDGSNYSGRWKVSQSLMMSGNAGIAFIDGEMWQTQRTFMLKVFHDFGMGKSV-SYEIVRQECHFLIDELETLIGKCVDVSDLIQLYTVNIISKFIMNKRFSRKEDKYKRLSDLSQHALKQKDFFQFLFYTLPLFDKMNWLCDWILRRTNRRIPFDAVDKLVQEELDEHRKTLDLNSEGEDFIDRFLIKQHQLKTSTGSSEQFTDFQLLRLSMELLVAGLETTMTTLGWSFLFMSKYTNIQKKVHNEIIKTVGKERFPTLNDRKYLHYTQAVMDEVIRVSSVAPLAFVHRAMEDSSLNGYYVPKDSLVFSNLYACNFDEKVWKKPKEFYPEHFLSTDINGVIIYTPNESLNPFGVGKRRCVGESLARMEIFVFFTSIMQRFEVKFAEDVSEALYEEALIGNEGVVRSS-KIKNFIFEK 504          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000078092.1 (SMESG000078092.1)

HSP 1 Score: 466.848 bits (1200), Expect = 7.577e-161
Identity = 243/480 (50.62%), Postives = 335/480 (69.79%), Query Frame = 2
Query:   80 KDSRMIPIEXXXXXXXXXXXXXXXXXDYYEKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQALVVTNNSGLVSIDGDLWHMHKAFVLNVMHKC----VTSFDNTQXXXXXXXXXXXXXNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERADIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKRLDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFETTSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAVMDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVWERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFIFFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVSLKDYIFTRR 1507
            K  + IP+E GLP++G + K++ P+  Y  KL RK GP+FR+++GMR I VLNNY+ I+KA +++ NNF+GRW       VT++SG++  DG +W   ++F+L V+         S +  Q EC   L+EL++L+ ++++ SE+I +YT NIISRF++NKRF RD+P   F+ K   +F +  DIFQ I    P FD    IC+L+   T   + F + Q+ F +EI+EHR  LD  SEGEDL+D FLIKQ+QLK +TG+V SF D QLI++S+ELFIAGFETTST L W  LFM++Y DIQE V+KEI + IGKERLPTM D+K L YTQAVMDEV RLSS+ P+A+IHR  +D NI+G++IPKDSL+  N++ CH DP +WE  K  YP HFL  D+ G  KY P++EL  F +GKRQCIGESLAR EYFIFF S++QRF ++F   ++E  +   I G +G+IR+   +K+++F RR
Sbjct:   28 KGLKEIPMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIFQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRTQDFFADEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGFETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDEVLRLSSVVPMALIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWEFPKTLYPEHFLSLDSNGISKYQPREELIPFSVGKRQCIGESLARSEYFIFFVSMVQRFQISFGEEISEDRYSQTIIGNEGLIRTS-DIKNFLFKRR 506          
The following BLAST results are available for this feature:
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CYP2B65.662e-5331.38cytochrome P450 family 2 subfamily B member 6 [Sou... [more]
CYP2J21.237e-5131.36cytochrome P450 family 2 subfamily J member 2 [Sou... [more]
CYP2U13.638e-5029.93cytochrome P450 family 2 subfamily U member 1 [Sou... [more]
CYP1A27.295e-5028.54cytochrome P450 family 1 subfamily A member 2 [Sou... [more]
CYP2F12.517e-4927.58cytochrome P450 family 2 subfamily F member 1 [Sou... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp-23A15.008e-5129.91CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-33D17.372e-4829.32CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-14A11.493e-4627.49CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-33C91.978e-4628.50CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-33A13.153e-4627.64CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp18a17.219e-4928.76gene:FBgn0010383 transcript:FBtr0074610[more]
