Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30008378
Length (bp)1722
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30008378) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30008378) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30008378) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30008378) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008378

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30008378SMESG000003368.1 dd_Smed_v4_8275_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30008378SMESG000003368.1 dd_Smed_v4_8275_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 165.622 bits (418), Expect = 1.892e-43
Identity = 110/357 (30.81%), Postives = 174/357 (48.74%), Query Frame = 1
Query:  475 RYLCFTHNESYVDTTRTFSDCNLNDGDLILMENLLETKHEHFCEITLESINHNYESISLFVTRQETIDYIKLKLSKEINIPVKNIQLFNNETQLELCENSENLCMEKRIFYNIFPDFE-NVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRF---CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTA-KSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHF 1524
            RY    H++ Y D  RTF     + G+L  +              +  S++ N E++ L V                        Q  +   +L   ++   L +++R      P    N  +  L+ +G+FG VY C  +++ +E A K+++F      +  E+     EI +L +L  H RIV++    +   E  L I MEY+PGGS+   ++++G L E    + +++ILE + YLH   I+HRDIKG N+L D   +VKL DF  SK L        ++GT  +S  GT  WM+PE+I+G+ Y   AD+WS G TV+EM T KPP++E    A IF+I  +     ++P H 
Sbjct:  278 RYHVSVHHKDYSDGRRTFPRIRRHQGNLFTLV------------PSSRSLSTNGENMGLAV------------------------QYLDPRGRLRSADSENALSVQERNVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNL-QHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC----MSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ-PTNPQLPSHI 592          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 165.236 bits (417), Expect = 2.594e-43
Identity = 110/357 (30.81%), Postives = 174/357 (48.74%), Query Frame = 1
Query:  475 RYLCFTHNESYVDTTRTFSDCNLNDGDLILMENLLETKHEHFCEITLESINHNYESISLFVTRQETIDYIKLKLSKEINIPVKNIQLFNNETQLELCENSENLCMEKRIFYNIFPDFE-NVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRF---CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTA-KSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHF 1524
            RY    H++ Y D  RTF     + G+L  +              +  S++ N E++ L V                        Q  +   +L   ++   L +++R      P    N  +  L+ +G+FG VY C  +++ +E A K+++F      +  E+     EI +L +L  H RIV++    +   E  L I MEY+PGGS+   ++++G L E    + +++ILE + YLH   I+HRDIKG N+L D   +VKL DF  SK L        ++GT  +S  GT  WM+PE+I+G+ Y   AD+WS G TV+EM T KPP++E    A IF+I  +     ++P H 
Sbjct:  274 RYHVSVHHKDYSDGRRTFPRIRRHQGNLFTLV------------PSSRSLSTNGENMGLAV------------------------QYLDPRGRLRSADSENALSVQERNVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNL-QHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC----MSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ-PTNPQLPSHI 588          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 165.622 bits (418), Expect = 2.646e-43
Identity = 110/357 (30.81%), Postives = 174/357 (48.74%), Query Frame = 1
Query:  475 RYLCFTHNESYVDTTRTFSDCNLNDGDLILMENLLETKHEHFCEITLESINHNYESISLFVTRQETIDYIKLKLSKEINIPVKNIQLFNNETQLELCENSENLCMEKRIFYNIFPDFE-NVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRF---CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTA-KSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHF 1524
            RY    H++ Y D  RTF     + G+L  +              +  S++ N E++ L V                        Q  +   +L   ++   L +++R      P    N  +  L+ +G+FG VY C  +++ +E A K+++F      +  E+     EI +L +L  H RIV++    +   E  L I MEY+PGGS+   ++++G L E    + +++ILE + YLH   I+HRDIKG N+L D   +VKL DF  SK L        ++GT  +S  GT  WM+PE+I+G+ Y   AD+WS G TV+EM T KPP++E    A IF+I  +     ++P H 
Sbjct:  305 RYHVSVHHKDYSDGRRTFPRIRRHQGNLFTLV------------PSSRSLSTNGENMGLAV------------------------QYLDPRGRLRSADSENALSVQERNVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNL-QHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC----MSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ-PTNPQLPSHI 619          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 165.622 bits (418), Expect = 2.863e-43
Identity = 110/357 (30.81%), Postives = 174/357 (48.74%), Query Frame = 1
Query:  475 RYLCFTHNESYVDTTRTFSDCNLNDGDLILMENLLETKHEHFCEITLESINHNYESISLFVTRQETIDYIKLKLSKEINIPVKNIQLFNNETQLELCENSENLCMEKRIFYNIFPDFE-NVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRF---CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTA-KSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHF 1524
            RY    H++ Y D  RTF     + G+L  +              +  S++ N E++ L V                        Q  +   +L   ++   L +++R      P    N  +  L+ +G+FG VY C  +++ +E A K+++F      +  E+     EI +L +L  H RIV++    +   E  L I MEY+PGGS+   ++++G L E    + +++ILE + YLH   I+HRDIKG N+L D   +VKL DF  SK L        ++GT  +S  GT  WM+PE+I+G+ Y   AD+WS G TV+EM T KPP++E    A IF+I  +     ++P H 
Sbjct:  309 RYHVSVHHKDYSDGRRTFPRIRRHQGNLFTLV------------PSSRSLSTNGENMGLAV------------------------QYLDPRGRLRSADSENALSVQERNVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNL-QHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC----MSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ-PTNPQLPSHI 623          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 165.622 bits (418), Expect = 2.863e-43
Identity = 110/357 (30.81%), Postives = 174/357 (48.74%), Query Frame = 1
Query:  475 RYLCFTHNESYVDTTRTFSDCNLNDGDLILMENLLETKHEHFCEITLESINHNYESISLFVTRQETIDYIKLKLSKEINIPVKNIQLFNNETQLELCENSENLCMEKRIFYNIFPDFE-NVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRF---CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTA-KSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHF 1524
            RY    H++ Y D  RTF     + G+L  +              +  S++ N E++ L V                        Q  +   +L   ++   L +++R      P    N  +  L+ +G+FG VY C  +++ +E A K+++F      +  E+     EI +L +L  H RIV++    +   E  L I MEY+PGGS+   ++++G L E    + +++ILE + YLH   I+HRDIKG N+L D   +VKL DF  SK L        ++GT  +S  GT  WM+PE+I+G+ Y   AD+WS G TV+EM T KPP++E    A IF+I  +     ++P H 
Sbjct:  309 RYHVSVHHKDYSDGRRTFPRIRRHQGNLFTLV------------PSSRSLSTNGENMGLAV------------------------QYLDPRGRLRSADSENALSVQERNVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNL-QHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC----MSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ-PTNPQLPSHI 623          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: nsy-1 (Mitogen-activated protein kinase kinase kinase nsy-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21029])

