Centrosomal protein 112

Overview
NameCentrosomal protein 112
Smed IDSMED30008379
Length (bp)3023
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Centrosomal protein 112 (SMED30008379) t-SNE clustered cells

Violin plots show distribution of expression levels for Centrosomal protein 112 (SMED30008379) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Centrosomal protein 112 (SMED30008379) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Centrosomal protein 112 (SMED30008379) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008379

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30008379SMESG000041686.1 dd_Smed_v4_9119_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008379SMESG000041686.1 dd_Smed_v4_9119_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30008379SMESG000041686.1 dd_Smed_v6_9119_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30008379SMESG000041687.1 SMESG000041686.1 Contig14546newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30008379SMESG000041687.1 SMESG000041686.1 Contig14546uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30008379SMESG000041686.1 dd_Smed_v4_9119_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Centrosomal protein 112 vs. Ensembl Human
Match: CEP112 (centrosomal protein 112 [Source:HGNC Symbol;Acc:HGNC:28514])

HSP 1 Score: 181.03 bits (458), Expect = 4.863e-46
Identity = 243/977 (24.87%), Postives = 467/977 (47.80%), Query Frame = 3
Query:   54 IMNEDQTIKSLQLEFDEILTCIKPIYLSWKSQQDKSFIAGWIKKLTNLKNVTLDYMHL--RNLYILALYENLRRDILCDPFTKNPPIDELPPLSNHLRQLIE-------KFSSKYTTPDWLENDEKIDINCLENAVDYEEDDYVGDLKFANDMHDLKQNFLINSEKLNPSKSIEPENGGL--SFGDVYKFHNF-GTDWVR-QSMNQVHEKDTRLIEDQ------EGLKQNLEDSRLKYKPNEYNAFNKVQEKEILLNNISGMERRLAQLQNAYHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDE---IEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLSKEIEEHKKVIENLNEEKAKKISELQ-------SSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQEDCKINFTKKYNNDIDNLQKVVKNNLESYK---KELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQS 2888
            + +E++  + L  EFD  +  +KP  L    + ++   A WI+KL          M    RNLY   L   L+R  L  PFT  P    L  L +++    +       K SS    P W+                      +G+L+ +   H L +++ ++S           E+  L  S  DVY    + G   VR  S++  H +D + I  +      +    +L+DS ++ + N +N                G++ +   ++  +HE+ LKL+ ++++++Q I+ RKN EIE ++T ++ K  E E  ++ LE K    ++   + +ETK  +I ++K+    + ES N++ E K+ N + + + EK  L +++    +   ++T     K++ E+  ++ STN  I +LEA + +L         Q  KL  E+  L    +   ++L E + R   +  + + L+  +E+++  L+   +  +   N+ K E     +KA   IEELE  +  L+ +L ++    K++L +    +  EK   K  YE +   ++ +L   K  ++ KI    + L+ K+ QL +  +   ++ + +   +E+ K+++  N E+   +   + E++E++L      + K+  + + QL + +Q  E ++ E++   + +   L      EK SL +D +    +EIE  +K +   N E   +I E +       +  E++ H+   L+ EL       K +  +L  + E EK +   +H+I +  L  ++  +K+ L++  +      L K N KLK+IE EY ++  +S ++I+EL+ T   LKEE  +   A E    +  +K+    D  ++++++N ++ K    EL N   + R  EK+L+ K+ E ++QI +++ EYETKL  LMP  ++ + E+TI SL++Q++FLQ++  IL++E+T      TYQ 
Sbjct:    3 VGSEEEKWEKLDAEFDHFVVDMKPFVLKLPHRTERQRCALWIRKLCEPSGTGAGIMGRKNRNLYAKLLLHMLKRGALEGPFTHRPEPGTLKILPSYMSIYFDEPNPARAKGSSPEGLPAWV----------------------LGELETSE--HKLNESWKLSS----------GEDNTLVQSPTDVYSREQYTGKLRVRSHSLSPTHREDGQNITPKICEVYSKKSPVSLDDSDIEARLNSWNL---------------GLDMKTKMMEAKFHEEKLKLQQKHDADVQKILERKNNEIEELKTLYRSKQHETEETIRKLEKKVQTLIRDCQVIRETKEDQIAELKKICEQSTESLNNDWEKKLHNAVAEMEQEKFDLQKQHTENIQELLEDTNVRLNKMESEYMAQTQSTNHMIKELEARVQQLTGEAENSNLQRQKLIQEKAELERCYQITCSELQEVKARRNTLHKEKDHLVNDYEQNMKLLQTKYDADI---NLLKQEHALSASKASSMIEELEQNVCQLKQQLQESELQRKQQLRDQENKFQMEKSHLKHIYEKKAHDLQSELDKGKEDTQKKIHKFEEALKEKEEQLTRVTEVQRLQAQQADAALEEFKRQVELNSEKVYAEMKEQMEKVEADLTRSKSLREKQSKEFLWQLEDIRQRYEQQIVELKLEHEQEKTHLLQQHNAEKDSLVRDHE----REIENLEKQLRAANMEHENQIQEFKKRDAQVIADMEAQVHK---LREELINVNSQRKQQLVELGLLREEEKQRATREHEIVVNKLKAESEKMKIELKKTHAAETEMTLEKANSKLKQIEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFE---DEKKQLIRDNDQAIKVLQDELENRSNQVRCAEKKLQHKELESQEQITYIRQEYETKLKGLMPASLRQELEDTISSLKSQVNFLQKRASILQEELT------TYQG 911          
BLAST of Centrosomal protein 112 vs. Ensembl Human
Match: CEP112 (centrosomal protein 112 [Source:HGNC Symbol;Acc:HGNC:28514])

HSP 1 Score: 176.792 bits (447), Expect = 1.153e-44
Identity = 248/1000 (24.80%), Postives = 473/1000 (47.30%), Query Frame = 3
Query:   54 IMNEDQTIKSLQLEFDEILTCIKPIYLSWKSQQDKSFIAGWIKKLTNLKNVTLDYMHL--RNLYILALYENLRRDILCDPFTKNPPIDELPPLSNHLRQLIE-------KFSSKYTTPDW----LENDEKI-----------DINCLENAVD-YEEDDYVGDLKFANDMHDLKQNFLINSEKLNPSKSIEPENGGLSFGDVYKFHNFGTDWVRQSMNQVHEKD--TRL------IEDQEGLKQNLEDSRL---KYKPNEYNAF------NKVQEKEILLNNISGMERRLAQLQNAYHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDE---IEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLSKEIEEHKKVIENLNEEKAKKISELQ-------SSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQEDCKINFTKKYNNDIDNLQKVVKNNLESYK---KELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQS 2888
            + +E++  + L  EFD  +  +KP  L    + ++   A WI+KL          M    RNLY   L   L+R  L  PFT  P    L  L +++    +       K SS    P W    LE  E             D   +++  D Y  + Y G L+             + S  L+P+   + +N      +VY          ++S   + + D   RL      IE+   L+Q      L   K+   + ++F      ++++EKE        ++ +   ++  +HE+ LKL+ ++++++Q I+ RKN EIE ++T ++ K  E E  ++ LE K    ++   + +ETK  +I ++K+    + ES N++ E K+ N + + + EK  L +++    +   ++T     K++ E+  ++ STN  I +LEA + +L         Q  KL  E+  L    +   ++L E + R   +  + + L+  +E+++  L+   +  +   N+ K E     +KA   IEELE  +  L+ +L ++    K++L +    +  EK   K  YE +   ++ +L   K  ++ KI    + L+ K+ QL +  +   ++ + +   +E+ K+++  N E+   +   + E++E++L      + K+  + + QL + +Q  E ++ E++   + +   L      EK SL +D +    +EIE  +K +   N E   +I E +       +  E++ H+   L+ EL       K +  +L  + E EK +   +H+I +  L  ++  +K+ L++  +      L K N KLK+IE EY ++  +S ++I+EL+ T   LKEE  +   A E    +  +K+    D  ++++++N ++ K    EL N   + R  EK+L+ K+ E ++QI +++ EYETKL  LMP  ++ + E+TI SL++Q++FLQ++  IL++E+T      TYQ 
Sbjct:    3 VGSEEEKWEKLDAEFDHFVVDMKPFVLKLPHRTERQRCALWIRKLCEPSGTGAGIMGRKNRNLYAKLLLHMLKRGALEGPFTHRPEPGTLKILPSYMSIYFDEPNPARAKGSSPEGLPAWVLGELETSEHKLNESWKLSSGEDNTLVQSPTDVYSREQYTGKLR-------------VRSHSLSPTHREDGQNITPKICEVYS---------KKSPVSLDDSDIEARLNSWNLGIENPRYLRQKPIPVSLMTPKFSLRKSSSFHDDHFLSRIREKE--------LDMKTKMMEAKFHEEKLKLQQKHDADVQKILERKNNEIEELKTLYRSKQHETEETIRKLEKKVQTLIRDCQVIRETKEDQIAELKKICEQSTESLNNDWEKKLHNAVAEMEQEKFDLQKQHTENIQELLEDTNVRLNKMESEYMAQTQSTNHMIKELEARVQQLTGEAENSNLQRQKLIQEKAELERCYQITCSELQEVKARRNTLHKEKDHLVNDYEQNMKLLQTKYDADI---NLLKQEHALSASKASSMIEELEQNVCQLKQQLQESELQRKQQLRDQENKFQMEKSHLKHIYEKKAHDLQSELDKGKEDTQKKIHKFEEALKEKEEQLTRVTEVQRLQAQQADAALEEFKRQVELNSEKVYAEMKEQMEKVEADLTRSKSLREKQSKEFLWQLEDIRQRYEQQIVELKLEHEQEKTHLLQQHNAEKDSLVRDHE----REIENLEKQLRAANMEHENQIQEFKKRDAQVIADMEAQVHK---LREELINVNSQRKQQLVELGLLREEEKQRATREHEIVVNKLKAESEKMKIELKKTHAAETEMTLEKANSKLKQIEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFE---DEKKQLIRDNDQAIKVLQDELENRSNQVRCAEKKLQHKELESQEQITYIRQEYETKLKGLMPASLRQELEDTISSLKSQVNFLQKRASILQEELT------TYQG 953          
BLAST of Centrosomal protein 112 vs. Ensembl Human
Match: CEP112 (centrosomal protein 112 [Source:HGNC Symbol;Acc:HGNC:28514])

HSP 1 Score: 176.792 bits (447), Expect = 1.153e-44
Identity = 248/1000 (24.80%), Postives = 473/1000 (47.30%), Query Frame = 3
Query:   54 IMNEDQTIKSLQLEFDEILTCIKPIYLSWKSQQDKSFIAGWIKKLTNLKNVTLDYMHL--RNLYILALYENLRRDILCDPFTKNPPIDELPPLSNHLRQLIE-------KFSSKYTTPDW----LENDEKI-----------DINCLENAVD-YEEDDYVGDLKFANDMHDLKQNFLINSEKLNPSKSIEPENGGLSFGDVYKFHNFGTDWVRQSMNQVHEKD--TRL------IEDQEGLKQNLEDSRL---KYKPNEYNAF------NKVQEKEILLNNISGMERRLAQLQNAYHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDE---IEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLSKEIEEHKKVIENLNEEKAKKISELQ-------SSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQEDCKINFTKKYNNDIDNLQKVVKNNLESYK---KELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQS 2888
            + +E++  + L  EFD  +  +KP  L    + ++   A WI+KL          M    RNLY   L   L+R  L  PFT  P    L  L +++    +       K SS    P W    LE  E             D   +++  D Y  + Y G L+             + S  L+P+   + +N      +VY          ++S   + + D   RL      IE+   L+Q      L   K+   + ++F      ++++EKE        ++ +   ++  +HE+ LKL+ ++++++Q I+ RKN EIE ++T ++ K  E E  ++ LE K    ++   + +ETK  +I ++K+    + ES N++ E K+ N + + + EK  L +++    +   ++T     K++ E+  ++ STN  I +LEA + +L         Q  KL  E+  L    +   ++L E + R   +  + + L+  +E+++  L+   +  +   N+ K E     +KA   IEELE  +  L+ +L ++    K++L +    +  EK   K  YE +   ++ +L   K  ++ KI    + L+ K+ QL +  +   ++ + +   +E+ K+++  N E+   +   + E++E++L      + K+  + + QL + +Q  E ++ E++   + +   L      EK SL +D +    +EIE  +K +   N E   +I E +       +  E++ H+   L+ EL       K +  +L  + E EK +   +H+I +  L  ++  +K+ L++  +      L K N KLK+IE EY ++  +S ++I+EL+ T   LKEE  +   A E    +  +K+    D  ++++++N ++ K    EL N   + R  EK+L+ K+ E ++QI +++ EYETKL  LMP  ++ + E+TI SL++Q++FLQ++  IL++E+T      TYQ 
Sbjct:    3 VGSEEEKWEKLDAEFDHFVVDMKPFVLKLPHRTERQRCALWIRKLCEPSGTGAGIMGRKNRNLYAKLLLHMLKRGALEGPFTHRPEPGTLKILPSYMSIYFDEPNPARAKGSSPEGLPAWVLGELETSEHKLNESWKLSSGEDNTLVQSPTDVYSREQYTGKLR-------------VRSHSLSPTHREDGQNITPKICEVYS---------KKSPVSLDDSDIEARLNSWNLGIENPRYLRQKPIPVSLMTPKFSLRKSSSFHDDHFLSRIREKE--------LDMKTKMMEAKFHEEKLKLQQKHDADVQKILERKNNEIEELKTLYRSKQHETEETIRKLEKKVQTLIRDCQVIRETKEDQIAELKKICEQSTESLNNDWEKKLHNAVAEMEQEKFDLQKQHTENIQELLEDTNVRLNKMESEYMAQTQSTNHMIKELEARVQQLTGEAENSNLQRQKLIQEKAELERCYQITCSELQEVKARRNTLHKEKDHLVNDYEQNMKLLQTKYDADI---NLLKQEHALSASKASSMIEELEQNVCQLKQQLQESELQRKQQLRDQENKFQMEKSHLKHIYEKKAHDLQSELDKGKEDTQKKIHKFEEALKEKEEQLTRVTEVQRLQAQQADAALEEFKRQVELNSEKVYAEMKEQMEKVEADLTRSKSLREKQSKEFLWQLEDIRQRYEQQIVELKLEHEQEKTHLLQQHNAEKDSLVRDHE----REIENLEKQLRAANMEHENQIQEFKKRDAQVIADMEAQVHK---LREELINVNSQRKQQLVELGLLREEEKQRATREHEIVVNKLKAESEKMKIELKKTHAAETEMTLEKANSKLKQIEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFE---DEKKQLIRDNDQAIKVLQDELENRSNQVRCAEKKLQHKELESQEQITYIRQEYETKLKGLMPASLRQELEDTISSLKSQVNFLQKRASILQEELT------TYQG 953          
BLAST of Centrosomal protein 112 vs. Ensembl Human
Match: CEP112 (centrosomal protein 112 [Source:HGNC Symbol;Acc:HGNC:28514])

HSP 1 Score: 80.8777 bits (198), Expect = 1.554e-16
Identity = 60/165 (36.36%), Postives = 102/165 (61.82%), Query Frame = 3
Query: 2403 KTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQEDCKINFTKKYNNDIDNLQKVVKNNLESYK---KELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQS 2888
            K N KLK+IE EY ++  +S ++I+EL+ T   LKEE  +   A E    +  +K+    D  ++++++N ++ K    EL N   + R  EK+L+ K+ E ++QI +++ EYETKL  LMP  ++ + E+TI SL++Q++FLQ++  IL++E+T      TYQ 
Sbjct:   54 KANSKLKQIEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFE---DEKKQLIRDNDQAIKVLQDELENRSNQVRCAEKKLQHKELESQEQITYIRQEYETKLKGLMPASLRQELEDTISSLKSQVNFLQKRASILQEELT------TYQG 209          
BLAST of Centrosomal protein 112 vs. Ensembl Human
Match: CEP112 (centrosomal protein 112 [Source:HGNC Symbol;Acc:HGNC:28514])