Cyp18a17.219e-4928.76gene:FBgn0010383 transcript:FBtr0074609[more]
Cyp303a12.335e-3126.50gene:FBgn0001992 transcript:FBtr0343812[more]
Cyp303a12.335e-3126.50gene:FBgn0001992 transcript:FBtr0080828[more]
Cyp305a12.249e-2825.18gene:FBgn0036910 transcript:FBtr0074925[more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp2p107.280e-5732.13cytochrome P450, family 2, subfamily P, polypeptid... [more]
cyp2p107.280e-5732.13cytochrome P450, family 2, subfamily P, polypeptid... [more]
cyp2p88.500e-5731.35cytochrome P450, family 2, subfamily P, polypeptid... [more]
cyp2v14.665e-5431.89cytochrome P450, family 2, subfamily V, polypeptid... [more]
cyp2p63.015e-5330.80cytochrome P450, family 2, subfamily P, polypeptid... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp2f11.131e-5832.69cytochrome P450 2K1 [Source:NCBI gene;Acc:10049047... [more]
cyp11a11.170e-5731.85cytochrome P450 family 11 subfamily A member 1 [So... [more]
cyp11a11.410e-5731.85cytochrome P450 family 11 subfamily A member 1 [So... [more]
slc35b21.833e-5733.33solute carrier family 35 member B2 [Source:Xenbase... [more]
slc35b21.833e-5733.33solute carrier family 35 member B2 [Source:Xenbase... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp2b132.122e-5732.34cytochrome P450, family 2, subfamily b, polypeptid... [more]
Cyp2b98.421e-5731.04cytochrome P450, family 2, subfamily b, polypeptid... [more]
Cyp2b191.840e-5430.16cytochrome P450, family 2, subfamily b, polypeptid... [more]
Cyp2b106.241e-5332.78cytochrome P450, family 2, subfamily b, polypeptid... [more]
Cyp2j68.106e-5331.31cytochrome P450, family 2, subfamily j, polypeptid... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P24460|CP2BB_CANLF1.397e-5732.40Cytochrome P450 2B11 OS=Canis lupus familiaris OX=... [more]
sp|P12790|CP2B9_MOUSE5.890e-5631.04Cytochrome P450 2B9 OS=Mus musculus OX=10090 GN=Cy... [more]
sp|P00178|CP2B4_RABIT5.020e-5533.10Cytochrome P450 2B4 OS=Oryctolagus cuniculus OX=99... [more]
sp|Q92088|CP2M1_ONCMY1.650e-5431.65Cytochrome P450 2M1 OS=Oncorhynchus mykiss OX=8022... [more]
sp|O55071|CP2BJ_MOUSE1.287e-5330.16Cytochrome P450 2B19 OS=Mus musculus OX=10090 GN=C... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4P8NYX55.176e-16352.86P450 2B-like protein OS=Dugesia japonica OX=6161 G... [more]
A0A2U8U4731.121e-15150.66Cytochrome P450 2K1-like protein OS=Dugesia japoni... [more]