HSP 1 Score: 147.132 bits (370), Expect = 8.766e-37
Identity = 86/235 (36.60%), Postives = 136/235 (57.87%), Query Frame = 1
Query:  820 DFENVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKF-----EQKFAKENCLYILMEYVPGGSLGSYIRSH-GRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLD-YERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQ--YDCAADIWSFGATVIEMFTGKPPYSEL-GYYAVIFRIGFEK 1494
            +  N  ++ ++ +G++G+VY    ++++++  +KE+    +   E+    +EI++  +L  H  IV++       K    +   I ME+VPGGSL S +RS  G +NE  +    ++ILE ++YLH L I+HRDIKGDNVL++ Y    K+ DF   K L        LN   ++F GT  +MAPE+I+  Q  Y   ADIWSFG T++EM TG+PP+ E+    A +FR+G  K
Sbjct:  660 ELSNSNERVVLGKGTYGTVYAARDMDTQRQIVVKEIEV--KYDEEVQPLMEEISLHSTLC-HANIVQYLGCDLVGKDGSNDHFLIFMEHVPGGSLSSLLRSKWGPMNENAMNYYGKQILEGLKYLHELKIVHRDIKGDNVLVNTYSGVCKISDFGTCKRL------AGLNPVTETFTGTLQYMAPEVIDHGQRGYGAPADIWSFGCTMVEMATGRPPFVEMQNPQAAMFRVGMFK 885          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: nsy-1 (Mitogen-activated protein kinase kinase kinase nsy-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21029])

HSP 1 Score: 147.132 bits (370), Expect = 9.129e-37
Identity = 86/235 (36.60%), Postives = 136/235 (57.87%), Query Frame = 1
Query:  820 DFENVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKF-----EQKFAKENCLYILMEYVPGGSLGSYIRSH-GRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLD-YERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQ--YDCAADIWSFGATVIEMFTGKPPYSEL-GYYAVIFRIGFEK 1494
            +  N  ++ ++ +G++G+VY    ++++++  +KE+    +   E+    +EI++  +L  H  IV++       K    +   I ME+VPGGSL S +RS  G +NE  +    ++ILE ++YLH L I+HRDIKGDNVL++ Y    K+ DF   K L        LN   ++F GT  +MAPE+I+  Q  Y   ADIWSFG T++EM TG+PP+ E+    A +FR+G  K
Sbjct:  646 ELSNSNERVVLGKGTYGTVYAARDMDTQRQIVVKEIEV--KYDEEVQPLMEEISLHSTLC-HANIVQYLGCDLVGKDGSNDHFLIFMEHVPGGSLSSLLRSKWGPMNENAMNYYGKQILEGLKYLHELKIVHRDIKGDNVLVNTYSGVCKISDFGTCKRL------AGLNPVTETFTGTLQYMAPEVIDHGQRGYGAPADIWSFGCTMVEMATGRPPFVEMQNPQAAMFRVGMFK 871          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: cst-2 (Caenorhabditis STE20-like kinase [Source:UniProtKB/TrEMBL;Acc:Q304D8])