HSP 1 Score: 70.0922 bits (170), Expect = 1.266e-11
Identity = 129/544 (23.71%), Postives = 237/544 (43.57%), Query Frame = 3
Query:  165 IAGWIKKLTNLKNVTLDYMHL--RNLYILALYENLRRDILCDPFTKNPPIDELPPLSNHLRQLIE-------KFSSKYTTPDW----LENDEKI-----------DINCLENAVD-YEEDDYVGDLKFANDMHDLKQNFLINSEKLNPSKSIEPENGGLSFGDVYKFHNFGTDWVRQSMNQVHEKD--TRL------IEDQEGLKQNLEDSRL---KYKPNEYNAF------NKVQEKEILLNNISGMERRLAQLQNAYHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDE---IEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYE 1661
             A WI+KL          M    RNLY   L   L+R  L  PFT  P    L  L +++    +       K SS    P W    LE  E             D   +++  D Y  + Y G L+             + S  L+P+   + +N      +VY          ++S   + + D   RL      IE+   L+Q      L   K+   + ++F      ++++EKE        ++ +   ++  +HE+ LKL+ ++++++Q I+ RKN EIE ++T ++ K  E E  ++ LE K    ++   + +ETK  +I ++K+    + ES N++ E K+ N + + + EK  L +++    +   ++T     K++ E+  ++ STN  I +LEA + +L         Q  KL  E+  L    +   ++L E + R   +  + + L+  +E+++  L+   +  +   N+ K E     +KA   IEELE  +  L+ +L ++    K++L +    +  EK   K  YE
Sbjct:   40 CALWIRKLCEPSGTGAGIMGRKNRNLYAKLLLHMLKRGALEGPFTHRPEPGTLKILPSYMSIYFDEPNPARAKGSSPEGLPAWVLGELETSEHKLNESWKLSSGEDNTLVQSPTDVYSREQYTGKLR-------------VRSHSLSPTHREDGQNITPKICEVYS---------KKSPVSLDDSDIEARLNSWNLGIENPRYLRQKPIPVSLMTPKFSLRKSSSFHDDHFLSRIREKE--------LDMKTKMMEAKFHEEKLKLQQKHDADVQKILERKNNEIEELKTLYRSKQHETEETIRKLEKKVQTLIRDCQVIRETKEDQIAELKKICEQSTESLNNDWEKKLHNAVAEMEQEKFDLQKQHTENIQELLEDTNVRLNKMESEYMAQTQSTNHMIKELEARVQQLTGEAENSNLQRQKLIQEKAELERCYQITCSELQEVKARRNTLHKEKDHLVNDYEQNMKLLQTKYDADI---NLLKQEHALSASKASSMIEELEQNVCQLKQQLQESELQRKQQLRDQENKFQMEKSHLKHIYE 550          
BLAST of Centrosomal protein 112 vs. Ensembl Zebrafish
Match: cep112 (centrosomal protein 112 [Source:ZFIN;Acc:ZDB-GENE-120104-2])

HSP 1 Score: 111.309 bits (277), Expect = 2.418e-24
Identity = 157/716 (21.93%), Postives = 367/716 (51.26%), Query Frame = 3
Query:  780 MERRLAQLQNAYHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELK---NSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDEIE-----AKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLSKEIEEHKKVI---ENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQEDCKINFTKKY--------NNDIDNLQKVVKNNLESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNM 2870
            +E R   L+  + ED L+++ ++++EIQ I++RKN EI+ +++ ++ K +E E  ++ LE +    +++  + ++TK K+I ++K+    + ES  +E E K+   +   + EK +L +++    +   ++T +   K++ E++ +  +T   + +LE  + +L     S N +     K+  E+  L  ++  +  +L E+ +R   +  + +++ + +E+ +  L+     A H A+++  + E     AKA + I++LE  +  L+ ++ +A     ++L +    +  E    + + E +L++++ +L   +   + KI  +   L  K+ QL +       + + +   +E+ K+++  + E+       + E++E++L      + K+  +   QL   +Q+ E ++ E++   + +   L      EK SL +D Q ++    ++ +  +   +   +E  K+ ++  S  E++ H    L++E+       K +  +L  + E E+ +  +DH+ AL+ L  +   ++ +LE+           KT+ ++K +E EY ++  +S ++ISEL+ +   +KE+  +   + E  K+   + Y        N D D   K++   +E+ +++L+       ++EK+L  ++ E ++QI  ++ E E K+  LMP E+Q + E+TI SL++Q+SFLQ++  +L++++ + ++
Sbjct:  244 VELRTKVLEAKHQEDTLRMQQKHDAEIQKILDRKNGEIDELKSLYRGKQKEAEETVRRLEKRVQSLLRESQVIRQTKEKQISELKKMSDQSAESLKNEWEKKLHAAVAHMEQEKSELQKKHTENIQELLEDTNQRLAKMEAEYSGQMQATEHIVRELETRVKQLSVEVESGNLL---RQKVTQEKAELELQIASISAELQEANQRSTTLQKEMDQMRVHYEEALQKLQ-----ARHNADMSHFQQEHAVSAAKASEVIQDLEQTVIHLKQQIQEAESRRHRQLRDQENKWQQEITDMQNSTEKKLQTLQAELEKERADRKRKISKMEDSLRDKEEQLVRVRDSQRHQAQQAESALENFKKQVELSSEKTYADMKQQMEKVEADLIRSKSLREKQCKEFRHQLEELQQKYEQQIVELKLQHEQERTHLLQTHNAEKDSLVQDHQREIDSLDKQTRAAMVQQQTQTQEWRKRDAQTISDLEAQVHS---LRKEVLAAHSQRKQQLMELGVLREEERQRSAQDHQAALDRLRAEMEQVRQDLEKTHKAERELAQEKTSSRIKHLEKEYQQKMAKSAQVISELQASLSSVKEDSRQTQQSLER-KLQAAQSYWDEEKTQLNRDADQSNKILHERVETLQRQLN-------AVEKKLMNRELEYQEQITHVRQECELKIKGLMPAELQQELEDTITSLKSQVSFLQKRASVLQEQLDAGHI 940          
BLAST of Centrosomal protein 112 vs. Ensembl Zebrafish
Match: cep112 (centrosomal protein 112 [Source:ZFIN;Acc:ZDB-GENE-120104-2])

HSP 1 Score: 102.449 bits (254), Expect = 1.087e-21
Identity = 159/713 (22.30%), Postives = 356/713 (49.93%), Query Frame = 3
Query:  780 MERRLAQLQNAYHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELK---NSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDEIE-----AKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLSKEIEEHKKVIENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQEDCKINFTKKY--------NNDIDNLQKVVKNNLESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNM 2870
            +E R   L+  + ED L+++ ++++EIQ I++RKN EI+ +++ ++ K +E E  ++ LE +    +++  + ++TK K+I ++K+    + ES  +E E K+   +   + EK +L +++    +   ++T +   K++ E++ +  +T   + +LE  + +L     S N +     K+  E+  L  ++  +  +L E+ +R   +  + +++ + +E+ +  L+     A H A+++  + E     AKA + I++LE  +  L+ ++ +A     ++L +    +  E    + + E +L++++ +L   +   + KI  +   L  K+ QL +               V D     S  H+ Q  +   E  + + EL  E     K   D+ +Q+   K + E + + + +  +++   L  D ++E  SL+K    Q    + + +   +   +  A+ IS+L++   S       L++E+       K +  +L  + E E+ +  +DH+ AL+ L  +   ++ +LE+           KT+ ++K +E EY ++  +S ++ISEL+ +   +KE+  +   + E  K+   + Y        N D D   K++   +E+ +++L+       ++EK+L  ++ E ++QI  ++ E E K+  LMP E+Q + E+TI SL++Q+SFLQ++  +L++++ + ++
Sbjct:  244 VELRTKVLEAKHQEDTLRMQQKHDAEIQKILDRKNGEIDELKSLYRGKQKEAEETVRRLEKRVQSLLRESQVIRQTKEKQISELKKMSDQSAESLKNEWEKKLHAAVAHMEQEKSELQKKHTENIQELLEDTNQRLAKMEAEYSGQMQATEHIVRELETRVKQLSVEVESGNLL---RQKVTQEKAELELQIASISAELQEANQRSTTLQKEMDQMRVHYEEALQKLQ-----ARHNADMSHFQQEHAVSAAKASEVIQDLEQTVIHLKQQIQEAESRRHRQLRDQENKWQQEITDMQNSTEKKLQTLQAELEKERADRKRKISKMEDSLRDKEEQLVR---------------VRD-----SQRHQAQQAESALENFKKQVELSSE-----KTYADMKQQIVELKLQHEQERTHLLQTHNAEKDSLVQDHQREIDSLDK----QTRAAMVQQQTQTQEWRKRDAQTISDLEAQVHS-------LRKEVLAAHSQRKQQLMELGVLREEERQRSAQDHQAALDRLRAEMEQVRQDLEKTHKAERELAQEKTSSRIKHLEKEYQQKMAKSAQVISELQASLSSVKEDSRQTQQSLER-KLQAAQSYWDEEKTQLNRDADQSNKILHERVETLQRQLN-------AVEKKLMNRELEYQEQITHVRQECELKIKGLMPAELQQELEDTITSLKSQVSFLQKRASVLQEQLDAGHI 904          
BLAST of Centrosomal protein 112 vs. Ensembl Xenopus
Match: mtg2 (mitochondrial ribosome-associated GTPase 2 [Source:Xenbase;Acc:XB-GENE-974614])

HSP 1 Score: 54.6842 bits (130), Expect = 1.366e-8
Identity = 31/87 (35.63%), Postives = 57/87 (65.52%), Query Frame = 3
Query: 2595 KVVKNNLESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEV 2855
            KV+K+ +E+Y  EL       R+ EK+L+ K+   ++Q+  ++ EYE K+  LMP  V+ + E TI SL++Q++FLQ++  +L+ ++
Sbjct:   11 KVLKDEVENYSLEL-------RATEKKLQEKELAAQEQVTQIRQEYELKIKGLMPATVRQELEGTITSLKSQVNFLQKRAQLLQADL 90          
BLAST of Centrosomal protein 112 vs. Ensembl Mouse
Match: Cep112 (centrosomal protein 112 [Source:MGI Symbol;Acc:MGI:1923673])

HSP 1 Score: 176.407 bits (446), Expect = 1.031e-44
Identity = 232/963 (24.09%), Postives = 461/963 (47.87%), Query Frame = 3
Query:   60 NEDQTIKSLQLEFDEILTCIKPIYLSWKSQQDKSFIAGWIKKLTNLKNVTLDYMHL--RNLYILALYENLRRDILCDPFTKNPPIDELPPLSNHLR-------QLIEKFSSKYTTPDWLENDEKIDINCLENAVDYEEDDYVGDLKFANDMH--DLKQNFLINSEKLNPSKSIEPENGGLSFGDVYKFHNFGTDWVRQSMNQVHEKDTRLIEDQEGLKQNLEDSRLKYKPNEYNAFNKVQEKEILLNNISGMERRLAQLQNAYHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDE---IEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQ---LSKEIEEHKKVIENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQEDCKINFTKKYNNDIDNLQKVVKNN---LESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQS 2888
            +E++  + L  EFD  +  +KP  L    + ++   A WI+KL          M    RNLY   L   LRR IL  PFT  P    L  L +++        Q   K SS    PDW+  + +     L ++      +    +  A+D H         + S  ++P+   + ++                  +   + +VH K + +         +L+DS ++ + N +N                G++ +   ++  + E+ LKL+ ++++E+Q I+ RKN E+E ++  +K+K  E E  ++ LE K    ++   + +ETK  +I ++K+    + ES N++ E K+ N + + + +K +L + +    +   ++T     K++ ++  +  STN  I +LE  + +L         Q  KL  E+  L    +   N+L E + R   +  +   L+  +E+++  LK   ++ +   N+ + E     +K    IEELE  I  L+ ++ ++    K+++++    +  EK   K  YE ++  ++ +L   K  ++ KI    + L+ K+ QL++  +   ++ + +   +E+ K+++  N E+   +   + E++E++L      + K+  + + QL + KQ  E ++ E++   + +   L      EK SL +D   +   L K++       EN  +E  K+ +++ +  E++ H+   L+ EL       K +  +L  + E EK +  +DH+ A++ L  ++  +K+ L++  +      L K N +LK+IE EY ++  +S ++I+EL+ T   LKEE      A E    +  +K+    D  Q+++++N   +++ + EL     + RS EK+L  K+ E ++QI +++ EYETK   LMP  ++ + E+TI SL++Q++FLQ++  IL++E+T      TYQS
Sbjct:    5 SEEEKWEKLDAEFDHFVVDMKPFVLKLPHRSERQRCALWIRKLCEPSGTGAGLMGRKNRNLYAKLLLHMLRRGILEGPFTHRPEPGTLKTLPSYMSIYFDEPNQAQPKDSSPEKLPDWVRGELQTGEQRLSDSWQCSSGEDNTLVLAASDAHREQYTGKLRMRSHSVSPTYREDKQH------------------ITSKICEVHSKTSPI---------SLDDSDIEVRLNSWNL---------------GLDMKTKMMEAKFSEEKLKLQQKHDAEVQKILERKNNELEELKILYKKKQTETEETIRKLEKKVQILIRDCQVIRETKENQITELKKICEQSTESLNNDWEKKLHNAVAEMEKDKFELQKHHTETIQELLEDTNVRLSKMEADYVVQMQSTNHMIKELEGRVQQLMGEAENSNLQRQKLTQEKLELERCYQITCNELQELKTRRNILHKEKEHLVNDYEQNVKLLKTKYDSDI---NLLRQEHALSTSKTSGVIEELEQNICQLKQQVQESELQRKQQVKDQENKFHMEKNHLKHTYEKKVHELQSELDKEKEDAQRKIHKFEEALKEKEEQLSRVTEVQRLQAQQADAALEEFKRQVEVNSEKVYGEMKEQMEKVEADLTRSKSLREKQSKEFLWQLEDAKQRYEQQIVELKLEHEQEKTHLLQQHSAEKDSLVRDHDREIENLEKQLRAANMEHENQIQESKKRDAQVIADMEAQVHK---LREELISVNSQRKQQLIELGLLREEEKQRAAKDHETAVKKLKAESERVKMELKKTHAAETEMTLEKANSRLKQIEKEYTQKLAKSSQIIAELQTTISSLKEESSRQQLAAERRLQDVIQKFE---DEKQQLIRDNDQAIKALQDELETRSHQVRSAEKKLHHKELEAQEQIMYIRQEYETKFKGLMPASLRQELEDTISSLKSQVNFLQKRASILQEELT------TYQS 910          
BLAST of Centrosomal protein 112 vs. Ensembl Mouse
Match: Cep112 (centrosomal protein 112 [Source:MGI Symbol;Acc:MGI:1923673])

HSP 1 Score: 169.859 bits (429), Expect = 1.580e-42
Identity = 243/1006 (24.16%), Postives = 475/1006 (47.22%), Query Frame = 3
Query:   15 GYRY*HLILNL--RII--MNEDQTIKSLQLEFDEILTCIKPIYLSWKSQQDKSFIAGWIKKLTNLKNVTLDYMHL--RNLYILALYENLRRDILCDPFTKNPPIDELPPLSNHLR-------QLIEKFSSKYTTPDWLENDEKI---------------DINCLENAVDYEEDDYVGDLKFANDMHDLKQNFLINSEKLNPSKS-IEPENGGLSFGDV-----YKFHNFGTD---WVRQSMNQVHEKDTRLIEDQEGLKQ--NLEDSRLKYKPNEYNAFNKVQEKEILLNNISGMERRLAQLQNAYHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDE---IEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQ---LSKEIEEHKKVIENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQEDCKINFTKKYNNDIDNLQKVVKNN---LESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQS 2888
            G R   L++    RI+   +E++  + L  EFD  +  +KP  L    + ++   A WI+KL          M    RNLY   L   LRR IL  PFT  P    L  L +++        Q   K SS    PDW+  + +                D   +  A D   + Y G L+  +  H +   +  + + +      +  +   +S  D          N G +   ++RQ    V      L+  +  L++  +L D             +++ EKE        ++ +   ++  + E+ LKL+ ++++E+Q I+ RKN E+E ++  +K+K  E E  ++ LE K    ++   + +ETK  +I ++K+    + ES N++ E K+ N + + + +K +L + +    +   ++T     K++ ++  +  STN  I +LE  + +L         Q  KL  E+  L    +   N+L E + R   +  +   L+  +E+++  LK   ++ +   N+ + E     +K    IEELE  I  L+ ++ ++    K+++++    +  EK   K  YE ++  ++ +L   K  ++ KI    + L+ K+ QL++  +   ++ + +   +E+ K+++  N E+   +   + E++E++L      + K+  + + QL + KQ  E ++ E++   + +   L      EK SL +D   +   L K++       EN  +E  K+ +++ +  E++ H+   L+ EL       K +  +L  + E EK +  +DH+ A++ L  ++  +K+ L++  +      L K N +LK+IE EY ++  +S ++I+EL+ T   LKEE      A E    +  +K+    D  Q+++++N   +++ + EL     + RS EK+L  K+ E ++QI +++ EYETK   LMP  ++ + E+TI SL++Q++FLQ++  IL++E+T      TYQS
Sbjct:   38 GGRVDGLLVGAPDRIMETGSEEEKWEKLDAEFDHFVVDMKPFVLKLPHRSERQRCALWIRKLCEPSGTGAGLMGRKNRNLYAKLLLHMLRRGILEGPFTHRPEPGTLKTLPSYMSIYFDEPNQAQPKDSSPEKLPDWVRGELQTGEQRLSDSWQCSSGEDNTLVLAASDAHREQYTGKLRMRS--HSVSPTYREDKQHITSKICEVHSKTSPISLDDSDIEVRLNSWNLGIENPRYLRQKPLPVS-----LMTPKGSLRKASSLHDDHF---------LSRMHEKE--------LDMKTKMMEAKFSEEKLKLQQKHDAEVQKILERKNNELEELKILYKKKQTETEETIRKLEKKVQILIRDCQVIRETKENQITELKKICEQSTESLNNDWEKKLHNAVAEMEKDKFELQKHHTETIQELLEDTNVRLSKMEADYVVQMQSTNHMIKELEGRVQQLMGEAENSNLQRQKLTQEKLELERCYQITCNELQELKTRRNILHKEKEHLVNDYEQNVKLLKTKYDSDI---NLLRQEHALSTSKTSGVIEELEQNICQLKQQVQESELQRKQQVKDQENKFHMEKNHLKHTYEKKVHELQSELDKEKEDAQRKIHKFEEALKEKEEQLSRVTEVQRLQAQQADAALEEFKRQVEVNSEKVYGEMKEQMEKVEADLTRSKSLREKQSKEFLWQLEDAKQRYEQQIVELKLEHEQEKTHLLQQHSAEKDSLVRDHDREIENLEKQLRAANMEHENQIQESKKRDAQVIADMEAQVHK---LREELISVNSQRKQQLIELGLLREEEKQRAAKDHETAVKKLKAESERVKMELKKTHAAETEMTLEKANSRLKQIEKEYTQKLAKSSQIIAELQTTISSLKEESSRQQLAAERRLQDVIQKFE---DEKQQLIRDNDQAIKALQDELETRSHQVRSAEKKLHHKELEAQEQIMYIRQEYETKFKGLMPASLRQELEDTISSLKSQVNFLQKRASILQEELT------TYQS 1004          
BLAST of Centrosomal protein 112 vs. Ensembl Mouse
Match: Cep112 (centrosomal protein 112 [Source:MGI Symbol;Acc:MGI:1923673])