A0A1I8I1X11.007e-7132.53Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HTI64.954e-7132.31Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GWC92.494e-6732.31Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000041981.16.167e-5430.37cytochrome P450 2B4-like [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000010049.27.072e-5429.35cytochrome P450 2G1-like [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000010639.27.982e-5428.10cytochrome P450 2M1-like [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000007184.28.851e-5430.14cytochrome P450 2B4-like [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000003264.21.913e-5329.46cytochrome P450 2B4-like [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002462.11.185e-5035.76pep scaffold:Pmarinus_7.0:GL485824:2571:10389:-1 g... [more]
ENSPMAT00000011254.12.098e-4931.40pep scaffold:Pmarinus_7.0:GL479221:5463:6953:-1 ge... [more]
cyp17a12.453e-4826.68cytochrome P450, family 17, subfamily A, polypepti... [more]
ENSPMAT00000001876.16.068e-4730.07pep scaffold:Pmarinus_7.0:GL477372:10316:22460:-1 ... [more]
ENSPMAT00000011205.11.572e-4326.74pep scaffold:Pmarinus_7.0:GL477378:108537:110066:1... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DIT21.963e-624.64N-formyltyrosine oxidase; sporulation-specific mic... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO481915.647e-4927.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482074.490e-4428.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433141.067e-4026.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409302.147e-4025.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO284464.121e-4026.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000020799.25.962e-6133.72cytochrome P450 2J6 [Source:NCBI gene;Acc:10115541... [more]
cyp2n138.483e-5629.39cytochrome P450 2J6 [Source:NCBI gene;Acc:10115696... [more]
ENSORLT00000018818.21.545e-5531.04cytochrome P450 2J2 [Source:NCBI gene;Acc:10115776... [more]
ENSORLT00000034003.14.247e-5529.82cytochrome P450 2F3 [Source:NCBI gene;Acc:10115714... [more]
ENSORLT00000001518.26.544e-5529.32cytochrome P450 2F3-like [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072689.10.000e+099.37SMESG000072689.1[more]
SMESG000072733.11.746e-17953.83SMESG000072733.1[more]
SMESG000072744.11.072e-16653.20SMESG000072744.1[more]
SMESG000049728.17.031e-16351.21SMESG000049728.1[more]
SMESG000078092.17.577e-16150.63SMESG000078092.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008390 ID=SMED30008390|Name=Cytochrome P450 2K1-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1550bp
CTTGTCGAATTAATAGATGATTTATTTTATAATTTTAGCTCTCTTTATAA
TTGCTTATTTCTTGGTTAGGTCCAGAAGGAAAGACTCAAGGATGATACCA
ATTGAGAAGGGGTTACCCCTTGTTGGAGTTTTACTAAAACTGAAATATCC
AGTCTTGGACTATTACGAGAAACTCGCAAGAAAACACGGCCCGTTGTTCA
GAATGCGAATAGGAATGAGGGACATTTTTGTTTTGAATAATTATGATACA
ATTCGAAAAGCGTTTGTTGAAAATGGAAATAATTTTGCTGGAAGATGGAA
ACTTTTCCAAGCTTTGGTGGTGACAAACAATTCTGGTTTGGTTTCGATTG
ATGGGGATCTTTGGCATATGCATAAAGCATTTGTTCTCAATGTCATGCAC
AAATGCGTGACATCTTTTGACAATACCCAGGAAGAATGCTTATGTTTATT
AGAAGAACTTGAAAGTCTTAATAAAAAGGTTATCAATCTTTCTGAGGTTA
TACGTGTTTATACTGTCAATATAATTTCAAGATTTGTCCTGAATAAACGC
TTCAATAGAGACAATCCGATATTCACATTCTTGAGTAAAATGTCCCTTGA
GTTTGCGGAGCGGGCTGACATTTTTCAATTTATTTTCTTTACCCTTCCAA
TTTTCGATAAATTACCTGGGATTTGTAGACTACTAATAGATTTCACTGAC