HSP 1 Score: 139.428 bits (350), Expect = 8.454e-36
Identity = 83/230 (36.09%), Postives = 125/230 (54.35%), Query Frame = 1
Query:  850 IDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGR-LNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHFKKEF 1536
            +  GS+GSV+K +   S    A+K++   D    EI    KEI+I+        +VK+   + K + L+I+MEY   GS+   +R+  + L+E+EI    ++ L+ +QYLH L  IHRDIK  N+LL+ +   KL DF ++  L    +K        + +GT  WMAPE+I    YD  ADIWS G T IEM  G+PPYS++     IF I  +    ++ P+ +  EF
Sbjct:   41 LGEGSYGSVHKAIHRESGHVLAIKKVP-VDTDLQEI---IKEISIMQQCKSK-YVVKYYGSYFKHSDLWIVMEYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHRDIKAGNILLNTDGIAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIEEIGYDTKADIWSLGITAIEMAEGRPPYSDIHPMRAIFMIPTKPPPTFKKPEEWSSEF 259          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: cst-1 (Serine/threonine-protein kinase cst-1 Serine/threonine-protein kinase cst-1 37kDa subunit Serine/threonine-protein kinase cst-1 18kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:Q9NB31])

HSP 1 Score: 139.813 bits (351), Expect = 1.808e-35
Identity = 83/230 (36.09%), Postives = 125/230 (54.35%), Query Frame = 1
Query:  850 IDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGR-LNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHFKKEF 1536
            +  GS+GSV+K +   S    A+K++   D    EI    KEI+I+        +VK+   + K + L+I+MEY   GS+   +R+  + L+E+EI    ++ L+ +QYLH L  IHRDIK  N+LL+ +   KL DF ++  L    +K        + +GT  WMAPE+I    YD  ADIWS G T IEM  G+PPYS++     IF I  +    ++ P+ +  EF
Sbjct:   41 LGEGSYGSVHKAIHRESGHVLAIKKVP-VDTDLQEI---IKEISIMQQCKSK-YVVKYYGSYFKHSDLWIVMEYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHRDIKAGNILLNTDGIAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIEEIGYDTKADIWSLGITAIEMAEGRPPYSDIHPMRAIFMIPTKPPPTFKKPEEWSSEF 259          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: cst-1 (Serine/threonine-protein kinase cst-1 Serine/threonine-protein kinase cst-1 37kDa subunit Serine/threonine-protein kinase cst-1 18kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:Q9NB31])

HSP 1 Score: 139.813 bits (351), Expect = 2.064e-35
Identity = 83/230 (36.09%), Postives = 125/230 (54.35%), Query Frame = 1
Query:  850 IDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGR-LNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHFKKEF 1536
            +  GS+GSV+K +   S    A+K++   D    EI    KEI+I+        +VK+   + K + L+I+MEY   GS+   +R+  + L+E+EI    ++ L+ +QYLH L  IHRDIK  N+LL+ +   KL DF ++  L    +K        + +GT  WMAPE+I    YD  ADIWS G T IEM  G+PPYS++     IF I  +    ++ P+ +  EF
Sbjct:   41 LGEGSYGSVHKAIHRESGHVLAIKKVP-VDTDLQEI---IKEISIMQQCKSK-YVVKYYGSYFKHSDLWIVMEYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHRDIKAGNILLNTDGIAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIEEIGYDTKADIWSLGITAIEMAEGRPPYSDIHPMRAIFMIPTKPPPTFKKPEEWSSEF 259          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: GckIII (gene:FBgn0266465 transcript:FBtr0083399)

HSP 1 Score: 147.902 bits (372), Expect = 1.443e-37
Identity = 86/215 (40.00%), Postives = 121/215 (56.28%), Query Frame = 1
Query:  838 KQDLIDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRI 1482
            KQ+ I +GSFG V+K +   +++  A+K +   + +  EID   +EI +L    D P + K+   F K   L+I+MEY+ GGS    +++ G   E  I    +E+L+ + YLH    +HRDIK  NVLL  +  VKL DF ++  L +  SK        +FVGT  WMAPE+I   QYD  ADIWS G T IE+  G+PP SEL    V+F I
Sbjct:   15 KQERIGKGSFGEVFKGIDNRTQQVVAIKIIDL-EEAEDEIDDIQQEIMVLSQC-DSPYVTKYYGSFLKGTKLWIIMEYLGGGSALDLMKA-GSFEEMHIGIILREVLKGLDYLHSERKLHRDIKAANVLLSEQGDVKLADFGVAGQLTNTTSK------RNTFVGTPFWMAPEVIKQSQYDAKADIWSLGITAIELAKGEPPNSELHPMRVLFLI 220          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Ask1 (gene:FBgn0014006 transcript:FBtr0300256)