HSP 1 Score: 169.474 bits (428), Expect = 1.827e-42
Identity = 238/987 (24.11%), Postives = 467/987 (47.32%), Query Frame = 3
Query:   60 NEDQTIKSLQLEFDEILTCIKPIYLSWKSQQDKSFIAGWIKKLTNLKNVTLDYMHL--RNLYILALYENLRRDILCDPFTKNPPIDELPPLSNHLR-------QLIEKFSSKYTTPDWLENDEKI---------------DINCLENAVDYEEDDYVGDLKFANDMHDLKQNFLINSEKLNPSKS-IEPENGGLSFGDV-----YKFHNFGTD---WVRQSMNQVHEKDTRLIEDQEGLKQ--NLEDSRLKYKPNEYNAFNKVQEKEILLNNISGMERRLAQLQNAYHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDE---IEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQ---LSKEIEEHKKVIENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQEDCKINFTKKYNNDIDNLQKVVKNN---LESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQS 2888
            +E++  + L  EFD  +  +KP  L    + ++   A WI+KL          M    RNLY   L   LRR IL  PFT  P    L  L +++        Q   K SS    PDW+  + +                D   +  A D   + Y G L+  +  H +   +  + + +      +  +   +S  D          N G +   ++RQ    V      L+  +  L++  +L D             +++ EKE        ++ +   ++  + E+ LKL+ ++++E+Q I+ RKN E+E ++  +K+K  E E  ++ LE K    ++   + +ETK  +I ++K+    + ES N++ E K+ N + + + +K +L + +    +   ++T     K++ ++  +  STN  I +LE  + +L         Q  KL  E+  L    +   N+L E + R   +  +   L+  +E+++  LK   ++ +   N+ + E     +K    IEELE  I  L+ ++ ++    K+++++    +  EK   K  YE ++  ++ +L   K  ++ KI    + L+ K+ QL++  +   ++ + +   +E+ K+++  N E+   +   + E++E++L      + K+  + + QL + KQ  E ++ E++   + +   L      EK SL +D   +   L K++       EN  +E  K+ +++ +  E++ H+   L+ EL       K +  +L  + E EK +  +DH+ A++ L  ++  +K+ L++  +      L K N +LK+IE EY ++  +S ++I+EL+ T   LKEE      A E    +  +K+    D  Q+++++N   +++ + EL     + RS EK+L  K+ E ++QI +++ EYETK   LMP  ++ + E+TI SL++Q++FLQ++  IL++E+T      TYQS
Sbjct:    5 SEEEKWEKLDAEFDHFVVDMKPFVLKLPHRSERQRCALWIRKLCEPSGTGAGLMGRKNRNLYAKLLLHMLRRGILEGPFTHRPEPGTLKTLPSYMSIYFDEPNQAQPKDSSPEKLPDWVRGELQTGEQRLSDSWQCSSGEDNTLVLAASDAHREQYTGKLRMRS--HSVSPTYREDKQHITSKICEVHSKTSPISLDDSDIEVRLNSWNLGIENPRYLRQKPLPV-----SLMTPKGSLRKASSLHDDHF---------LSRMHEKE--------LDMKTKMMEAKFSEEKLKLQQKHDAEVQKILERKNNELEELKILYKKKQTETEETIRKLEKKVQILIRDCQVIRETKENQITELKKICEQSTESLNNDWEKKLHNAVAEMEKDKFELQKHHTETIQELLEDTNVRLSKMEADYVVQMQSTNHMIKELEGRVQQLMGEAENSNLQRQKLTQEKLELERCYQITCNELQELKTRRNILHKEKEHLVNDYEQNVKLLKTKYDSDI---NLLRQEHALSTSKTSGVIEELEQNICQLKQQVQESELQRKQQVKDQENKFHMEKNHLKHTYEKKVHELQSELDKEKEDAQRKIHKFEEALKEKEEQLSRVTEVQRLQAQQADAALEEFKRQVEVNSEKVYGEMKEQMEKVEADLTRSKSLREKQSKEFLWQLEDAKQRYEQQIVELKLEHEQEKTHLLQQHSAEKDSLVRDHDREIENLEKQLRAANMEHENQIQESKKRDAQVIADMEAQVHK---LREELISVNSQRKQQLIELGLLREEEKQRAAKDHETAVKKLKAESERVKMELKKTHAAETEMTLEKANSRLKQIEKEYTQKLAKSSQIIAELQTTISSLKEESSRQQLAAERRLQDVIQKFE---DEKQQLIRDNDQAIKALQDELETRSHQVRSAEKKLHHKELEAQEQIMYIRQEYETKFKGLMPASLRQELEDTISSLKSQVNFLQKRASILQEELT------TYQS 952          
BLAST of Centrosomal protein 112 vs. Ensembl Mouse
Match: Cep112 (centrosomal protein 112 [Source:MGI Symbol;Acc:MGI:1923673])

HSP 1 Score: 169.474 bits (428), Expect = 1.827e-42
Identity = 238/987 (24.11%), Postives = 467/987 (47.32%), Query Frame = 3
Query:   60 NEDQTIKSLQLEFDEILTCIKPIYLSWKSQQDKSFIAGWIKKLTNLKNVTLDYMHL--RNLYILALYENLRRDILCDPFTKNPPIDELPPLSNHLR-------QLIEKFSSKYTTPDWLENDEKI---------------DINCLENAVDYEEDDYVGDLKFANDMHDLKQNFLINSEKLNPSKS-IEPENGGLSFGDV-----YKFHNFGTD---WVRQSMNQVHEKDTRLIEDQEGLKQ--NLEDSRLKYKPNEYNAFNKVQEKEILLNNISGMERRLAQLQNAYHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDE---IEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQ---LSKEIEEHKKVIENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQEDCKINFTKKYNNDIDNLQKVVKNN---LESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQS 2888
            +E++  + L  EFD  +  +KP  L    + ++   A WI+KL          M    RNLY   L   LRR IL  PFT  P    L  L +++        Q   K SS    PDW+  + +                D   +  A D   + Y G L+  +  H +   +  + + +      +  +   +S  D          N G +   ++RQ    V      L+  +  L++  +L D             +++ EKE        ++ +   ++  + E+ LKL+ ++++E+Q I+ RKN E+E ++  +K+K  E E  ++ LE K    ++   + +ETK  +I ++K+    + ES N++ E K+ N + + + +K +L + +    +   ++T     K++ ++  +  STN  I +LE  + +L         Q  KL  E+  L    +   N+L E + R   +  +   L+  +E+++  LK   ++ +   N+ + E     +K    IEELE  I  L+ ++ ++    K+++++    +  EK   K  YE ++  ++ +L   K  ++ KI    + L+ K+ QL++  +   ++ + +   +E+ K+++  N E+   +   + E++E++L      + K+  + + QL + KQ  E ++ E++   + +   L      EK SL +D   +   L K++       EN  +E  K+ +++ +  E++ H+   L+ EL       K +  +L  + E EK +  +DH+ A++ L  ++  +K+ L++  +      L K N +LK+IE EY ++  +S ++I+EL+ T   LKEE      A E    +  +K+    D  Q+++++N   +++ + EL     + RS EK+L  K+ E ++QI +++ EYETK   LMP  ++ + E+TI SL++Q++FLQ++  IL++E+T      TYQS
Sbjct:    5 SEEEKWEKLDAEFDHFVVDMKPFVLKLPHRSERQRCALWIRKLCEPSGTGAGLMGRKNRNLYAKLLLHMLRRGILEGPFTHRPEPGTLKTLPSYMSIYFDEPNQAQPKDSSPEKLPDWVRGELQTGEQRLSDSWQCSSGEDNTLVLAASDAHREQYTGKLRMRS--HSVSPTYREDKQHITSKICEVHSKTSPISLDDSDIEVRLNSWNLGIENPRYLRQKPLPV-----SLMTPKGSLRKASSLHDDHF---------LSRMHEKE--------LDMKTKMMEAKFSEEKLKLQQKHDAEVQKILERKNNELEELKILYKKKQTETEETIRKLEKKVQILIRDCQVIRETKENQITELKKICEQSTESLNNDWEKKLHNAVAEMEKDKFELQKHHTETIQELLEDTNVRLSKMEADYVVQMQSTNHMIKELEGRVQQLMGEAENSNLQRQKLTQEKLELERCYQITCNELQELKTRRNILHKEKEHLVNDYEQNVKLLKTKYDSDI---NLLRQEHALSTSKTSGVIEELEQNICQLKQQVQESELQRKQQVKDQENKFHMEKNHLKHTYEKKVHELQSELDKEKEDAQRKIHKFEEALKEKEEQLSRVTEVQRLQAQQADAALEEFKRQVEVNSEKVYGEMKEQMEKVEADLTRSKSLREKQSKEFLWQLEDAKQRYEQQIVELKLEHEQEKTHLLQQHSAEKDSLVRDHDREIENLEKQLRAANMEHENQIQESKKRDAQVIADMEAQVHK---LREELISVNSQRKQQLIELGLLREEEKQRAAKDHETAVKKLKAESERVKMELKKTHAAETEMTLEKANSRLKQIEKEYTQKLAKSSQIIAELQTTISSLKEESSRQQLAAERRLQDVIQKFE---DEKQQLIRDNDQAIKALQDELETRSHQVRSAEKKLHHKELEAQEQIMYIRQEYETKFKGLMPASLRQELEDTISSLKSQVNFLQKRASILQEELT------TYQS 952          
BLAST of Centrosomal protein 112 vs. Ensembl Mouse
Match: Cep112 (centrosomal protein 112 [Source:MGI Symbol;Acc:MGI:1923673])

HSP 1 Score: 80.4925 bits (197), Expect = 7.548e-17
Identity = 58/164 (35.37%), Postives = 100/164 (60.98%), Query Frame = 3
Query: 2406 TNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQEDCKINFTKKYNNDIDNLQKVVKNN---LESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQS 2888
             N +LK+IE EY ++  +S ++I+EL+ T   LKEE      A E    +  +K+    D  Q+++++N   +++ + EL     + RS EK+L  K+ E ++QI +++ EYETK   LMP  ++ + E+TI SL++Q++FLQ++  IL++E+T      TYQS
Sbjct:   17 ANSRLKQIEKEYTQKLAKSSQIIAELQTTISSLKEESSRQQLAAERRLQDVIQKFE---DEKQQLIRDNDQAIKALQDELETRSHQVRSAEKKLHHKELEAQEQIMYIRQEYETKFKGLMPASLRQELEDTISSLKSQVNFLQKRASILQEELT------TYQS 171          
BLAST of Centrosomal protein 112 vs. UniProt/SwissProt
Match: sp|Q8N8E3|CE112_HUMAN (Centrosomal protein of 112 kDa OS=Homo sapiens OX=9606 GN=CEP112 PE=1 SV=2)

HSP 1 Score: 176.792 bits (447), Expect = 5.538e-44
Identity = 248/1000 (24.80%), Postives = 473/1000 (47.30%), Query Frame = 3
Query:   54 IMNEDQTIKSLQLEFDEILTCIKPIYLSWKSQQDKSFIAGWIKKLTNLKNVTLDYMHL--RNLYILALYENLRRDILCDPFTKNPPIDELPPLSNHLRQLIE-------KFSSKYTTPDW----LENDEKI-----------DINCLENAVD-YEEDDYVGDLKFANDMHDLKQNFLINSEKLNPSKSIEPENGGLSFGDVYKFHNFGTDWVRQSMNQVHEKD--TRL------IEDQEGLKQNLEDSRL---KYKPNEYNAF------NKVQEKEILLNNISGMERRLAQLQNAYHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDE---IEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLSKEIEEHKKVIENLNEEKAKKISELQ-------SSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQEDCKINFTKKYNNDIDNLQKVVKNNLESYK---KELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQS 2888
            + +E++  + L  EFD  +  +KP  L    + ++   A WI+KL          M    RNLY   L   L+R  L  PFT  P    L  L +++    +       K SS    P W    LE  E             D   +++  D Y  + Y G L+             + S  L+P+   + +N      +VY          ++S   + + D   RL      IE+   L+Q      L   K+   + ++F      ++++EKE        ++ +   ++  +HE+ LKL+ ++++++Q I+ RKN EIE ++T ++ K  E E  ++ LE K    ++   + +ETK  +I ++K+    + ES N++ E K+ N + + + EK  L +++    +   ++T     K++ E+  ++ STN  I +LEA + +L         Q  KL  E+  L    +   ++L E + R   +  + + L+  +E+++  L+   +  +   N+ K E     +KA   IEELE  +  L+ +L ++    K++L +    +  EK   K  YE +   ++ +L   K  ++ KI    + L+ K+ QL +  +   ++ + +   +E+ K+++  N E+   +   + E++E++L      + K+  + + QL + +Q  E ++ E++   + +   L      EK SL +D +    +EIE  +K +   N E   +I E +       +  E++ H+   L+ EL       K +  +L  + E EK +   +H+I +  L  ++  +K+ L++  +      L K N KLK+IE EY ++  +S ++I+EL+ T   LKEE  +   A E    +  +K+    D  ++++++N ++ K    EL N   + R  EK+L+ K+ E ++QI +++ EYETKL  LMP  ++ + E+TI SL++Q++FLQ++  IL++E+T      TYQ 
Sbjct:    3 VGSEEEKWEKLDAEFDHFVVDMKPFVLKLPHRTERQRCALWIRKLCEPSGTGAGIMGRKNRNLYAKLLLHMLKRGALEGPFTHRPEPGTLKILPSYMSIYFDEPNPARAKGSSPEGLPAWVLGELETSEHKLNESWKLSSGEDNTLVQSPTDVYSREQYTGKLR-------------VRSHSLSPTHREDGQNITPKICEVYS---------KKSPVSLDDSDIEARLNSWNLGIENPRYLRQKPIPVSLMTPKFSLRKSSSFHDDHFLSRIREKE--------LDMKTKMMEAKFHEEKLKLQQKHDADVQKILERKNNEIEELKTLYRSKQHETEETIRKLEKKVQTLIRDCQVIRETKEDQIAELKKICEQSTESLNNDWEKKLHNAVAEMEQEKFDLQKQHTENIQELLEDTNVRLNKMESEYMAQTQSTNHMIKELEARVQQLTGEAENSNLQRQKLIQEKAELERCYQITCSELQEVKARRNTLHKEKDHLVNDYEQNMKLLQTKYDADI---NLLKQEHALSASKASSMIEELEQNVCQLKQQLQESELQRKQQLRDQENKFQMEKSHLKHIYEKKAHDLQSELDKGKEDTQKKIHKFEEALKEKEEQLTRVTEVQRLQAQQADAALEEFKRQVELNSEKVYAEMKEQMEKVEADLTRSKSLREKQSKEFLWQLEDIRQRYEQQIVELKLEHEQEKTHLLQQHNAEKDSLVRDHE----REIENLEKQLRAANMEHENQIQEFKKRDAQVIADMEAQVHK---LREELINVNSQRKQQLVELGLLREEEKQRATREHEIVVNKLKAESEKMKIELKKTHAAETEMTLEKANSKLKQIEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFE---DEKKQLIRDNDQAIKVLQDELENRSNQVRCAEKKLQHKELESQEQITYIRQEYETKLKGLMPASLRQELEDTISSLKSQVNFLQKRASILQEELT------TYQG 953          
BLAST of Centrosomal protein 112 vs. UniProt/SwissProt
Match: sp|Q5PR68|CE112_MOUSE (Centrosomal protein of 112 kDa OS=Mus musculus OX=10090 GN=Cep112 PE=2 SV=2)