AGAGGTCGTAAGTTTCGAAAGGCTCAAAATATTTTCCAAGAAGAAATTGA
AGAACACAGGAAAAGATTAGATCTGGATTCGGAAGGTGAAGATCTAATTG
ATTGTTTTCTTATCAAACAGCATCAATTGAAATCCACAACAGGATCTGTT
GGGAGTTTCACTGATATTCAACTGATTCAGAGTTCTTTGGAATTGTTTAT
TGCAGGTTTTGAAACCACCTCGACCATTTTAGAATGGAGCTTCTTGTTTA
TGGCTAGATACAATGATATACAAGAAAACGTTTATAAAGAAATTGTTGAT
AAAATTGGTAAAGAAAGGTTACCAACCATGAAAGACAGAAAGCAGTTGGT
ATATACTCAAGCTGTGATGGATGAAGTATATAGACTGAGTTCTATTTCGC
CTTTGGCGATAATTCACCGAGTGGTAAATGATTGCAACATAGATGGATAT
TTCATTCCAAAAGATTCGTTGGTTCAATCAAATATCTGGGGTTGCCATAC
TGACCCTAACGTTTGGGAGAGACATAAAGAATTTTATCCTCATCATTTTC
TAAAAACGGACGCTGCTGGAAATATCAAATATGATCCAAAACAAGAATTG
AACGCATTCGGAATTGGAAAGAGGCAATGTATTGGAGAATCTCTAGCACG
AATGGAATACTTTATATTTTTTACTTCGGTAATGCAACGGTTCGATGTCA
ACTTTGCGAATTCTGTCAATGAAGTCGAATTTGATAGCGCCATTCGAGGA
TGTGATGGGATCATTCGGAGTCCAGTTTCGTTAAAGGATTATATTTTTAC
GAGAAGAAAGTGAAGATAAACATTAATATTTTGTATTTCTTAGCCCAATA
back to top

protein sequence of SMED30008390-orf-1

>SMED30008390-orf-1 ID=SMED30008390-orf-1|Name=SMED30008390-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=499bp
MIYFIILALFIIAYFLVRSRRKDSRMIPIEKGLPLVGVLLKLKYPVLDYY
EKLARKHGPLFRMRIGMRDIFVLNNYDTIRKAFVENGNNFAGRWKLFQAL
VVTNNSGLVSIDGDLWHMHKAFVLNVMHKCVTSFDNTQEECLCLLEELES
LNKKVINLSEVIRVYTVNIISRFVLNKRFNRDNPIFTFLSKMSLEFAERA
DIFQFIFFTLPIFDKLPGICRLLIDFTDRGRKFRKAQNIFQEEIEEHRKR
LDLDSEGEDLIDCFLIKQHQLKSTTGSVGSFTDIQLIQSSLELFIAGFET
TSTILEWSFLFMARYNDIQENVYKEIVDKIGKERLPTMKDRKQLVYTQAV
MDEVYRLSSISPLAIIHRVVNDCNIDGYFIPKDSLVQSNIWGCHTDPNVW
ERHKEFYPHHFLKTDAAGNIKYDPKQELNAFGIGKRQCIGESLARMEYFI
FFTSVMQRFDVNFANSVNEVEFDSAIRGCDGIIRSPVSLKDYIFTRRK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036396Cyt_P450_sf
IPR001128Cyt_P450
IPR002401Cyt_P450_E_grp-I
IPR017972Cyt_P450_CS
Vocabulary: molecular function
TermDefinition
GO:0020037heme binding
GO:0005506iron ion binding
GO:0016705oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0004497monooxygenase activity
GO:0016491oxidoreductase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 134..154
NoneNo IPR availablePANTHERPTHR24300FAMILY NOT NAMEDcoord: 8..488
NoneNo IPR availableTMHMMTMhelixcoord: 2..19
IPR002401Cytochrome P450, E-class, group IPRINTSPR00463EP450Icoord: 305..331
score: 30.52
coord: 285..302
score: 40.7
coord: 428..438
score: 49.59
coord: 54..73
score: 30.64
coord: 165..183
score: 25.29
coord: 389..413
score: 34.23
coord: 78..99
score: 26.8
coord: 348..366
score: 34.36
coord: 438..461
score: 44.65
IPR001128Cytochrome P450PRINTSPR00385P450coord: 349..360
score: 36.38
coord: 296..313
score: 40.33
coord: 438..449
score: 51.54
coord: 429..438
score: 51.74
IPR001128Cytochrome P450PFAMPF00067p450coord: 29..468
e-value: 1.4E-91
score: 307.6
IPR036396Cytochrome P450 superfamilyGENE3DG3DSA:1.10.630.10coord: 16..497
e-value: 2.8E-112
score: 378.0
IPR036396Cytochrome P450 superfamilySUPERFAMILYSSF48264Cytochrome P450coord: 27..466
IPR017972Cytochrome P450, conserved sitePROSITEPS00086CYTOCHROME_P450coord: 431..440