HSP 1 Score: 147.517 bits (371), Expect = 6.874e-37
Identity = 88/233 (37.77%), Postives = 138/233 (59.23%), Query Frame = 1
Query:  820 DFENVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSH-GRL--NEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLD-YERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIING--KQYDCAADIWSFGATVIEMFTGKPPYSELG-YYAVIFRIGFEKK 1497
            D++   ++ ++ +G++G+VY      ++   A+KE+   +++  ++   ++EI +   L  H  IV++    ++     I ME VPGGSL   + +  G L  NE  +   S++ILE ++YLH   I+HRDIKGDNVL++ Y   VK+ DF  SK L        +N   ++F GT  +MAPE+I+   + Y  AADIWSFG T +EM TGKPP+ ELG  +A +F++GF KK
Sbjct:  581 DYDEQNRKMVLGKGTYGTVYAARDKQTQVRIAIKEV--PEKNSQDVQPLHEEIKLHSQL-RHRNIVRYLGSCSENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAFYSKQILEGLKYLHEQDIVHRDIKGDNVLVNTYSGVVKISDFGTSKRL------ARINPMTETFTGTLQYMAPEVIDQGVRGYGPAADIWSFGCTNVEMATGKPPFIELGSAHAAMFKVGFYKK 804          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Ask1 (gene:FBgn0014006 transcript:FBtr0083819)

HSP 1 Score: 147.517 bits (371), Expect = 7.200e-37
Identity = 88/233 (37.77%), Postives = 138/233 (59.23%), Query Frame = 1
Query:  820 DFENVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSH-GRL--NEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLD-YERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIING--KQYDCAADIWSFGATVIEMFTGKPPYSELG-YYAVIFRIGFEKK 1497
            D++   ++ ++ +G++G+VY      ++   A+KE+   +++  ++   ++EI +   L  H  IV++    ++     I ME VPGGSL   + +  G L  NE  +   S++ILE ++YLH   I+HRDIKGDNVL++ Y   VK+ DF  SK L        +N   ++F GT  +MAPE+I+   + Y  AADIWSFG T +EM TGKPP+ ELG  +A +F++GF KK
Sbjct:  414 DYDEQNRKMVLGKGTYGTVYAARDKQTQVRIAIKEV--PEKNSQDVQPLHEEIKLHSQL-RHRNIVRYLGSCSENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAFYSKQILEGLKYLHEQDIVHRDIKGDNVLVNTYSGVVKISDFGTSKRL------ARINPMTETFTGTLQYMAPEVIDQGVRGYGPAADIWSFGCTNVEMATGKPPFIELGSAHAAMFKVGFYKK 637          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: hpo (gene:FBgn0261456 transcript:FBtr0331920)

HSP 1 Score: 141.354 bits (355), Expect = 3.385e-35
Identity = 86/230 (37.39%), Postives = 118/230 (51.30%), Query Frame = 1
Query:  850 IDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGR-LNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHFKKEF 1536
            +  GS+GSVYK V   S    A+K L   +    EI    KEI+I+    D P +V++   + K+  L+I MEY   GS+   +R   + L E EI     + L+ + YLH    IHRDIK  N+LL+ E + KL DF ++  L    +K        + +GT  WMAPE+I    YDC ADIWS G T +EM  GKPPY E+     IF I  +    +  P  +  EF
Sbjct:   48 LGEGSYGSVYKAVHKESSSIVAIK-LVPVESDLHEI---IKEISIMQQC-DSPYVVRYYGSYFKQYDLWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANILLNTEGYAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIEEIGYDCVADIWSLGITALEMAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEF 266          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: hpo (gene:FBgn0261456 transcript:FBtr0086500)

HSP 1 Score: 141.354 bits (355), Expect = 3.385e-35
Identity = 86/230 (37.39%), Postives = 118/230 (51.30%), Query Frame = 1
Query:  850 IDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGR-LNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHFKKEF 1536
            +  GS+GSVYK V   S    A+K L   +    EI    KEI+I+    D P +V++   + K+  L+I MEY   GS+   +R   + L E EI     + L+ + YLH    IHRDIK  N+LL+ E + KL DF ++  L    +K        + +GT  WMAPE+I    YDC ADIWS G T +EM  GKPPY E+     IF I  +    +  P  +  EF
Sbjct:   48 LGEGSYGSVYKAVHKESSSIVAIK-LVPVESDLHEI---IKEISIMQQC-DSPYVVRYYGSYFKQYDLWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANILLNTEGYAKLADFGVAGQLTDTMAK------RNTVIGTPFWMAPEVIEEIGYDCVADIWSLGITALEMAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEF 266          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k22 (mitogen-activated protein kinase kinase kinase 22 [Source:ZFIN;Acc:ZDB-GENE-070928-11])