HSP 1 Score: 148.673 bits (374), Expect = 3.896e-35
Identity = 226/933 (24.22%), Postives = 445/933 (47.70%), Query Frame = 3
Query:  228 RNLYILALYENLRRDILCDPFTKNPPIDELPPLSNHLR-------QLIEKFSSKYTTPDWLENDEKI---------------DINCLENAVDYEEDDYVGDLKFANDMHDLKQNFLINSEKLNPSKS-IEPENGGLSFGDV-----YKFHNFGTD---WVRQSMNQVHEKDTRLIEDQEGLKQ--NLEDSRLKYKPNEYNAFNKVQEKEILLNNISGMERRLAQLQNAYHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDE---IEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLSKEIEEHKKVI-------ENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQEDCKINFTKKYNNDIDNLQKVVKNN---LESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQS 2888
            RNLY   L   LRR IL  PFT  P    L  L +++        Q   K SS    PDW+  + +                D   +  A D   + Y G L+  +  H +   +  + + +      +  +   +S  D          N G +   ++RQ    V      L+  +  L++  +L D             +++ EKE        ++ +   ++  + E+ LKL+ ++++E+Q I+ RKN E+E ++  +K+K  E E  ++ LE K    ++   + +ETK  +I ++K+    + ES N++ E K+ N + + + +K +L + +    +   ++T     K++ ++  +  STN  I +LE  + +L         Q  KL  E+  L    +   N+L E + R   +  +   L+  +E+++  LK   ++ +   N+ + E     +K    IEELE  I  L+ ++ ++    K+++++    +  EK   K  YE ++  ++ +L   K  ++ KI    + L+ K+ QL++  +   ++ + +   +E+ K+++  N E+   +   + E++E++L      + K+  + + QL + KQ  E ++ E++   + +   L      EK SL +D      +EIE  +K +       EN  +E  K+ +++ +  E++ H+   L+ EL       K +  +L  + E EK +  +DH+ A++ L  ++  +K+ L++  +      L K N +LK+IE EY ++  +S ++I+EL+ T   LKEE      A E    +  +K+    D  Q+++++N   +++ + EL     + RS EK+L  K+ E ++QI +++ EYETK   LMP  ++ + E+TI SL++Q++FLQ++  IL++E+T      TYQS
Sbjct:   63 RNLYAKLLLHMLRRGILEGPFTHRPEPGTLKTLPSYMSIYFDEPNQAQPKDSSPEKLPDWVRGELQTGEQRLSDSWQCSSGEDNTLVLAASDAHREQYTGKLRMRS--HSVSPTYREDKQHITSKICEVHSKTSPISLDDSDIEVRLNSWNLGIENPRYLRQKPLPV-----SLMTPKGSLRKASSLHDDHF---------LSRMHEKE--------LDMKTKMMEAKFSEEKLKLQQKHDAEVQKILERKNNELEELKILYKKKQTETEETIRKLEKKVQILIRDCQVIRETKENQITELKKICEQSTESLNNDWEKKLHNAVAEMEKDKFELQKHHTETIQELLEDTNVRLSKMEADYVVQMQSTNHMIKELEGRVQQLMGEAENSNLQRQKLTQEKLELERCYQITCNELQELKTRRNILHKEKEHLVNDYEQNVKLLKTKYDSDI---NLLRQEHALSTSKTSGVIEELEQNICQLKQQVQESELQRKQQVKDQENKFHMEKNHLKHTYEKKVHELQSELDKEKEDAQRKIHKFEEALKEKEEQLSRVTEVQRLQAQQADAALEEFKRQVEVNSEKVYGEMKEQMEKVEADLTRSKSLREKQSKEFLWQLEDAKQRYEQQIVELKLEHEQEKTHLLQQHSAEKDSLVRDH----DREIENLEKQLRAANMEHENQIQESKKRDAQVIADMEAQVHK---LREELISVNSQRKQQLIELGLLREEEKQRAAKDHETAVKKLKAESERVKMELKKTHAAETEMTLEKANSRLKQIEKEYTQKLAKSSQIIAELQTTISSLKEESSRQQLAAERRLQDVIQKFE---DEKQQLIRDNDQAIKALQDELETRSHQVRSAEKKLHHKELEAQEQIMYIRQEYETKFKGLMPASLRQELEDTISSLKSQVNFLQKRASILQEELT------TYQS 952          
BLAST of Centrosomal protein 112 vs. TrEMBL
Match: A0A4X1SUD9 (Centrosomal protein 112 OS=Sus scrofa OX=9823 GN=CEP112 PE=4 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 2.797e-46
Identity = 247/967 (25.54%), Postives = 472/967 (48.81%), Query Frame = 3
Query:   54 IMNEDQTIKSLQLEFDEILTCIKPIYLSWKSQQDKSFIAGWIKKLTNLKNVTLDYMHL--RNLYILALYENLRRDILCDPFTKNPPIDELPPLSNHLRQLIE-------KFSSKYTTPDWLENDEKIDINCLENAVDYEEDDYVGDLKFANDMHDLKQNFLINSEKLNPSKSIEPENGGLSFGDVYKFHNFGTDWVRQSMNQVHEKDTRLI--EDQEGLKQN----LEDSRLKYKPNEYNAFNKVQEKEILLNNISGMERRLAQLQNAYHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKN-------SKNKIVEQNDKLKLER-----DNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMS-HEKDINSLKETLETALHKANITKDEIEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQ---LSKEIEEHKKVIENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQEDCKINFTKKYNNDIDNLQKVVKNNLESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTS 2861
            + +E++  + L  EFD  +  +KP  L    + ++   A WI+KL          +    RNLY   L   L+R +L  PFT  P    L  L +++    +       K SS    PDW+                      +G+L      H L +++ ++S + + S    P N       + K          QSM+  + +D ++I  +  EG  Q     L+DS ++ + N +N                G++ +   ++  YHE+ LKL+ ++++++Q I+ RKN EIE ++T +K+K  E E  ++ LE K    +++  + +ETK  +I ++K+    + ES N++ E K+ N + + + EK +L + +    +   ++T     K++ E+  ++ STN+ I +LE+ + +L          K K+V+  +KL+LER      N   EV+  +N L + +        Q  +L+ + ++ DIN LK+  E AL           +KA   I+ELE  I  L+ +L ++    K++L++    +  EK   K  YE ++  ++ +L   K  ++ KI    + L+ K+ QL +  +   ++ + +   +E+ K+++  N E+   +   + E++E++L      + K+  + + QL + KQ+ E ++ E++   + +   L      EK SL +D + +   L K++       EN  +E  K+ S++ +  E++ H+   L+ EL       K +  +L  + E EK +   DH+  +  L  ++  +K+ L++  +      L K N +LK+IE EY ++  +S ++I+EL+ T   LKEE      A E    +  +K+ ++   L +     +++ + E+ N   + R +EK+L+ K+ E + QI +++ EYETKL  LMP  ++ + E+TI SL++Q+SFLQ++  IL++E+TS
Sbjct:    3 MGSEEEKWEKLDSEFDHFVVDMKPFVLKLPHRSERQRCALWIRKLCEPSGTGAGIIGRKNRNLYAKLLLHMLKRGVLEGPFTHRPEPGTLKTLPSYMSIYFDEPNPAQAKGSSPEGLPDWV----------------------MGEL--GTSEHKLNESWKLSSGE-DYSLVQSPTNVHSREQCIAKLQTRS-----QSMSPTYREDGQIITPKSSEGHSQKSALCLDDSDIEARLNSWNL---------------GLDMKTKMMEAKYHEEKLKLQQKHDADVQKILERKNNEIEEMKTLYKKKQNETEETIRKLEKKVQTLIRECQVIRETKDNQIAELKKICEQSTESLNNDWEKKLHNAVAEMEKEKFELQKRHTENIQELLEDTNIRLNKMEGEYMAQTQSTNQMIKELESRVQQLTGEAENSNLQKQKLVQ--EKLELERCYQITCNELQEVKARRNTLHKEKDHLVNDYEQSMKLLQTKYDADINLLKK--EHALSA---------SKASGMIKELEQTICQLKQQLQESELQRKEQLKDQENKFQMEKSHLKHTYEKKVHDLQSELDKEKEDTQKKIHKFEEALKEKEEQLTRVTEVQRLQAQQADAALEEFKRQVELNSEKVYAEMKEQMEKVEADLTRSKSLREKQSKEFLWQLEDVKQQYEQQIVELKLEHEQEKTHLLQQHNAEKDSLVRDHEREIGNLEKQLRAANMEHENQIQEFKKRDSQVIADMEAQVHK---LREELINVNSQRKQQLVELGLLREEEKQRAARDHETTVNKLKAESEKMKMELKKTHAAETEMTLEKANSRLKQIEKEYTQKLAKSSQIIAELQTTISSLKEENSRQQLAAERRLQDVIQKFEDEKKQLIRDNDRAIKALQDEVENRSNQVRCIEKKLQHKELESQDQITYIRQEYETKLKGLMPASLRQELEDTISSLKSQVSFLQKRASILQEELTS 908          
BLAST of Centrosomal protein 112 vs. TrEMBL
Match: A0A4W2EDU5 (Centrosomal protein 112 OS=Bos indicus x Bos taurus OX=30522 GN=CEP112 PE=4 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.160e-45
Identity = 236/974 (24.23%), Postives = 476/974 (48.87%), Query Frame = 3
Query:   54 IMNEDQTIKSLQLEFDEILTCIKPIYLSWKSQQDKSFIAGWIKKLT--NLKNVTLDYMHLRNLYILALYENLRRDILCDPFTKNPPIDELPPLSNHLRQLIE-------KFSSKYTTPDWLENDEKIDINCLENAVDYEEDDYVGDLKFANDMHDLKQNFLINSEKLNPSKSIEPENGGLSFGDVYKFHNFGTDWVRQSMNQVHEKDTRLIEDQEG---LKQN---LEDSRLKYKPNEYNAFNKVQEKEILLNNISGMERRLAQLQNAYHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKN-------SKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDE---IEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLSKEIEEHKKVI----ENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQEDCKINFTKKYNNDIDNLQKVVKNNLESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQS 2888
            +  E++  + L  EFD  +  +KP  L    + ++   A WI+KL   +     +     RNLY   L   LRR +L  PFT+ P    L  L +++    +       K S     PDW+  +    +   E  +    +   G+       H L Q+      +   +   +P +                    QS +  H +D +++  Q+    LK++   L+DS +  + N +N                G++ +   ++  YHE+ LKL+ ++++++Q I+ RKN EIE ++T +K+K  E E  ++ LE K    +++  + +ETK  +I ++K+    + ES N++ E K+ N + + + EK +L + +    +   ++T     K++ E+  ++ STN+ I +LE+ + +L          K K+++  +KL+LER           N+L E + R   +  + + L+  +E+++  L+   +  +   N+ K E     AKA   I+ELE  I  L+ +L ++    K++L++    +  E+   K+ +E ++  ++ +L   K  ++ KI    + L+ K+ QL + ++   ++ + +   +E+ K+++  N E+   +   + E++E++L      + K+  + + QL + KQ  E ++ E++   + +   L    K EK SL +D + ++   +E   +      EN  +E  K+ S++ +  E++ H+   L+ EL       K +  +L  + E EK +   DH+ A+  L  ++  +++ L++  +      L K N +LK+IE EY ++  +S ++I+EL+ T   L+E+      A E       +K+ ++   L +  +  +++ ++EL N   + RS+EK+L+ K+ E ++QI +++ EYETK   LMP  ++ + E+TI SL++Q++FLQ++  +L+DE+T+      YQS
Sbjct:    3 MGREEEKWEKLDAEFDHFVVDMKPFVLKLPHRSERQRCALWIRKLCEPSGTGTGIPGRKNRNLYAKLLLHMLRRGVLEGPFTQRPEPGTLRALPSYMSIYFDEPNPAPAKGSGADGLPDWVVGE----LGSSERRLSESRELSSGE------DHSLVQSPTAVHSREQCTAKFQPRS--------------------QSTSPTHREDGQILTPQDCDIHLKKSTLSLDDSDMGTRLNSWNL---------------GLDMKTKLMEAKYHEEKLKLQQKHDADVQKILERKNNEIEEMKTLYKKKQNETEETIRKLEKKVQTLVREGQVIRETKDNQIAELKKICEQSTESLNNDWEKKLHNAVAEMEKEKFELQKRHTENIQELLEDTNVRLNKMEGEYVAQTRSTNQMIKELESRVQQLTGEAENSNLQKQKLIQ--EKLELERCYQI-----TCNELQEVKARRNTLHKEKDHLVSDYEQNLKLLQTKCDADV---NLLKKEHALSAAKASGMIKELEQNICQLKQQLQESELQRKQQLKDQENKFQMERSHLKRTFEKKIHDLQSELDKEKEDAQKKIHKFEEALKEKEEQLTRVSEGQRLQAQQADAALEEFKRQVELNSEKVYAEMKEQMEKVEADLTRSKSLREKQSKEFLWQLDDVKQRYEQQIVELKLEHEQEKTHLLQQHKAEKESLVRDHEREVGN-LENKLRAANMEHENQIQEFKKRDSQVIADMEAQVHK---LREELVSVNSQRKQQLVELGLLREEEKQRAARDHEAAVSKLKAESEKMRLELKKTHAAETELTLEKANSRLKQIEKEYTQKLAKSSQVIAELQGTVSSLREDSSRQQLAAERRLQEVVRKFEDEKQQLIRENERAVKALQEELENRSKQVRSIEKKLQHKELESQEQITYIRQEYETKFKGLMPASLRQELEDTISSLKSQVNFLQKRASVLQDELTA------YQS 911          
BLAST of Centrosomal protein 112 vs. TrEMBL
Match: A0A4W2GFU6 (Centrosomal protein 112 OS=Bos indicus x Bos taurus OX=30522 GN=CEP112 PE=4 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 2.545e-45
Identity = 239/974 (24.54%), Postives = 478/974 (49.08%), Query Frame = 3
Query:   54 IMNEDQTIKSLQLEFDEILTCIKPIYLSWKSQQDKSFIAGWIKKLT--NLKNVTLDYMHLRNLYILALYENLRRDILCDPFTKNPPIDELPPLSNHLRQLIE-------KFSSKYTTPDWLENDEKIDINCLENAVDYEEDDYVGDLKFANDMHDLKQNFLINSEKLNPSKSIEPENGGLSFGDVYKFHNFGTDWVRQSMNQVHEKDTRLIEDQEG---LKQN---LEDSRLKYKPNEYNAFNKVQEKEILLNNISGMERRLAQLQNAYHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKN-------SKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDE---IEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLSKEIEEHKKVI----ENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQEDCKINFTKKYNNDIDNLQKVVKNNLESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQS 2888
            + +E++  + L  EFD  +  +KP  L    + ++   A WI+KL   +     +     RNLY   L   LRR +L  PFT+ P    L  L +++    +       K S     PDW+  +    +   E  +    +   G+       H L Q+         P+     E        + KF         QS +  H +D +++  Q+    LK++   L+DS +  + N +N                G++ +   ++  YHE+ LKL+ ++++++Q I+ RKN EIE ++T +K+K  E E  ++ LE K    +++  + +ETK  +I ++K+    + ES N++ E K+ N + + + EK +L + +    +   ++T     K++ E+  ++ STN+ I +LE+ + +L          K K+++  +KL+LER           N+L E + R   +  + + L+  +E+++  L+   +  +   N+ K E     AKA   I+ELE  I  L+ +L ++    K++L++    +  E+   K+ +E ++  ++ +L   K  ++ KI    + L+ K+ QL + ++   ++ + +   +E+ K+++  N E+   +   + E++E++L      + K+  + + QL + KQ  E ++ E++   + +   L    K EK SL +D + ++   +E   +      EN  +E  K+ S++ +  E++ H+   L+ EL       K +  +L  + E EK +   DH+ A+  L  ++  +++ L++  +      L K N +LK+IE EY ++  +S ++I+EL+ T   L+E+      A E       +K+ ++   L +  +  +++ ++EL N   + RS+EK+L+ K+ E ++QI +++ EYETK   LMP  ++ + E+TI SL++Q++FLQ++  +L+DE+T+      YQS
Sbjct:    3 MGSEEEKWEKLDAEFDHFVVDMKPFVLKLPHRSERQRCALWIRKLCEPSGTGTGIPGRKNRNLYAKLLLHMLRRGVLEGPFTQRPEPGTLRALPSYMSIYFDEPNPAPAKGSGADGLPDWVVGE----LGSSERRLSESRELSSGE------DHSLVQS---------PTAVHSREQC------IAKFQPRS-----QSTSPTHREDGQILTPQDCDIHLKKSTLSLDDSDMGTRLNSWNL---------------GLDMKTKLMEAKYHEEKLKLQQKHDADVQKILERKNNEIEEMKTLYKKKQNETEETIRKLEKKVQTLVREGQVIRETKDNQIAELKKICEQSTESLNNDWEKKLHNAVAEMEKEKFELQKRHTENIQELLEDTNVRLNKMEGEYVAQTRSTNQMIKELESRVQQLTGEAENSNLQKQKLIQ--EKLELERCYQI-----TCNELQEVKARRNTLHKEKDHLVSDYEQNLKLLQTKCDADV---NLLKKEHALSAAKASGMIKELEQNICQLKQQLQESELQRKQQLKDQENKFQMERSHLKRTFEKKIHDLQSELDKEKEDAQKKIHKFEEALKEKEEQLTRVSEGQRLQAQQADAALEEFKRQVELNSEKVYAEMKEQMEKVEADLTRSKTLREKQSKEFLWQLDDVKQRYEQQIVELKLEHEQEKTHLLQQHKAEKESLVRDHEREVGN-LENKLRAANMEHENQIQEFKKRDSQVIADMEAQVHK---LREELVSVNSQRKQQLVELGLLREEEKQRAARDHEAAVSKLKAESEKMRLELKKTHAAETELTLEKANSRLKQIEKEYTQKLAKSSQVIAELQGTVSSLREDSSRQQLAAERRLQEVVRKFEDEKQQLIRENERAVKALQEELENRSKQVRSIEKKLQHKELESQEQITYIRQEYETKFKGLMPASLRQELEDTISSLKSQVNFLQKRASVLQDELTA------YQS 911          
BLAST of Centrosomal protein 112 vs. TrEMBL
Match: A0A2R9CJU0 (Centrosomal protein 112 OS=Pan paniscus OX=9597 GN=CEP112 PE=4 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 2.276e-44
Identity = 245/981 (24.97%), Postives = 468/981 (47.71%), Query Frame = 3
Query:   54 IMNEDQTIKSLQLEFDEILTCIKPIYLSWKSQQDKSFIAGWIKKLTNLKNVTLDYMHL--RNLYILALYENLRRDILCDPFTKNPPIDELPPLSNHLRQLIE-------KFSSKYTTPDWLENDEKIDINCLENAVDYEEDDYVGDLKFANDMHDLKQNFLINSEKLNPSKSIEPENGGL--SFGDVYKFHNF-GTDWVR-QSMNQVHEKDTRLIEDQ------EGLKQNLEDSRLKYKPNEYNAFNKVQEKEILLNNISGMERRLAQLQNAYHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDE---IEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLSKEIEEHKKVIENLNEEKAKKISELQ-------SSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQEDCKINFTKKYNNDIDNLQKVVKNNLESYK---KELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQSNGFS 2900
            + +E++  + L  EFD  +  +KP  L    + ++   A WI+KL          M    RNLY   L   L+R  L  PFT  P    L  L +++    +       K SS    P W+                      +G+L+ +   H L +++ ++S           E+  L  S  DVY    + G   VR  S++  H +D + I  +      +    +L+DS ++ + N +N                G++ +   ++  +HE+ LKL+ ++++++Q I+ RKN EIE ++T ++ K  E E  ++ LE K    ++   + +ETK  +I ++K+    + ES N++ E K+ N + + + EK  L +++    +   ++T     K++ E+  ++ STN  I +LEA + +L         Q  KL  E+  L    +   ++L E + R   +  + + L+  +E+++  L+   +  +   N+ K E     +KA   IEELE  +  L+ +L ++    K++L +    +  EK   K  YE +   ++ +L   K  ++ KI    + L+ K+ QL +  +   ++ + +   +E+ K+++  N E+   +   + E++E++L      + K+  + + QL + +Q  E ++ E++   + +   L      EK SL +D +    +EIE  +K +   N E   +I E +       +  E + H+   L+ EL       K +  +L  + E EK +   +H+I +  L  ++  +K+ L++  +      L K N KLK+IE EY ++  +S ++I+EL+ T   LKEE  +   A E    +  +K+    D  ++++++N ++ K    EL N   + R  EK+L+ KD E ++QI +++ EYETKL  LMP  ++ + E+TI SL++Q++FLQ++  IL++E+T      TYQ   +S
Sbjct:    3 VGSEEEKWEKLDAEFDHFVVDMKPFVLKLPHRTERQRCALWIRKLCEPSGTGAGIMGRKNRNLYAKLLLHMLKRGALEGPFTHRPEPGTLKILPSYMSIYFDEPNPARAKGSSPEGLPAWV----------------------LGELETSE--HKLNESWKLSS----------GEDNTLVQSPTDVYSREQYTGKLRVRSHSLSPTHREDGQNITPKICEVYSKKSPVSLDDSDIEARLNSWNL---------------GLDMKTKMMEAKFHEEKLKLQQKHDADVQKILERKNNEIEELKTLYRSKQHETEETIRKLEKKVQTLIRDCQVIRETKEDQIAELKKICEQSTESLNNDWEKKLHNAVAEMEQEKFDLQKQHTENIQELLEDTNVRLNKMESEYMAQTQSTNHMIKELEARVQQLTGEAENSNLQRQKLIQEKAELERCYQITCSELQEVKARRNTLHKEKDHLVNDYEQNMKLLQTKYDADI---NLLKQEHALSASKASSMIEELEQNVCQLKQQLQESELQRKQQLRDQENKFQMEKSHLKHIYEKKAHDLQSELDKGKEDTQKKIHKFEEALKEKEEQLTRVTEVQRLQAQQADAALEEFKRQVELNSEKVYAEMKEQMEKVEADLTRSKSLREKQSKEFLWQLEDIRQRYEQQIVELKLEHEQEKTHLLQQHNAEKDSLVRDHE----REIENLEKQLRAANMEHENQIQEFKKRDAQVIADMEVQVHK---LREELINVNSQRKQQLVELGLLREEEKQRATREHEIVINKLKAESEKMKIELKKTHAAETEMTLEKANSKLKQIEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFE---DEKKQLIRDNDQAIKVLQDELENRSNQVRCAEKKLQHKDLESQEQITYIRQEYETKLKGLMPASLRQELEDTISSLKSQVNFLQKRASILQEELT------TYQGRRYS 915          
BLAST of Centrosomal protein 112 vs. TrEMBL
Match: A0A5F9CS70 (Centrosomal protein 112 OS=Oryctolagus cuniculus OX=9986 GN=CEP112 PE=4 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 7.256e-44
Identity = 238/972 (24.49%), Postives = 465/972 (47.84%), Query Frame = 3
Query:   54 IMNEDQTIKSLQLEFDEILTCIKPIYLSWKSQQDKSFIAGWIKKLTNLKNVTLDYMHL--RNLYILALYENLRRDILCDPFTKNPPIDELPPLSNHLRQLIE-------KFSSKYTTPDWLENDEKIDINCLENAVDYEEDDYVGDLKFANDMHDLKQ---NFLINSEKLNPSKSIEPENGGLSFGDVYKFHNFGTDWVRQSMNQVHEKDTRLIEDQEGLKQNLEDSRLKYKPNEYNAFNKVQEKEILLNNISGMERRLAQLQNAYHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANIT--KDE---IEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLSKEIEEHKKVIENLNEEKAKKISELQ-------SSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQEDCKINFTKKYNNDIDNLQKVVKNN---LESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQS 2888
            + +E++  + L  EFD  +  +KP  L    + ++   A WI+KL          M    RNLY   L   L++ +L  PFT  P    L  L +++    +       K SS    PDW+  +     + L  +      D    ++   D+H  +Q      I ++ L+P               VYK  +     V   + +VH +   +         +L+DS ++ + N +N                G++ +   ++  +HE+ LKL+ ++++++Q I+ RKN EIE ++T +K+K  E E  ++ LE K    ++   + +ETK  +I ++K+    + ES  ++ E K+ + + + + EK  L +++    +   ++T     K++ E+  ++ STN+ + +LEA + +L         Q  KL  E+  L    +   ++L E + R   +  + + L   +E+++  L+       + A+IT  K E     +KA   IEELE  I  L+ +L D+    K++L +    +  EK   K+ YE ++  ++ +L   K  ++ KI    + ++ KD QL +  +   ++ + +   +E+ K+++  N E+   +   + E++E++L      + K+  + + QL + KQ  E ++ E++   + +   L      E+ SL +D +    +EIE  +K +   N E   +I E +       +  E++ H+   L+ EL       K +  +L  + E EK +   DH+ A+  +  ++  +K+ L++  +      L K N +LK+IE EY ++  +S ++I+EL+ T   LKEE      A E    +  +K+    D  Q+++++N   +++ + EL N   + R  EK+L+ ++ E ++QI +++ EYETK   LMP  ++ + E+TI SL++Q++FLQ++  IL++E+T      TYQ 
Sbjct:    3 MGSEEEKWEKLDAEFDHFVVDMKPFVLKLPHRSERQRCALWIRKLCEPSGTGTGLMGRKNRNLYAKLLLHMLKQGVLEGPFTHRPEPGTLKTLPSYMSIYFDEPNPAQAKGSSPEGLPDWVMGELGTSEHKLNESWKLSSGDDNALVQLPTDIHSREQYTGKLQIKTQSLSP---------------VYKEDDQN---VTSKICEVHVRKPPV---------SLDDSDIEARLNSWNL---------------GLDMKTKMMEAKFHEEKLKLQQKHDADVQKILERKNNEIEELKTLYKKKQNETEETIRKLEKKVQILIRDCQVIRETKENQIAELKKICEQSTESLKNDWEKKLHSAVAEMEKEKFDLQKQHTENIQELLEDTNVRLNKMEGEYMAQTQSTNQIVKELEARVQQLTGEAENSNLQRQKLIQEKQELERCYQITCSELQEVKARRNILHKEKDHLANEYEQNMKLLQ-----TKYNADITILKQEHALSASKASGMIEELEQNICQLKQQLQDSELQRKQQLRDQENKFEMEKSHLKRTYEKKVHDLQSELDKEKEDAQKKILKFEEVMKEKDEQLARVTEVQRLQAQQADAALEEFKRQVELNSEKVYAEMKEQMERVEADLTRSKSLREKQSKEFVWQLDDVKQRYEQQIVELKLEHEQEKTHLLQQHNAERGSLVRDHE----REIENLEKQLRAANMEHENQIQEFKKRDAQVIADMEAQVHK---LREELINVNSQRKQQLIELGLLREEEKQRTARDHETAINRMKAESEKMKLELKKTHAAETEVTLEKANSRLKQIEKEYTQKLAKSSQIIAELQTTVSSLKEENSRQQLAAERRLQDAVQKFE---DEKQQLIRDNDRAIKALQDELENRSNQVRCAEKRLQHRELEAQEQITYIRQEYETKFKGLMPASLRQELEDTISSLKSQVNFLQKRASILQEELT------TYQG 911          
BLAST of Centrosomal protein 112 vs. Ensembl Cavefish
Match: cep112 (centrosomal protein 112 [Source:ZFIN;Acc:ZDB-GENE-120104-2])