HSP 1 Score: 160.614 bits (405), Expect = 7.177e-42
Identity = 89/227 (39.21%), Postives = 134/227 (59.03%), Query Frame = 1
Query:  829 NVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRF---CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTA-KSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFE 1491
            N  +  L+ RG+FG VY C  +++ +E A K++ F   C  +  E++    EI +L +L  H RIV++    +   +  L I +E++PGGS+   ++++G L EK   R +++IL+ + YLH   I+HRDIKG N+L D   +VKL DF  SK +        ++GT  KS  GT  WM+PE+ING+ Y   ADIWS   TV+EM T KPP++E    A IF+I  +
Sbjct:  359 NWRQGKLLGRGAFGVVYLCYDVDTGRELAAKQVPFDPECQETSKEVNALECEIQLLKNL-HHERIVQYYGCLRDPVQKKLSIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVHYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTIC----MSGTGIKSVTGTPYWMSPEVINGEGYGRKADIWSVACTVVEMLTQKPPWAEYEAMAAIFKIATQ 580          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 158.688 bits (400), Expect = 3.206e-41
Identity = 90/233 (38.63%), Postives = 134/233 (57.51%), Query Frame = 1
Query:  847 LIDRGSFGSVYKCVQLNSRKEFALKELRF---CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKIL--IHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHF 1524
            L+ +G+FG VY C  +++ +E A K++ F      +  E+     EI +L +L  H RIV++    +   E  L I MEY+PGGS+   ++++G L E    + +++ILE + YLH   I+HRDIKG N+L D   +VKL DF  SK L  I  +S G      +S  GT  WM+PE+I+G+ Y   AD+WS G TV+EM T KPP++E    A IF+I  +     ++P H 
Sbjct:  361 LLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKNL-HHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTG-----VRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIATQ-PTNPQLPSHI 586          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 158.688 bits (400), Expect = 3.864e-41
Identity = 90/233 (38.63%), Postives = 134/233 (57.51%), Query Frame = 1
Query:  847 LIDRGSFGSVYKCVQLNSRKEFALKELRF---CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKIL--IHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHF 1524
            L+ +G+FG VY C  +++ +E A K++ F      +  E+     EI +L +L  H RIV++    +   E  L I MEY+PGGS+   ++++G L E    + +++ILE + YLH   I+HRDIKG N+L D   +VKL DF  SK L  I  +S G      +S  GT  WM+PE+I+G+ Y   AD+WS G TV+EM T KPP++E    A IF+I  +     ++P H 
Sbjct:  367 LLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKNL-HHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTG-----VRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIATQ-PTNPQLPSHI 592          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 157.918 bits (398), Expect = 6.007e-41
Identity = 90/233 (38.63%), Postives = 134/233 (57.51%), Query Frame = 1
Query:  847 LIDRGSFGSVYKCVQLNSRKEFALKELRF---CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKIL--IHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHF 1524
            L+ +G+FG VY C  +++ +E A K++ F      +  E+     EI +L +L  H RIV++    +   E  L I MEY+PGGS+   ++++G L E    + +++ILE + YLH   I+HRDIKG N+L D   +VKL DF  SK L  I  +S G      +S  GT  WM+PE+I+G+ Y   AD+WS G TV+EM T KPP++E    A IF+I  +     ++P H 
Sbjct:  349 LLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKNL-HHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTG-----VRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIATQ-PTNPQLPSHI 574          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 157.532 bits (397), Expect = 7.806e-41
Identity = 88/221 (39.82%), Postives = 131/221 (59.28%), Query Frame = 1
Query:  847 LIDRGSFGSVYKCVQLNSRKEFALKELRF---CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTA-KSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFE 1491
            L+ +G+FG V+ C   ++ +E A+K+++F      +  E+     EI +L +L  H RIV++    +   E  L I MEY+PGGS+   ++S+G L E    + +++ILE + YLH   I+HRDIKG N+L D   +VKL DF  S+ L        L+GT  KS  GT  WM+PE+I+G+ Y   ADIWS G TV+EM T +PP++E    A IF+I  +
Sbjct:  367 LLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVSALECEIQLLKNLF-HERIVQYYGCLRDTHEKTLSIFMEYMPGGSIKDQLKSYGALTENVTRKYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTIC----LSGTGIKSVTGTPYWMSPEVISGEGYGRKADIWSIGCTVVEMLTQRPPWAEFEAMAAIFKIATQ 582          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 168.318 bits (425), Expect = 2.520e-44
Identity = 95/262 (36.26%), Postives = 146/262 (55.73%), Query Frame = 1
Query:  727 IQLFNNETQLELCENSENLCMEKRIFYNIFPDFE-NVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRF---CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKF--AKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTA-KSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFE 1491
            +Q   N  +L   ++   L +++R   +  P    N  +  L+ +G+FG VY C  +++ +E A K+++F      +  E+     EI +L +L  H RIV++        E  L I MEY+PGGS+   ++++G L E    R +++ILE + YLH   I+HRDIKG N+L D   +VKL DF  SK L        ++GT  +S  GT  WM+PE+I+G+ Y   AD+WS G TV+EM T KPP++E    A IF+I  +
Sbjct:  329 VQYMENRGRLRNADSENTLTVQERNISSKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEIQLLKNL-HHDRIVQYYGSLRDKGEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC----MSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ 585          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 167.548 bits (423), Expect = 3.701e-44
Identity = 95/262 (36.26%), Postives = 146/262 (55.73%), Query Frame = 1
Query:  727 IQLFNNETQLELCENSENLCMEKRIFYNIFPDFE-NVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRF---CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKF--AKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTA-KSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFE 1491
            +Q   N  +L   ++   L +++R   +  P    N  +  L+ +G+FG VY C  +++ +E A K+++F      +  E+     EI +L +L  H RIV++        E  L I MEY+PGGS+   ++++G L E    R +++ILE + YLH   I+HRDIKG N+L D   +VKL DF  SK L        ++GT  +S  GT  WM+PE+I+G+ Y   AD+WS G TV+EM T KPP++E    A IF+I  +
Sbjct:  311 VQYMENRGRLRNADSENTLTVQERNISSKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEIQLLKNL-HHDRIVQYYGSLRDKGEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC----MSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ 567          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:100493570])

HSP 1 Score: 161.77 bits (408), Expect = 3.825e-42
Identity = 93/231 (40.26%), Postives = 138/231 (59.74%), Query Frame = 1
Query:  847 LIDRGSFGSVYKCVQLNSRKEFALKELRFCDRSF---SEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTA-KSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKH 1521
            L+ +G+FG VY C   ++ +E A+K+++F   S     E++    EI +L +L  H RIV++    + ++E  L I MEY+PGGS+   ++++G L E    + +++ILE + YLH   I+HRDIKG N+L D   +VKL DF  SK L        L+GT  KS  GT  WM+PE+I+G+ Y   ADIWS G TV+EM T KPP++E    A IF+I  +     ++P H
Sbjct:  372 LLGQGAFGRVYLCYDADTGRELAVKQVQFDPDSLETSKEVNALECEIQLLKNLL-HERIVQYYGCLRDSQEKTLSIFMEYMPGGSIKDQLKAYGALTEFVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRLQTIC----LSGTGMKSVTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIATQ-PTNPQLPAH 596          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:100493570])

HSP 1 Score: 161.384 bits (407), Expect = 4.939e-42
Identity = 93/231 (40.26%), Postives = 138/231 (59.74%), Query Frame = 1
Query:  847 LIDRGSFGSVYKCVQLNSRKEFALKELRFCDRSF---SEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTA-KSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKH 1521
            L+ +G+FG VY C   ++ +E A+K+++F   S     E++    EI +L +L  H RIV++    + ++E  L I MEY+PGGS+   ++++G L E    + +++ILE + YLH   I+HRDIKG N+L D   +VKL DF  SK L        L+GT  KS  GT  WM+PE+I+G+ Y   ADIWS G TV+EM T KPP++E    A IF+I  +     ++P H
Sbjct:  344 LLGQGAFGRVYLCYDADTGRELAVKQVQFDPDSLETSKEVNALECEIQLLKNL-LHERIVQYYGCLRDSQEKTLSIFMEYMPGGSIKDQLKAYGALTEFVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRLQTIC----LSGTGMKSVTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIATQ-PTNPQLPAH 568          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: dennd1a (DENN domain containing 1A [Source:Xenbase;Acc:XB-GENE-5729862])

HSP 1 Score: 155.606 bits (392), Expect = 5.769e-40
Identity = 89/228 (39.04%), Postives = 131/228 (57.46%), Query Frame = 1
Query:  826 ENVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRF---CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTA-KSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFE 1491
            EN     L+ RG+FG VY C  ++  +E A+K++ F      +  E++    EI +L  L  H RIV++    +   E  L I +EY+PGGS+   ++++G L E    R +++IL+ + YLH   I+HRDIKG N+L D   +VKL DF  SK +        ++GT  KS  GT  WM+PE+I+G+ Y   AD+WS   TV+EM T KPP+SE    A IF+I  +
Sbjct:  352 ENWRLGKLLGRGAFGEVYLCYDVDKGRELAVKQVPFDPDSQETSKEVNALECEIQLL-KLHRHERIVQYYGCLRDPTERKLSIFVEYMPGGSIKDQLKAYGALTENVTRRYTRQILQGVSYLHGNMIVHRDIKGANILRDSAGNVKLGDFGASKRIQTIC----MSGTGIKSVTGTPYWMSPEVISGEGYGRKADVWSVACTVVEMLTEKPPWSEYEAMAAIFKIATQ 574          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:MGI Symbol;Acc:MGI:1346874])

HSP 1 Score: 162.925 bits (411), Expect = 1.094e-42
Identity = 109/357 (30.53%), Postives = 174/357 (48.74%), Query Frame = 1
Query:  475 RYLCFTHNESYVDTTRTFSDCNLNDGDLILMENLLETKHEHFCEITLESINHNYESISLFVTRQETIDYIKLKLSKEINIPVKNIQLFNNETQLELCENSENLCMEKRIFYNIFPDFE-NVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRF---CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTA-KSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHF 1524
            RY    H++ Y D  RTF     + G+L  +              +  S++ N E++ + V                        Q  +   +L   ++   L +++R      P    N  +  L+ +G+FG VY C  +++ +E A K+++F      +  E+     EI +L +L  H RIV++    +   E  L I MEY+PGGS+   ++++G L E    + +++ILE + YLH   I+HRDIKG N+L D   +VKL DF  SK L        ++GT  +S  GT  WM+PE+I+G+ Y   AD+WS G TV+EM T KPP++E    A IF+I  +     ++P H 
Sbjct:  278 RYHVSVHHKDYNDGRRTFPRIRRHQGNLFTLVP------------SSRSLSTNGENMGVAV------------------------QYLDPRGRLRSADSENALTVQERNVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNL-QHERIVQYYGCLRDRAEKILTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC----MSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ-PTNPQLPSHI 592          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:MGI Symbol;Acc:MGI:1346873])