HSP 1 Score: 88.9669 bits (219), Expect = 1.544e-17
Identity = 206/950 (21.68%), Postives = 422/950 (44.42%), Query Frame = 3
Query:   72 TIKSLQLEFDEILTCIKPIYLSWKSQQDKSFIAGWIKKLTN--LKNVTLDYMHLRNLYILALYENLRRDILCDPFTKNPPIDELPPLSNHLRQLI--------EKFSSKYTTPDWLENDEKIDINCLENAVDYEEDDYVGDLKFANDMHDLKQNFLINSEKLNPSKSIEPENGGLSFGDVYKFHNFGTDWVRQSMNQVHEKDTRLIEDQEGLKQ---NLEDSRLKYKPNEYNAFNKVQEKEILLNN---ISGMERRLAQLQNAYHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADI----TELKNS---KNKIVEQNDKLKLERDNLFGEVRKLQNDLS-------ESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDEIEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLSKEIEEHKKVIENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQE----DCKINF---TKKYNNDIDNLQKVVKNNLESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQ 2810
            +++ L  +FD  L  +KP  L   + + +   A WIKKL +       L     RN Y   L   LRR +L  PFT  P    L  L  +++ +          +  S    PDW+ ++           + + ED +        D    ++N                      F D      F +  ++      H +DT  + D    KQ   +LEDS L+ + N +N    +++   L  N   +S  E R   L+  + E+ LKL+ ++++++Q I+ RKN EI  +++ ++ K +E E  ++ LE K    +++  + +++K K+I ++K+    + +S  ++ E K+   +   + EK  L +++    +   ++T +   K++ E++ ++ +T R + +LEA +     E++N    + K+ ++  +L++    +  E+++    +S       ++++  + +   HN+    HE D+N  ++  E AL  A         KA + IE+LE  +  L+ +L D+    +K+L  +      E    + + E ++++++ +L   +  +  +   L   L+ +D QL++  +    + + + Q +E+ K+++                    EL  E     K   D+ +Q+ + K + E + + + +  + +  GL  + ++E  SLE+  +  +   ++   +  E    +  + IS+L+   ++   E+      L  QAQ  K + S+L  + E E+ +  +D             D  V+    + E + Q L KT+           ER     K ++EL+     +KEE I+   A E    + ++ +    ++ N D D   KV++  +E+ +K+L        + EK+L  +  E ++QI  ++ EYE K+  LMP E++ + E+TI SL++Q
Sbjct:    3 SVEDLDSQFDHYLVDMKPFVLKL-THKSRQRCALWIKKLCDPVASGSGLTGRKNRNAYARLLLVMLRRGVLEGPFTHRPEAGSLKTLPTYMQSIYFDEPLLARPRGHSSAVLPDWVSSE-----------LGHSEDTWTS---LPKDSSSPRRNL---------------------FSDKSPSRPFSSSPLK------HTEDT--LVDGRHRKQPVSSLEDSDLEARLNSWNLG--IEDPRYLRENPIPLSPTEMRSKVLEAKHQEERLKLQQKHDTDVQKILERKNGEIAELKSMYRTKQKEAEEAVRTLEKK-QSLLRESQVIRQSKEKQIVELKKLSDQSADSLKNDWEKKLHATVAQMEQEKFDLQKKHTENIQELLEDTNQRLAKMEAEYSAQAQTTERTVRELEARVKQLSVEVENGNLLRQKVTQEKAELEIHIAAISAELQEANRSISMLKEKEVQNEQYEETLQKLHNK----HEADMNHFQQ--EHALSAA---------KASEVIEDLERMVAQLRQQLQDSEHRRQKQLRELENKMHQETKELQHSSEIKVQALQAELEKERADARRRSNKLEDALD-RDEQLSRMRESQRQQVQQAEQTLENFKKQV--------------------ELSSE-----KAYTDMKQQIVDLKLQQEQERTHLLQKHNGEKEGLVQEHQREISSLERQARAAM---LQHQAQTQEWRRRDGQQTISDLEVQVQALREEV------LEVQAQR-KQQLSELTVLREEERQRAAQD------------QDAAVSRVRAEMERVRQDLEKTHT---------AERERAQEKAVAELQTALCSVKEESIKNKQALERQLQEAQMRWDEEKRQLNRDSDRASKVLQERVEALQKQLH-------TAEKKLMTRQLETQEQITLIRQEYELKIKGLMPAELRQELEDTITSLKSQ 826          
BLAST of Centrosomal protein 112 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008348.1 (pep scaffold:Pmarinus_7.0:GL476515:143484:211518:-1 gene:ENSPMAG00000007536.1 transcript:ENSPMAT00000008348.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 1.097e-8
Identity = 126/617 (20.42%), Postives = 271/617 (43.92%), Query Frame = 3
Query:  228 RNLYILALYENLRRDILCDPFTKNP---PIDELPP-LSNHLRQLIEKFSSKYTTPDWLENDEKIDINCLENAVDYEEDDYVGD--LKFANDMHDLKQNFLINSEKLNPSKSI--EPENGGLS-------FGDVYKFHNFGTDWVRQSMNQVHEKDTRLIEDQEGLKQNLEDSRLK-YKPNEYNAFNK--VQEKEILLNNISGMERRLAQLQNAYHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSES---QKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDEIEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKI---QDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIR 2006
            RN Y   L   LRR +L +PFT  P   P+  LP  ++ +  + +E   +    PDW+        N L ++      +++G       N      ++ L   +  +  + I   P +  +S        G+VY+ H+ G       ++       R    ++    N E S +  + P   +  N   + ++ +   +   +E R   L+  + E+ LKL+ +++++IQ I++RKN EIE +++  + K +E +  ++ LE K    M +  + QE+K +E+  + R    NIE    + E K+T    DF+ EK +L + +    +    +T      ++ E++ ++ +T  Q  +LE+ + +L     +      +L  E+  L  +    Q   + +   + RY  ++ +  R  +  E+ +   +  LE  L           ++A   IE LE ++ + +  L +      ++L      +  +    +Q  + ++ SV+ +L   K +++ KI   +D +++ E + T+  +A +    + + +   ++D K+++  N E+   +   +  ++ES+L      + K+  +  RQ    +Q  E ++ E+R
Sbjct:   66 RNDYARLLLHMLRRSVLEEPFTHRPDTGPLKTLPTYMAIYFDEPLEDIVASREPPDWVTGALDAPENKLSSSYYM---NFIGKKITLCINCTSLFSKSTLTGMQAKSRERGIITPPSHQQMSRDFFSPAVGNVYQDHHTGLSSDDSDLDSRF--GVRYFGVEQPHYMNCESSGITDFTPQAGDERNGTFLDQQTVSQMHKKELEVRTKLLEVMFQEEKLKLQQKHDADIQKILDRKNGEIEEVKSLNRRKQKEADDTIKKLEKKVQALMWEAQVLQESKDREMVDLARTSEHNIEDLRSQYESKLTEATSDFEVEKLQLQKRHTDNIQALLDDTNTRLAAMEDEYSSQARATVEQTRELESRVQQLSIEAERNSSLGQRLGQEKAQLEAQC-STQRTYAATLLLRARYASLEQESQRARLVLEEKLQQCRGRLEAQLESLKQDNARAASEATAVIEGLEKEVSEHKGSLRETELQKHRQLREQENQFKQQIIELEQLSDKKIRSVQTELEETKAEAQRKIRQMEDGIREKEERHTRALEAERAHAQRAEAA---LDDFKKQVELNAEKIYGEMRHQMTKVESDLSRSKSLREKQAKEFTRQQEQLRQRYEQQIVELR 673          
BLAST of Centrosomal protein 112 vs. Ensembl Nematostella
Match: EDO31913 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWJ9])