HSP 1 Score: 160.999 bits (406), Expect = 6.413e-42
Identity = 89/221 (40.27%), Postives = 133/221 (60.18%), Query Frame = 1
Query:  847 LIDRGSFGSVYKCVQLNSRKEFALKELRFCDRS---FSEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTA-KSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFE 1491
            L+ +G+FG VY C  +++ +E A+K+++F   S     E++    EI +L +L  H RIV++    +  +E  L I MEY+PGGS+   ++++G L E    + +++ILE + YLH   I+HRDIKG N+L D   ++KL DF  SK L        L+GT  KS  GT  WM+PE+I+G+ Y   ADIWS   TV+EM T KPP++E    A IF+I  +
Sbjct:  361 LLGQGAFGRVYLCYDVDTGRELAVKQVQFNPESPETSKEVNALECEIQLLKNLL-HERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNIKLGDFGASKRLQTIC----LSGTGMKSVTGTPYWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQ 576          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Stk4 (serine/threonine kinase 4 [Source:MGI Symbol;Acc:MGI:1929004])

HSP 1 Score: 154.066 bits (388), Expect = 3.041e-40
Identity = 96/259 (37.07%), Postives = 141/259 (54.44%), Query Frame = 1
Query:  850 IDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGR-LNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHFKKEFQXXXXXXXXXXXXXXXXXXXXXEHPFLKC 1623
            +  GS+GSVYK +   + +  A+K++       S++    KEI+I+    D P +VK+   + K   L+I+MEY   GS+   IR   + L E EI    Q  L+ ++YLH++  IHRDIK  N+LL+ E H KL DF ++  L    +K +      + +GT  WMAPE+I    Y+C ADIWS G T IEM  GKPPY+++     IF I       +  P+ +   F  F+  CL  S  +R +A  LL+HPF+K 
Sbjct:   36 LGEGSYGSVYKAIHKETGQIVAIKQVPVE----SDLQEIIKEISIMQQC-DSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRN------TVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDNFMDFVKQCLVKSPEQRATATQLLQHPFVKS 283          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Stk3 (serine/threonine kinase 3 [Source:MGI Symbol;Acc:MGI:1928487])

HSP 1 Score: 152.525 bits (384), Expect = 1.190e-39
Identity = 95/258 (36.82%), Postives = 142/258 (55.04%), Query Frame = 1
Query:  850 IDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGR-LNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHFKKEFQXXXXXXXXXXXXXXXXXXXXXEHPFLK 1620
            +  GS+GSV+K +   S +  A+K++       S++    KEI+I+    D P +VK+   + K   L+I+MEY   GS+   IR   + L E EI    +  L+ ++YLH++  IHRDIK  N+LL+ E H KL DF ++  L    +K +      + +GT  WMAPE+I    Y+C ADIWS G T IEM  GKPPY+++     IF I       +  P+ +  +F  F+  CL  S  +R +A  LL+HPF+K
Sbjct:   31 LGEGSYGSVFKAIHKESGQVVAIKQVPVE----SDLQEIIKEISIMQQC-DSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRN------TVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKSPEQRATATQLLQHPFIK 277          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Stk3 (serine/threonine kinase 3 [Source:MGI Symbol;Acc:MGI:1928487])

HSP 1 Score: 152.14 bits (383), Expect = 1.747e-39
Identity = 95/258 (36.82%), Postives = 142/258 (55.04%), Query Frame = 1
Query:  850 IDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGR-LNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHFKKEFQXXXXXXXXXXXXXXXXXXXXXEHPFLK 1620
            +  GS+GSV+K +   S +  A+K++       S++    KEI+I+    D P +VK+   + K   L+I+MEY   GS+   IR   + L E EI    +  L+ ++YLH++  IHRDIK  N+LL+ E H KL DF ++  L    +K +      + +GT  WMAPE+I    Y+C ADIWS G T IEM  GKPPY+++     IF I       +  P+ +  +F  F+  CL  S  +R +A  LL+HPF+K
Sbjct:   33 LGEGSYGSVFKAIHKESGQVVAIKQVPVE----SDLQEIIKEISIMQQC-DSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRN------TVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKSPEQRATATQLLQHPFIK 279          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99759|M3K3_HUMAN (Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP3K3 PE=1 SV=2)