HSP 1 Score: 121.709 bits (304), Expect = 2.672e-28
Identity = 165/696 (23.71%), Postives = 364/696 (52.30%), Query Frame = 3
Query:  813 YHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSE-SQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDEIEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLSKEIEEHKKVIENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALE---NLTRQTNDI-----------KVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQEDCKINFTKKYNNDIDNLQKVVKNNLESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEV 2855
            +HE+ LKL+ Q++  +Q I++RKN E+E I+ +++ K  E E  ++  E K +   ++    +E K K+I ++K     + E+  H+ E K+ + + +F+ EK ++ +++    +    ET +  +K++ E+N+++T+T   I +LE  + +L      + E   KL  E+ +L   VR  +N  +     R   ++  H RLM  H+  I  L++  ++ +           +++ D I ELE Q+  L+  L D+    +K+  ++  S   EK   +  Y+ ++  ++ ++   +L+ + +I+ L   L+ +D Q+ +  +  + +   +   +ED K ++  N  R   +   + E++E +L      + K+  +  RQ+ + K + + +++EI+         +T++  QEK  L + FQ      + E ++  E   E+  +K+SEL++    ++     ++ EL QQ +  + E   ++      K +++E + +  E   N  RQ  ++           ++ L+ + S  + ++L KTN +LK +E+EY  RS  + + +  L+   +KLKEE + +  + E    + ++K+N + + +++   + + S ++++ +++   R LEK+ ++ + + +++++ M+L+YE K+  L+P +++++ E+TI+SLR QIS LQ +  IL++E+
Sbjct:   10 FHEEKLKLQQQHDVAVQKILDRKNMELEEIKAHYRNKVTEMETTIKKHERKISSMTRESSTLKEQKDKQINELKSLVEQSGENAQHDYEKKLNDKIAEFEQEKFEMQKQHTNNIQELLDETNQRLQKMETEYNQQTTATGLVIRELEGRVHQLTQESEALQESRTKLAKEKVSL---VRFWENHFNALFHPRLSKLERDHGRLMNDHQSSIQQLQKKTDSTIELMKQEHSAAASRSSDTISELEAQVSQLKQALQDSEYQRQKQARDMESSGQQEKLSLEHLYDKKVRGMQAEIDQQELEFQKRIRKLEATLKERDEQIQRLTEAQKQQAAQAEHALEDFKNQVERNSGRMFDEMKTQMEKVEEDLARSKNLREKQAKEFSRQMDDMKLKYDKQVAEIK---------ITHE--QEKAQLMRSFQGDRDSLLREQEQEREMQAEKLQQKLSELENHSRERAARDAKIQAELEQQVRELREE---VVEANSLRKTQLMEANMLREEDRHNFKRQEENLVSKSKSQLEQQRLQLQREHSNEMEKMLDKTNSRLKHMEDEYATRSATAQETVRTLEGEIKKLKEENLRMRLSSEKKIGSVSEKHNEEKNTMKRHHTSIVNSLEQDVESQKSMVRHLEKRCKQIELDAQERVSRMRLQYEEKMKGLLPADLRDELEDTIESLRQQISVLQSRANILQEEI 688          
BLAST of Centrosomal protein 112 vs. Ensembl Nematostella
Match: EDO29019 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4U5])

HSP 1 Score: 78.1814 bits (191), Expect = 6.044e-15
Identity = 111/472 (23.52%), Postives = 200/472 (42.37%), Query Frame = 3
Query:   96 FDEILTCIKPIYLSWKSQQDKSFIAGWIKKLTNLKNVTLDYMHLRNLYILALYENLRRDILCDPFTKNPPIDELPPLSNHLRQLIEKFSSKY-------TTPDWLENDEKIDINCLENAVDYEEDDYVGDLK--FANDM------HDLKQNFLINSEKLNPSKSIEPENGGLSFGD-------VYKF-HNF---GTDWVRQSMNQVHEKDTRLIEDQ-----EGLKQ------------NLEDSRLKYKPNEYNAF-------------------NKVQEKEILLNNISGMERRLAQLQNAYHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLER 1325
            FD  +  +KP  L    + ++  +  WIKKL      +      RNLY   L   L+R +L DPFT+ P    L PL +++  +   + S Y        +P +  +D++ D+   E        D+V DL    A+ M          +  L ++  ++P  S        S  D       + KF H     G    R S     E D R  +D+      G +Q                S    K N YN +                   NKV E+E+ L        ++  ++  +HE+ L L+ Q++  +Q I++RKN E+E I+ +++ K  E E  ++  E K +   ++    +E K K+I ++K     + E+  H+ E K+ + + +F+ EK ++ +++    +    ET +  +K++ E+N+++T+T   I +LE  + +L      + E   KL  E+
Sbjct:   11 FDRFIADMKPFVLRLPHKLERQRVGLWIKKLCEAPGPSPSARKNRNLYAQLLLHMLKRGLLEDPFTRRPESGNLQPLPSYM-VISHTYMSIYLDEPITNKSPSY--HDDESDMGSREPP------DWVRDLGSSIASSMISDSSVAPRPRRELPSTNGVHPIPSARSNTYSTSTRDRSNYEPSMPKFDHGVNGEGDYGARNSSGGFPEDDARTYDDEHPYTPPGRRQVPSEPWYHHPDSGYPSSSPTSKSNHYNGYLPNYSRGVNMALQEDASLTNKVNEREVEL--------KVKMVEAKFHEEKLTLQQQHDVAVQKILDRKNMELEEIKAHYRNKVTEMETTIKKHERKISSMTRESSSLKEQKDKQINELKSLVEQSGENAQHDYEKKLNDKIAEFEQEKFEMQKQHTNNIQELLDETNQRLQKMETEYNQQTTATGLVIRELEGRVHQLTQESEALQESRTKLAKEK 465          
BLAST of Centrosomal protein 112 vs. Ensembl Medaka
Match: cep112 (centrosomal protein 112 [Source:NCBI gene;Acc:101159196])

HSP 1 Score: 166.777 bits (421), Expect = 8.096e-42
Identity = 221/953 (23.19%), Postives = 453/953 (47.53%), Query Frame = 3
Query:   84 LQLEFDEILTCIKPIYLSWKSQQDKSFIAGWIKKLTNLKNVTLDYMHLRN--LYILALYENLRRDILCDPFTKNPPIDELPPLSNHLR-QLIEKFSSKYTT------PDWLENDEKIDI-NCLENAVDYEEDDYVGDLKFANDMHDLKQNFLINSEKLNPSKSIEPEN--GGLSFGDVYKFHNFGTDWVRQSMNQVHEKDTRLIEDQEGLKQNLEDSRLKYKPNEYNAFNKVQEKEILLNNISGMERRLAQLQNAYHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDEIEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLS-------KEIEEHKKVIENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQE----DCKINF---TKKYNNDIDNLQKVVKNNLESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTST 2864
            L  EFD IL  +KP  L   ++ ++   A WIKKL +  +       LRN  LY   L   L+R +L  PFT  P    L  L  ++     E  + +         PDW+  +      N L   +D  +D Y          H  ++ +    E++N S+ + P    GG                 RQ        DTR++++     ++ EDS L+   N +N    VQ               +  L+  + E+ LKL+ +++++I+ I++RK+AEIE +++ ++ K +E +  ++ LE K    +++  +  ++K K+IE++K+    + +S  +E E K+   + + + EK  L +++ +  +    +T     K++ E+N +S +T +++ +LE  + +      K      K+  E+  L   V  L  +L E+ +R   +  +  +    H++ I  L+   ET +   +   D   AK+ + IE+ E  +  ++ +L D      +++ +  M +  EK   +   E ++ +++ +    K+++  KI  L + L   ++QL++A +    + + + + +E  K+++  + E+   +   + +++E +L      +  +  +  +QL   +++ E +++E R   + +   L    K EK ++ ++ Q ++S         +++H++  +   +  A+ ISEL++  E        L+ EL    +NHK + ++L  ++E E+ + + D + +L+ L      I+ +LE    +  +  L KTN ++K+IE EY ++  +S +LI+EL+ +    KEE +    A E    +    +    ++  +  D   K+++  LES +++L        S EK+L  K+ E ++++  +  EYE K+  LMP EV+ + E+TI SL+ Q+SFLQ+   +L++E+ + 
Sbjct:   11 LDTEFDHILLDMKPYVLKHPNRTERQRCAVWIKKLCDPASCGSGLTSLRNRNLYARLLLHMLKRGLLEGPFTSKPGPGTLKTLPAYMSIYFGEPLAGQSVGTNSRELPDWVTGELGASADNSL--VMDLLKDKYSS---TPVKTHHRRRLY----EEMNLSRPMSPNPLLGG----------------PRQ--------DTRMMDEALKADESPEDSDLEAHLNSWNTGTDVQ---------------IKVLEAKHQEEKLKLQQRHDADIEKILDRKHAEIEEMKSLYQAKQKESQELIRKLEKKVQSVLRESQVICQSKDKQIEELKKMSDQSSDSLRNEWEKKLHAAVSEVEQEKFLLQKKHTQSIQELLDDTNARLAKMEKEYNTRSQTTEQKVFELELRVKQQSVEVEKCNTLRQKVAKEKAQLEIHVASLSTELQEANRRIMALQKEKEQQSEQHDEFILKLEAKHETDISHLHQEHDLSAAKSAEVIEDFEKIVAQMKHQLQDTEYRRLQQVRDQEMKFQQEKTELQVNCEKKVSAIQAEAEKEKMEANRKIAKLEESLREMESQLDRARESQRQQIQQADRAMEQFKKQVELSSEKVYTEMKLQMKKVEEDLVHSKSLRENQAKEFSQQLDALREKYEQQMAEQRSQHEQERTRLQQQHKAEKDTMVQEHQREVSGVESQARAALQQHQQHSQEWRKRDAQTISELEALVEG-------LREELQDVRRNHKQQLTELASLHEEERRRAVLDKETSLDQLRSDMERIRSDLERSHQQEKNATLEKTNSRMKQIEKEYSQKLTKSAQLIAELQTSVCDSKEEALRTKQAMEKQLKEANARWDEERRRITHHADQTNKMLQEKLESLQRQL-------HSTEKKLLSKELETEEKVTMVHQEYEGKIKGLMPAEVRQELEDTITSLKAQVSFLQKTASLLQEELNAC 901          
BLAST of Centrosomal protein 112 vs. Ensembl Medaka
Match: cep112 (centrosomal protein 112 [Source:NCBI gene;Acc:101159196])

HSP 1 Score: 166.777 bits (421), Expect = 8.096e-42
Identity = 221/953 (23.19%), Postives = 453/953 (47.53%), Query Frame = 3
Query:   84 LQLEFDEILTCIKPIYLSWKSQQDKSFIAGWIKKLTNLKNVTLDYMHLRN--LYILALYENLRRDILCDPFTKNPPIDELPPLSNHLR-QLIEKFSSKYTT------PDWLENDEKIDI-NCLENAVDYEEDDYVGDLKFANDMHDLKQNFLINSEKLNPSKSIEPEN--GGLSFGDVYKFHNFGTDWVRQSMNQVHEKDTRLIEDQEGLKQNLEDSRLKYKPNEYNAFNKVQEKEILLNNISGMERRLAQLQNAYHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDEIEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLS-------KEIEEHKKVIENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQE----DCKINF---TKKYNNDIDNLQKVVKNNLESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTST 2864
            L  EFD IL  +KP  L   ++ ++   A WIKKL +  +       LRN  LY   L   L+R +L  PFT  P    L  L  ++     E  + +         PDW+  +      N L   +D  +D Y          H  ++ +    E++N S+ + P    GG                 RQ        DTR++++     ++ EDS L+   N +N    VQ               +  L+  + E+ LKL+ +++++I+ I++RK+AEIE +++ ++ K +E +  ++ LE K    +++  +  ++K K+IE++K+    + +S  +E E K+   + + + EK  L +++ +  +    +T     K++ E+N +S +T +++ +LE  + +      K      K+  E+  L   V  L  +L E+ +R   +  +  +    H++ I  L+   ET +   +   D   AK+ + IE+ E  +  ++ +L D      +++ +  M +  EK   +   E ++ +++ +    K+++  KI  L + L   ++QL++A +    + + + + +E  K+++  + E+   +   + +++E +L      +  +  +  +QL   +++ E +++E R   + +   L    K EK ++ ++ Q ++S         +++H++  +   +  A+ ISEL++  E        L+ EL    +NHK + ++L  ++E E+ + + D + +L+ L      I+ +LE    +  +  L KTN ++K+IE EY ++  +S +LI+EL+ +    KEE +    A E    +    +    ++  +  D   K+++  LES +++L        S EK+L  K+ E ++++  +  EYE K+  LMP EV+ + E+TI SL+ Q+SFLQ+   +L++E+ + 
Sbjct:   11 LDTEFDHILLDMKPYVLKHPNRTERQRCAVWIKKLCDPASCGSGLTSLRNRNLYARLLLHMLKRGLLEGPFTSKPGPGTLKTLPAYMSIYFGEPLAGQSVGTNSRELPDWVTGELGASADNSL--VMDLLKDKYSS---TPVKTHHRRRLY----EEMNLSRPMSPNPLLGG----------------PRQ--------DTRMMDEALKADESPEDSDLEAHLNSWNTGTDVQ---------------IKVLEAKHQEEKLKLQQRHDADIEKILDRKHAEIEEMKSLYQAKQKESQELIRKLEKKVQSVLRESQVICQSKDKQIEELKKMSDQSSDSLRNEWEKKLHAAVSEVEQEKFLLQKKHTQSIQELLDDTNARLAKMEKEYNTRSQTTEQKVFELELRVKQQSVEVEKCNTLRQKVAKEKAQLEIHVASLSTELQEANRRIMALQKEKEQQSEQHDEFILKLEAKHETDISHLHQEHDLSAAKSAEVIEDFEKIVAQMKHQLQDTEYRRLQQVRDQEMKFQQEKTELQVNCEKKVSAIQAEAEKEKMEANRKIAKLEESLREMESQLDRARESQRQQIQQADRAMEQFKKQVELSSEKVYTEMKLQMKKVEEDLVHSKSLRENQAKEFSQQLDALREKYEQQMAEQRSQHEQERTRLQQQHKAEKDTMVQEHQREVSGVESQARAALQQHQQHSQEWRKRDAQTISELEALVEG-------LREELQDVRRNHKQQLTELASLHEEERRRAVLDKETSLDQLRSDMERIRSDLERSHQQEKNATLEKTNSRMKQIEKEYSQKLTKSAQLIAELQTSVCDSKEEALRTKQAMEKQLKEANARWDEERRRITHHADQTNKMLQEKLESLQRQL-------HSTEKKLLSKELETEEKVTMVHQEYEGKIKGLMPAEVRQELEDTITSLKAQVSFLQKTASLLQEELNAC 901          
BLAST of Centrosomal protein 112 vs. Ensembl Medaka
Match: cep112 (centrosomal protein 112 [Source:NCBI gene;Acc:101159196])

HSP 1 Score: 166.392 bits (420), Expect = 1.074e-41
Identity = 221/953 (23.19%), Postives = 453/953 (47.53%), Query Frame = 3
Query:   84 LQLEFDEILTCIKPIYLSWKSQQDKSFIAGWIKKLTNLKNVTLDYMHLRN--LYILALYENLRRDILCDPFTKNPPIDELPPLSNHLR-QLIEKFSSKYTT------PDWLENDEKIDI-NCLENAVDYEEDDYVGDLKFANDMHDLKQNFLINSEKLNPSKSIEPEN--GGLSFGDVYKFHNFGTDWVRQSMNQVHEKDTRLIEDQEGLKQNLEDSRLKYKPNEYNAFNKVQEKEILLNNISGMERRLAQLQNAYHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDEIEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLS-------KEIEEHKKVIENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQE----DCKINF---TKKYNNDIDNLQKVVKNNLESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTST 2864
            L  EFD IL  +KP  L   ++ ++   A WIKKL +  +       LRN  LY   L   L+R +L  PFT  P    L  L  ++     E  + +         PDW+  +      N L   +D  +D Y          H  ++ +    E++N S+ + P    GG                 RQ        DTR++++     ++ EDS L+   N +N    VQ               +  L+  + E+ LKL+ +++++I+ I++RK+AEIE +++ ++ K +E +  ++ LE K    +++  +  ++K K+IE++K+    + +S  +E E K+   + + + EK  L +++ +  +    +T     K++ E+N +S +T +++ +LE  + +      K      K+  E+  L   V  L  +L E+ +R   +  +  +    H++ I  L+   ET +   +   D   AK+ + IE+ E  +  ++ +L D      +++ +  M +  EK   +   E ++ +++ +    K+++  KI  L + L   ++QL++A +    + + + + +E  K+++  + E+   +   + +++E +L      +  +  +  +QL   +++ E +++E R   + +   L    K EK ++ ++ Q ++S         +++H++  +   +  A+ ISEL++  E        L+ EL    +NHK + ++L  ++E E+ + + D + +L+ L      I+ +LE    +  +  L KTN ++K+IE EY ++  +S +LI+EL+ +    KEE +    A E    +    +    ++  +  D   K+++  LES +++L        S EK+L  K+ E ++++  +  EYE K+  LMP EV+ + E+TI SL+ Q+SFLQ+   +L++E+ + 
Sbjct:   11 LDTEFDHILLDMKPYVLKHPNRTERQRCAVWIKKLCDPASCGSGLTSLRNRNLYARLLLHMLKRGLLEGPFTSKPGPGTLKTLPAYMSIYFGEPLAGQSVGTNSRELPDWVTGELGASADNSL--VMDLLKDKYSS---TPVKTHHRRRLY----EEMNLSRPMSPNPLLGG----------------PRQ--------DTRMMDEALKADESPEDSDLEAHLNSWNTGTDVQ---------------IKVLEAKHQEEKLKLQQRHDADIEKILDRKHAEIEEMKSLYQAKQKESQELIRKLEKKVQSVLRESQVICQSKDKQIEELKKMSDQSSDSLRNEWEKKLHAAVSEVEQEKFLLQKKHTQSIQELLDDTNARLAKMEKEYNTRSQTTEQKVFELELRVKQQSVEVEKCNTLRQKVAKEKAQLEIHVASLSTELQEANRRIMALQKEKEQQSEQHDEFILKLEAKHETDISHLHQEHDLSAAKSAEVIEDFEKIVAQMKHQLQDTEYRRLQQVRDQEMKFQQEKTELQVNCEKKVSAIQAEAEKEKMEANRKIAKLEESLREMESQLDRARESQRQQIQQADRAMEQFKKQVELSSEKVYTEMKLQMKKVEEDLVHSKSLRENQAKEFSQQLDALREKYEQQMAEQRSQHEQERTRLQQQHKAEKDTMVQEHQREVSGVESQARAALQQHQQHSQEWRKRDAQTISELEALVEG-------LREELQDVRRNHKQQLTELASLHEEERRRAVLDKETSLDQLRSDMERIRSDLERSHQQEKNATLEKTNSRMKQIEKEYSQKLTKSAQLIAELQTSVCDSKEEALRTKQAMEKQLKEANARWDEERRRITHHADQTNKMLQEKLESLQRQL-------HSTEKKLLSKELETEEKVTMVHQEYEGKIKGLMPAEVRQELEDTITSLKAQVSFLQKTASLLQEELNAC 901          
BLAST of Centrosomal protein 112 vs. Ensembl Medaka
Match: cep112 (centrosomal protein 112 [Source:NCBI gene;Acc:101159196])

HSP 1 Score: 159.073 bits (401), Expect = 1.853e-39
Identity = 223/955 (23.35%), Postives = 441/955 (46.18%), Query Frame = 3
Query:   84 LQLEFDEILTCIKPIYLSWKSQQDKSFIAGWIKKLTNLKNVTLDYMHLRN--LYILALYENLRRDILCDPFTKNPPIDELPPLSNHLR-QLIEKFSSKYTT------PDWLENDEKIDI-NCLENAVDYEEDDYVGDLKFANDMHDLKQNFLINSEKLNPSKSIEPEN--GGLSFGDVYKFHNFGTDWVRQSMNQVHEKDTRLIEDQEGLKQNLEDSRLKYKPNEYNAFNKVQEKEILLNNISGMERRLAQLQNAYHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDEIEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKL--SEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLS-------KEIEEHKKVIENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQE----DCKINF---TKKYNNDIDNLQKVVKNNLESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTST 2864
            L  EFD IL  +KP  L   ++ ++   A WIKKL +  +       LRN  LY   L   L+R +L  PFT  P    L  L  ++     E  + +         PDW+  +      N L   +D  +D Y          H  ++ +    E++N S+ + P    GG                 RQ        DTR++++     ++ EDS L+   N +N    VQ               +  L+  + E+ LKL+ +++++I+ I++RK+AEIE +++ ++ K +E +  ++ LE K    +++  +  ++K K+IE++K+    + +S  +E E K+   + + + EK  L +++ +  +    +T     K++ E+N +S +T +++ +LE  + +      K      K+  E+  L   V  L  +L E+ +R   +  +  +    H++ I  L+   ET +   +   D   AK+ + IE+ E  +  ++ +L D      +++ +  M +  EK   +   E ++ +++ +    K+++  KI  L + L   ++QL++A +                      +  +Q+++     EQ + ++                +LS+ K  TE+KL  +E R   + +   L    K EK ++ ++ Q ++S         +++H++  +   +  A+ ISEL++  E        L+ EL    +NHK + ++L  ++E E+ + + D + +L+ L      I+ +LE    +  +  L KTN ++K+IE EY ++  +S +LI+EL+ +    KEE +    A E    +    +    ++  +  D   K+++  LES +++L        S EK+L  K+ E ++++  +  EYE K+  LMP EV+ + E+TI SL+ Q+SFLQ+   +L++E+ + 
Sbjct:   11 LDTEFDHILLDMKPYVLKHPNRTERQRCAVWIKKLCDPASCGSGLTSLRNRNLYARLLLHMLKRGLLEGPFTSKPGPGTLKTLPAYMSIYFGEPLAGQSVGTNSRELPDWVTGELGASADNSL--VMDLLKDKYSS---TPVKTHHRRRLY----EEMNLSRPMSPNPLLGG----------------PRQ--------DTRMMDEALKADESPEDSDLEAHLNSWNTGTDVQ---------------IKVLEAKHQEEKLKLQQRHDADIEKILDRKHAEIEEMKSLYQAKQKESQELIRKLEKKVQSVLRESQVICQSKDKQIEELKKMSDQSSDSLRNEWEKKLHAAVSEVEQEKFLLQKKHTQSIQELLDDTNARLAKMEKEYNTRSQTTEQKVFELELRVKQQSVEVEKCNTLRQKVAKEKAQLEIHVASLSTELQEANRRIMALQKEKEQQSEQHDEFILKLEAKHETDISHLHQEHDLSAAKSAEVIEDFEKIVAQMKHQLQDTEYRRLQQVRDQEMKFQQEKTELQVNCEKKVSAIQAEAEKEKMEANRKIAKLEESLREMESQLDRARE----------------------SQRQQIQQADRAMEQFKKQV----------------ELSSEKVYTEMKLQMAEQRSQHEQERTRLQQQHKAEKDTMVQEHQREVSGVESQARAALQQHQQHSQEWRKRDAQTISELEALVEG-------LREELQDVRRNHKQQLTELASLHEEERRRAVLDKETSLDQLRSDMERIRSDLERSHQQEKNATLEKTNSRMKQIEKEYSQKLTKSAQLIAELQTSVCDSKEEALRTKQAMEKQLKEANARWDEERRRITHHADQTNKMLQEKLESLQRQL-------HSTEKKLLSKELETEEKVTMVHQEYEGKIKGLMPAEVRQELEDTITSLKAQVSFLQKTASLLQEELNAC 865          
BLAST of Centrosomal protein 112 vs. Ensembl Medaka
Match: cep112 (centrosomal protein 112 [Source:NCBI gene;Acc:101159196])

HSP 1 Score: 150.984 bits (380), Expect = 6.613e-37
Identity = 213/946 (22.52%), Postives = 436/946 (46.09%), Query Frame = 3
Query:   84 LQLEFDEILTCIKPIYLSWKSQQDKSFIAGWIKKLTNLKNVTLDYMHLRN--LYILALYENLRRDILCDPFTKNPPIDELPPLSNHLR-QLIEKFSSKYTT------PDWLENDEKIDI-NCLENAVDYEEDDYVGDLKFANDMHDLKQNFLINSEKLNPSKSIEPEN--GGLSFGDVYKFHNFGTDWVRQSMNQVHEKDTRLIEDQEGLKQNLEDSRLKYKPNEYNAFNKVQEKEILLNNISGMERRLAQLQNAYHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDEIEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLS-------KEIEEHKKVIENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQEDCKINFTKKYNNDIDNLQKVVKNNLESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTST 2864
            L  EFD IL  +KP  L   ++ ++   A WIKKL +  +       LRN  LY   L   L+R +L  PFT  P    L  L  ++     E  + +         PDW+  +      N L   +D  +D Y          H  ++ +    E++N S+ + P    GG                 RQ        DTR++++     ++ EDS L+   N +N    VQ               +  L+  + E+ LKL+ +++++I+ I++RK+AEIE +++ ++ K +E +  ++ LE K    +++  +  ++K K+IE++K+    + +S  +E E K+   + + + EK  L +++ +  +    +T     K++ E+N +S +T +++ +LE  + +      K      K+  E+  L   V  L  +L E+ +R   +  +  +    H++ I  L+   ET +   +   D   AK+ + IE+ E  +  ++ +L D      +++ +  M +  EK   +   E ++ +++ +    K+++  KI  L + L   ++QL++A +    + + + + +E  K+++  + E+   +   + +++E +L      +  +  +  +QL   +++ E +++E R   + +   L    K EK ++ ++ Q ++S         +++H++  +   +  A+ ISEL++  E        L+ EL    +NHK + ++L  ++E E+ + + D + +L+ L      I+ +LE    +  +  L KTN ++K+IE EY ++  +S +LI+EL+ +    KEE +    A E       K+ N   D  ++ + ++ +   K                          +  +  EYE K+  LMP EV+ + E+TI SL+ Q+SFLQ+   +L++E+ + 
Sbjct:   11 LDTEFDHILLDMKPYVLKHPNRTERQRCAVWIKKLCDPASCGSGLTSLRNRNLYARLLLHMLKRGLLEGPFTSKPGPGTLKTLPAYMSIYFGEPLAGQSVGTNSRELPDWVTGELGASADNSL--VMDLLKDKYSS---TPVKTHHRRRLY----EEMNLSRPMSPNPLLGG----------------PRQ--------DTRMMDEALKADESPEDSDLEAHLNSWNTGTDVQ---------------IKVLEAKHQEEKLKLQQRHDADIEKILDRKHAEIEEMKSLYQAKQKESQELIRKLEKKVQSVLRESQVICQSKDKQIEELKKMSDQSSDSLRNEWEKKLHAAVSEVEQEKFLLQKKHTQSIQELLDDTNARLAKMEKEYNTRSQTTEQKVFELELRVKQQSVEVEKCNTLRQKVAKEKAQLEIHVASLSTELQEANRRIMALQKEKEQQSEQHDEFILKLEAKHETDISHLHQEHDLSAAKSAEVIEDFEKIVAQMKHQLQDTEYRRLQQVRDQEMKFQQEKTELQVNCEKKVSAIQAEAEKEKMEANRKIAKLEESLREMESQLDRARESQRQQIQQADRAMEQFKKQVELSSEKVYTEMKLQMKKVEEDLVHSKSLRENQAKEFSQQLDALREKYEQQMAEQRSQHEQERTRLQQQHKAEKDTMVQEHQREVSGVESQARAALQQHQQHSQEWRKRDAQTISELEALVEG-------LREELQDVRRNHKQQLTELASLHEEERRRAVLDKETSLDQLRSDMERIRSDLERSHQQEKNATLEKTNSRMKQIEKEYSQKLTKSAQLIAELQTSVCDSKEEALRTKQAME----KQLKEANARWDEERRRITHHADQTNK--------------------------VTMVHQEYEGKIKGLMPAEVRQELEDTITSLKAQVSFLQKTASLLQEELNAC 871          
BLAST of Centrosomal protein 112 vs. Planmine SMEST
Match: SMESG000041686.1 (SMESG000041686.1)

HSP 1 Score: 1814.28 bits (4698), Expect = 0.000e+0
Identity = 942/957 (98.43%), Postives = 942/957 (98.43%), Query Frame = 3
Query:   57 MNEDQTIKSLQLEFDEILTCIKPIYLSWKSQQDKSFIAGWIKKLTNLKNVTLDYMHLRNLYILALYENLRRDILCDPFTKNPPIDELPPLSNHLRQLIEKFSSKYTTPDWLENDEKIDINCLENAVDYEEDDYVGDLKFANDMHDLKQNFLINSEKLNPSKSIEPENGGLSFGDVYKFHNFGTDWVRQSMNQVHEKDTRLIEDQEGLKQNLEDSRLKYKPNEYNAFNKVQEKEILLNNISGMERRLAQLQNAYHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDEIEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLSKEIEEHKKVIENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQEDCKINFTKKYNNDIDNLQKVVKNNLESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQSNGFSKHKCDQLFE 2927
            MNEDQTIKSLQLEFDEILTCIKPIYLSWKSQQDKSFIAGWIKKLTNLKNVTLDYMHLRNLYILALYENLRRDILCDPFTKNPPIDELPPLSNHLRQLIEKFSSKYTTPDWLENDEKIDINCLENAVDYEEDDY               NFLINSEKLNPSKSIEPENGGLSFGDVYKFHNFGTDWVRQSMNQVHEKDTRLIEDQEGLKQNLEDSRLKYKPNEYNAFNKVQEKEILLNNISGMERRLAQLQNAYHEDILKLRNQNESEIQNIINRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDEIEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLSKEIEEHKKVIENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAEKLKEEKIELLNAQEDCKINFTKKYNNDIDNLQKVVKNNLESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQSNGFSKHKCDQLFE
Sbjct:    1 MNEDQTIKSLQLEFDEILTCIKPIYLSWKSQQDKSFIAGWIKKLTNLKNVTLDYMHLRNLYILALYENLRRDILCDPFTKNPPIDELPPLSNHLRQLIEKFSSKYTTPDWLENDEKIDINCLENAVDYEEDDY---------------NFLINSEKLNPSKSIEPENGGLSFGDVYKFHNFGTDWVRQSMNQVHEKDTRLIEDQEGLKQNLEDSRLKYKPNEYNAFNKVQEKEILLNNISGMERRLAQLQNAYHEDILKLRNQNESEIQNIINRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDEIEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLSKEIEEHKKVIENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAEKLKEEKIELLNAQEDCKINFTKKYNNDIDNLQKVVKNNLESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQSNGFSKHKCDQLFE 942          
BLAST of Centrosomal protein 112 vs. Planmine SMEST
Match: SMESG000041686.1 (SMESG000041686.1)

HSP 1 Score: 1210.28 bits (3130), Expect = 0.000e+0
Identity = 636/636 (100.00%), Postives = 636/636 (100.00%), Query Frame = 3
Query: 1020 IEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDEIEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLSKEIEEHKKVIENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQEDCKINFTKKYNNDIDNLQKVVKNNLESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQSNGFSKHKCDQLFE 2927
            IEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDEIEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLSKEIEEHKKVIENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAEKLKEEKIELLNAQEDCKINFTKKYNNDIDNLQKVVKNNLESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQSNGFSKHKCDQLFE
Sbjct:  139 IEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDEIEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLSKEIEEHKKVIENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAEKLKEEKIELLNAQEDCKINFTKKYNNDIDNLQKVVKNNLESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQSNGFSKHKCDQLFE 774          
BLAST of Centrosomal protein 112 vs. Planmine SMEST
Match: SMESG000041686.1 (SMESG000041686.1)

HSP 1 Score: 1210.28 bits (3130), Expect = 0.000e+0
Identity = 636/636 (100.00%), Postives = 636/636 (100.00%), Query Frame = 3
Query: 1020 IEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDEIEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLSKEIEEHKKVIENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQEDCKINFTKKYNNDIDNLQKVVKNNLESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQSNGFSKHKCDQLFE 2927
            IEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDEIEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLSKEIEEHKKVIENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAEKLKEEKIELLNAQEDCKINFTKKYNNDIDNLQKVVKNNLESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQSNGFSKHKCDQLFE
Sbjct:  136 IEQIKRNHVDNIESYNHENELKITNLMEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDEIEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLSKEIEEHKKVIENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAEKLKEEKIELLNAQEDCKINFTKKYNNDIDNLQKVVKNNLESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQSNGFSKHKCDQLFE 771          
BLAST of Centrosomal protein 112 vs. Planmine SMEST
Match: SMESG000041686.1 (SMESG000041686.1)

HSP 1 Score: 1162.52 bits (3006), Expect = 0.000e+0
Identity = 610/610 (100.00%), Postives = 610/610 (100.00%), Query Frame = 3
Query: 1098 MEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDEIEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLSKEIEEHKKVIENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAXXXXXXXXXXXNAQEDCKINFTKKYNNDIDNLQKVVKNNLESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQSNGFSKHKCDQLFE 2927
            MEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDEIEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLSKEIEEHKKVIENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAEKLKEEKIELLNAQEDCKINFTKKYNNDIDNLQKVVKNNLESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQSNGFSKHKCDQLFE
Sbjct:    1 MEDFQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEADITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQHNRLMMSHEKDINSLKETLETALHKANITKDEIEAKAHDKIEELENQIKDLQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKLQSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHERQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIRKWSDSQILGLTNDWKQEKLSLEKDFQLQLSKEIEEHKKVIENLNEEKAKKISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIEDHKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSMQSFKLISELKVTAEKLKEEKIELLNAQEDCKINFTKKYNNDIDNLQKVVKNNLESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLMPVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQSNGFSKHKCDQLFE 610          
BLAST of Centrosomal protein 112 vs. Planmine SMEST
Match: SMESG000041686.1 (SMESG000041686.1)

HSP 1 Score: 598.971 bits (1543), Expect = 0.000e+0
Identity = 308/335 (91.94%), Postives = 311/335 (92.84%), Query Frame = 3
Query:   57 MNEDQTIKSLQLEFDEILTCIKPIYLSWKSQQDKSFIAGWIKKLTNLKNVTLDYMHLRNLYILALYENLRRDILCDPFTKNPPIDELPPLSNHLRQLIEKFSSKYTTPDWLENDEKIDINCLENAVDYEEDDYVGDLKFANDMHDLKQNFLINSEKLNPSKSIEPENGGLSFGDVYKFHNFGTDWVRQSMNQVHEKDTRLIEDQEGLKQNLEDSRLKYKPNEYNAFNKVQEKEILLNNISGMERRLAQLQNAYHEDILKLRXXXXXXXXXXXXRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIES 1061
            MNEDQTIKSLQLEFDEILTCIKPIYLSWKSQQDKSFIAGWIKKLTNLKNVTLDYMHLRNLYILALYENLRRDILCDPFTKNPPIDELPPLSNHLRQLIEKFSSKYTTPDWLENDEKIDINCLENAVDYEEDDY               NFLINSEKLNPSKSIEPENGGLSFGDVYKFHNFGTDWVRQSMNQVHEKDTRLIEDQEGLKQNLEDSRLKYKPNEYNAFNKVQEKEILLNNISGMERRLAQLQNAYHEDILKLRNQNESEIQNIINRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKE E +    +  I+ 
Sbjct:    1 MNEDQTIKSLQLEFDEILTCIKPIYLSWKSQQDKSFIAGWIKKLTNLKNVTLDYMHLRNLYILALYENLRRDILCDPFTKNPPIDELPPLSNHLRQLIEKFSSKYTTPDWLENDEKIDINCLENAVDYEEDDY---------------NFLINSEKLNPSKSIEPENGGLSFGDVYKFHNFGTDWVRQSMNQVHEKDTRLIEDQEGLKQNLEDSRLKYKPNEYNAFNKVQEKEILLNNISGMERRLAQLQNAYHEDILKLRNQNESEIQNIINRKNAEIELIRTNFKEKFQEQEIQMQVLETKANDCMKQLHLFQETKLKEFELLLSKMIPGIKC 320          
The following BLAST results are available for this feature:
BLAST of Centrosomal protein 112 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CEP1124.863e-4624.87centrosomal protein 112 [Source:HGNC Symbol;Acc:HG... [more]
CEP1121.153e-4424.80centrosomal protein 112 [Source:HGNC Symbol;Acc:HG... [more]
CEP1121.153e-4424.80centrosomal protein 112 [Source:HGNC Symbol;Acc:HG... [more]
CEP1121.554e-1636.36centrosomal protein 112 [Source:HGNC Symbol;Acc:HG... [more]
CEP1121.266e-1123.71centrosomal protein 112 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Centrosomal protein 112 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein 112 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein 112 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cep1122.418e-2421.93centrosomal protein 112 [Source:ZFIN;Acc:ZDB-GENE-... [more]
cep1121.087e-2122.30centrosomal protein 112 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Centrosomal protein 112 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mtg21.366e-835.63mitochondrial ribosome-associated GTPase 2 [Source... [more]
back to top
BLAST of Centrosomal protein 112 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cep1121.031e-4424.09centrosomal protein 112 [Source:MGI Symbol;Acc:MGI... [more]
Cep1121.580e-4224.16centrosomal protein 112 [Source:MGI Symbol;Acc:MGI... [more]
Cep1121.827e-4224.11centrosomal protein 112 [Source:MGI Symbol;Acc:MGI... [more]
Cep1121.827e-4224.11centrosomal protein 112 [Source:MGI Symbol;Acc:MGI... [more]
Cep1127.548e-1735.37centrosomal protein 112 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Centrosomal protein 112 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q8N8E3|CE112_HUMAN5.538e-4424.80Centrosomal protein of 112 kDa OS=Homo sapiens OX=... [more]
sp|Q5PR68|CE112_MOUSE3.896e-3524.22Centrosomal protein of 112 kDa OS=Mus musculus OX=... [more]
back to top
BLAST of Centrosomal protein 112 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4X1SUD92.797e-4625.54Centrosomal protein 112 OS=Sus scrofa OX=9823 GN=C... [more]
A0A4W2EDU51.160e-4524.23Centrosomal protein 112 OS=Bos indicus x Bos tauru... [more]
A0A4W2GFU62.545e-4524.54Centrosomal protein 112 OS=Bos indicus x Bos tauru... [more]
A0A2R9CJU02.276e-4424.97Centrosomal protein 112 OS=Pan paniscus OX=9597 GN... [more]
A0A5F9CS707.256e-4424.49Centrosomal protein 112 OS=Oryctolagus cuniculus O... [more]
back to top
BLAST of Centrosomal protein 112 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cep1121.544e-1721.68centrosomal protein 112 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Centrosomal protein 112 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000008348.11.097e-820.42pep scaffold:Pmarinus_7.0:GL476515:143484:211518:-... [more]
back to top
BLAST of Centrosomal protein 112 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein 112 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO319132.672e-2823.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO290196.044e-1523.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Centrosomal protein 112 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cep1128.096e-4223.19centrosomal protein 112 [Source:NCBI gene;Acc:1011... [more]
cep1128.096e-4223.19centrosomal protein 112 [Source:NCBI gene;Acc:1011... [more]
cep1121.074e-4123.19centrosomal protein 112 [Source:NCBI gene;Acc:1011... [more]
cep1121.853e-3923.35centrosomal protein 112 [Source:NCBI gene;Acc:1011... [more]
cep1126.613e-3722.52centrosomal protein 112 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Centrosomal protein 112 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041686.10.000e+098.43SMESG000041686.1[more]
SMESG000041686.10.000e+0100.00SMESG000041686.1[more]
SMESG000041686.10.000e+0100.00SMESG000041686.1[more]
SMESG000041686.10.000e+0100.00SMESG000041686.1[more]
SMESG000041686.10.000e+091.94SMESG000041686.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008379 ID=SMED30008379|Name=Centrosomal protein 112|organism=Schmidtea mediterranea sexual|type=transcript|length=3023bp
GAATTTGAAAGCATGGTTACCGCTATTAACATTTAATCTTAAATTTACGA
ATAATTATGAATGAAGATCAGACAATAAAATCATTGCAATTAGAATTTGA
TGAAATTTTAACTTGCATCAAACCCATTTATCTTAGTTGGAAAAGCCAAC
AAGATAAATCCTTCATTGCTGGATGGATCAAAAAATTGACTAATTTAAAA
AATGTTACACTTGATTACATGCATCTAAGAAATCTTTATATATTAGCACT
GTACGAAAATTTGCGGCGTGACATACTTTGTGATCCTTTTACAAAAAATC
CTCCGATCGATGAACTTCCACCATTGTCGAATCATCTTAGACAGTTAATT
GAGAAATTTTCTAGCAAGTACACAACGCCGGATTGGTTGGAAAATGATGA
GAAAATCGACATCAATTGTCTTGAAAACGCGGTTGATTACGAAGAGGATG
ATTATGTTGGTGACTTAAAATTTGCAAATGATATGCATGATTTAAAACAG
AATTTTTTGATTAATTCCGAAAAATTAAATCCTTCAAAATCAATTGAACC
GGAAAACGGTGGCCTCTCTTTTGGAGATGTATATAAGTTTCATAATTTCG
GTACTGATTGGGTTCGTCAGTCTATGAATCAAGTTCATGAAAAAGATACG
AGACTGATTGAAGATCAAGAAGGACTAAAACAAAATCTGGAAGACAGCAG
ACTGAAATATAAACCGAACGAATATAATGCATTTAACAAGGTTCAAGAGA
AAGAAATTCTTTTAAATAATATCAGCGGGATGGAAAGAAGATTAGCTCAG
TTACAAAATGCATATCACGAGGATATATTGAAACTAAGGAACCAGAATGA
AAGCGAAATACAGAATATAATTAATCGGAAAAATGCAGAAATAGAGCTTA
TTCGTACAAATTTCAAAGAAAAGTTTCAAGAACAAGAAATTCAGATGCAA
GTATTAGAGACCAAAGCCAATGATTGTATGAAACAATTACACTTGTTTCA
GGAAACTAAGTTAAAAGAGATTGAACAGATAAAGCGAAATCACGTAGACA
ACATCGAAAGTTATAACCACGAAAATGAATTGAAAATCACTAATCTAATG
GAAGATTTTCAAAACGAGAAACAGAAACTAATCGAAGAAAATAGAAGACG
CGAAGAAATGTTTTCTAAAGAAACGAAAGAATACTTTGAAAAGGTCAAGC
ATGAATTTAATGAAAAATCTACCAGCACAAACCGACAAATTATCGACTTA
GAAGCCGATATTACGGAGTTGAAAAATTCAAAGAATAAAATTGTAGAGCA
GAATGACAAACTAAAGTTAGAACGAGATAATCTGTTCGGTGAAGTTCGAA
AACTGCAAAACGATTTAAGCGAATCCCAAAAGAGATATCAATTTATTGAC
AGTCAACATAACCGTCTAATGATGTCTCACGAAAAAGATATTAATTCTCT
AAAAGAAACATTGGAAACAGCATTGCACAAAGCTAATATTACTAAAGACG
AAATTGAGGCCAAAGCTCATGATAAAATTGAAGAACTAGAAAATCAGATA
AAAGATCTACAAATGAAACTTCTTGATGCTCATCGGACTTATAAAAAGGA
ATTAGAAAACATCAATATGAGTTATGGCAGTGAAAAGTTTCGATCCAAAC
AAGCCTATGAGGATGAATTGGAAAGCGTAAAACTCCAACTTAGAAATTAT
AAATTACAATCTGAACCTAAAATCCAAGACCTATTAAAGAAATTGGAGGT
AAAAGATACTCAATTAAATCAAGCTAATAAAGAATTGGAAATGAAAGAGA
AAATATCAGTGCAATTGGTAGAAGATATGAAACAAGAGCTGTCTCATAAT
CATGAACGTCAAATGCGTAAAAAACATTTTGAATTCGAACAGATAGAATC
AGAATTGAAAGAGGAAATTCAAGAAAAAAATAAAGAAGTAATTGATCTAA
TGCGCCAGTTGAGTAATCACAAACAGGAAACAGAATTGAAACTTTCTGAA
ATAAGAAAATGGTCTGATAGTCAAATATTGGGTTTAACAAATGACTGGAA
ACAGGAAAAATTATCATTGGAAAAAGATTTCCAACTTCAGTTGTCGAAAG
AAATCGAAGAACACAAAAAGGTAATAGAAAATCTAAATGAAGAAAAGGCC
AAAAAAATTTCTGAATTACAAAGTTCATTTGAATCGAAATCTCATGAAAT
ACCAATCTTGAAACGTGAACTTTACCAGCAAGCACAGAATCACAAGAATG
AGACTAGCGACTTGATTCATATGTACGAATCCGAGAAAGCGAAAATTATC
GAAGACCACAAAATTGCTCTGGAAAATTTGACTCGACAAACTAATGATAT
AAAAGTCAATTTAGAAGAAAAACAATCTGAAAACATTTCTCAGATTTTAT
CAAAGACAAATATCAAATTAAAGGAAATCGAAAATGAATATGGTGAAAGA
TCGATGCAGTCATTTAAACTTATTAGTGAGTTAAAAGTGACGGCTGAAAA
ATTGAAAGAAGAAAAGATTGAATTGTTGAATGCCCAAGAAGATTGTAAAA
TTAATTTTACTAAAAAATATAACAACGACATTGATAATTTGCAAAAGGTT
GTGAAAAATAATCTAGAGTCCTATAAAAAAGAGCTCAGTAATGAGCAATT
AAGGTACCGAAGCCTTGAAAAGCAATTAGAAAGAAAAGATCATGAAATAA
AAAAGCAAATAAATTTTATGAAATTGGAATATGAAACTAAGTTGTCCAAA
TTAATGCCGGTAGAAGTTCAAAACGATTACGAAGAAACAATTCAGTCTTT
GAGAACTCAAATATCGTTTTTACAGCAGAAGATTGGAATACTTGAAGACG
AAGTGACATCGACAAACATGTTCAAAACCTATCAGAGCAATGGTTTCTCC
AAGCATAAATGTGATCAATTATTTGAATAGTATTGTAACTGATTGTGATT
TCTTGTGATAATTATTATTATGACCATGAGTTTGATATGCTTGTCTGACA
TCATGATTTATTTCTCTGTAATT
back to top

protein sequence of SMED30008379-orf-1

>SMED30008379-orf-1 ID=SMED30008379-orf-1|Name=SMED30008379-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=958bp
MNEDQTIKSLQLEFDEILTCIKPIYLSWKSQQDKSFIAGWIKKLTNLKNV
TLDYMHLRNLYILALYENLRRDILCDPFTKNPPIDELPPLSNHLRQLIEK
FSSKYTTPDWLENDEKIDINCLENAVDYEEDDYVGDLKFANDMHDLKQNF
LINSEKLNPSKSIEPENGGLSFGDVYKFHNFGTDWVRQSMNQVHEKDTRL
IEDQEGLKQNLEDSRLKYKPNEYNAFNKVQEKEILLNNISGMERRLAQLQ
NAYHEDILKLRNQNESEIQNIINRKNAEIELIRTNFKEKFQEQEIQMQVL
ETKANDCMKQLHLFQETKLKEIEQIKRNHVDNIESYNHENELKITNLMED
FQNEKQKLIEENRRREEMFSKETKEYFEKVKHEFNEKSTSTNRQIIDLEA
DITELKNSKNKIVEQNDKLKLERDNLFGEVRKLQNDLSESQKRYQFIDSQ
HNRLMMSHEKDINSLKETLETALHKANITKDEIEAKAHDKIEELENQIKD
LQMKLLDAHRTYKKELENINMSYGSEKFRSKQAYEDELESVKLQLRNYKL
QSEPKIQDLLKKLEVKDTQLNQANKELEMKEKISVQLVEDMKQELSHNHE
RQMRKKHFEFEQIESELKEEIQEKNKEVIDLMRQLSNHKQETELKLSEIR
KWSDSQILGLTNDWKQEKLSLEKDFQLQLSKEIEEHKKVIENLNEEKAKK
ISELQSSFESKSHEIPILKRELYQQAQNHKNETSDLIHMYESEKAKIIED
HKIALENLTRQTNDIKVNLEEKQSENISQILSKTNIKLKEIENEYGERSM
QSFKLISELKVTAEKLKEEKIELLNAQEDCKINFTKKYNNDIDNLQKVVK
NNLESYKKELSNEQLRYRSLEKQLERKDHEIKKQINFMKLEYETKLSKLM
PVEVQNDYEETIQSLRTQISFLQQKIGILEDEVTSTNMFKTYQSNGFSKH
KCDQLFE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027831DUF4485
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0060077inhibitory synapse
Vocabulary: biological process
TermDefinition
GO:0097120receptor localization to synapse
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 905..932
NoneNo IPR availableCOILSCoilCoilcoord: 676..703
NoneNo IPR availableCOILSCoilCoilcoord: 283..303
NoneNo IPR availableCOILSCoilCoilcoord: 319..339
NoneNo IPR availableCOILSCoilCoilcoord: 455..511
NoneNo IPR availableCOILSCoilCoilcoord: 344..368
NoneNo IPR availableCOILSCoilCoilcoord: 556..590
NoneNo IPR availableCOILSCoilCoilcoord: 395..450
NoneNo IPR availableCOILSCoilCoilcoord: 846..880
NoneNo IPR availableCOILSCoilCoilcoord: 232..252
NoneNo IPR availableCOILSCoilCoilcoord: 806..833
NoneNo IPR availableCOILSCoilCoilcoord: 614..641
NoneNo IPR availableCOILSCoilCoilcoord: 531..551
NoneNo IPR availableCOILSCoilCoilcoord: 748..794
NoneNo IPR availablePANTHERPTHR18871FAMILY NOT NAMEDcoord: 3..935
IPR027831Domain of unknown function DUF4485PFAMPF14846DUF4485coord: 10..92
e-value: 5.1E-16
score: 58.5