HSP 1 Score: 165.622 bits (418), Expect = 9.085e-43
Identity = 110/357 (30.81%), Postives = 174/357 (48.74%), Query Frame = 1
Query:  475 RYLCFTHNESYVDTTRTFSDCNLNDGDLILMENLLETKHEHFCEITLESINHNYESISLFVTRQETIDYIKLKLSKEINIPVKNIQLFNNETQLELCENSENLCMEKRIFYNIFPDFE-NVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRF---CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTA-KSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHF 1524
            RY    H++ Y D  RTF     + G+L  +              +  S++ N E++ L V                        Q  +   +L   ++   L +++R      P    N  +  L+ +G+FG VY C  +++ +E A K+++F      +  E+     EI +L +L  H RIV++    +   E  L I MEY+PGGS+   ++++G L E    + +++ILE + YLH   I+HRDIKG N+L D   +VKL DF  SK L        ++GT  +S  GT  WM+PE+I+G+ Y   AD+WS G TV+EM T KPP++E    A IF+I  +     ++P H 
Sbjct:  278 RYHVSVHHKDYSDGRRTFPRIRRHQGNLFTLV------------PSSRSLSTNGENMGLAV------------------------QYLDPRGRLRSADSENALSVQERNVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNL-QHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC----MSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ-PTNPQLPSHI 592          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q61084|M3K3_MOUSE (Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus OX=10090 GN=Map3k3 PE=1 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 7.652e-42
Identity = 109/357 (30.53%), Postives = 174/357 (48.74%), Query Frame = 1
Query:  475 RYLCFTHNESYVDTTRTFSDCNLNDGDLILMENLLETKHEHFCEITLESINHNYESISLFVTRQETIDYIKLKLSKEINIPVKNIQLFNNETQLELCENSENLCMEKRIFYNIFPDFE-NVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRF---CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTA-KSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHF 1524
            RY    H++ Y D  RTF     + G+L  +              +  S++ N E++ + V                        Q  +   +L   ++   L +++R      P    N  +  L+ +G+FG VY C  +++ +E A K+++F      +  E+     EI +L +L  H RIV++    +   E  L I MEY+PGGS+   ++++G L E    + +++ILE + YLH   I+HRDIKG N+L D   +VKL DF  SK L        ++GT  +S  GT  WM+PE+I+G+ Y   AD+WS G TV+EM T KPP++E    A IF+I  +     ++P H 
Sbjct:  278 RYHVSVHHKDYNDGRRTFPRIRRHQGNLFTLVP------------SSRSLSTNGENMGVAV------------------------QYLDPRGRLRSADSENALTVQERNVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNL-QHERIVQYYGCLRDRAEKILTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC----MSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ-PTNPQLPSHI 592          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y2U5|M3K2_HUMAN (Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2)

HSP 1 Score: 160.999 bits (406), Expect = 4.486e-41
Identity = 89/221 (40.27%), Postives = 133/221 (60.18%), Query Frame = 1
Query:  847 LIDRGSFGSVYKCVQLNSRKEFALKELRF---CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTA-KSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFE 1491
            L+ +G+FG VY C  +++ +E A+K+++F      +  E++    EI +L +L  H RIV++    +  +E  L I MEY+PGGS+   ++++G L E    + +++ILE + YLH   I+HRDIKG N+L D   +VKL DF  SK L        L+GT  KS  GT  WM+PE+I+G+ Y   ADIWS   TV+EM T KPP++E    A IF+I  +
Sbjct:  361 LLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLL-HERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTIC----LSGTGMKSVTGTPYWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQ 576          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q61083|M3K2_MOUSE (Mitogen-activated protein kinase kinase kinase 2 OS=Mus musculus OX=10090 GN=Map3k2 PE=1 SV=2)

HSP 1 Score: 156.762 bits (395), Expect = 1.133e-39
Identity = 88/221 (39.82%), Postives = 131/221 (59.28%), Query Frame = 1
Query:  847 LIDRGSFGSVYKCVQLNSRKEFALKELRFCDRS---FSEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTA-KSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFE 1491
            L+ +G+FG VY C  +++ +E A+K+++F   S     E++    EI +L +L  H RIV++    +  +E  L I ME  PGGS+   ++++G L E    + +++ILE + YLH   I+HRDIKG N+L D   ++KL DF  SK L        L+GT  KS  GT  WM+PE+I+G+ Y   ADIWS   TV+EM T KPP++E    A IF+I  +
Sbjct:  361 LLGQGAFGRVYLCYDVDTGRELAVKQVQFNPESPETSKEVNALECEIQLLKNLL-HERIVQYYGCLRDPQEKTLSIFMELSPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNIKLGDFGASKRLQTIC----LSGTGMKSVTGTPYWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQ 576          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7ZUQ3|STK3_DANRE (Serine/threonine-protein kinase 3 OS=Danio rerio OX=7955 GN=stk3 PE=2 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 1.448e-39
Identity = 94/257 (36.58%), Postives = 142/257 (55.25%), Query Frame = 1
Query:  850 IDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGR-LNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHFKKEFQXXXXXXXXXXXXXXXXXXXXXEHPFL 1617
            +  GS+GSV+K +   S +  A+K++       S++    KEI+I+    D P +VK+   + K   L+I+MEY   GS+   IR   + L E EI    +  L+ ++YLH++  IHRDIK  N+LL+ E H KL DF ++  L    +K +      + +GT  WMAPE+I    Y+C ADIWS G T IEM  GKPPY+++     IF I       +  P+H+  +F  F+  CL  +  +R +A  LL+HPF+
Sbjct:   32 LGEGSYGSVFKAIHKESGQVVAIKQVPVE----SDLQEIIKEISIMQQC-DSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATVLKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRN------TVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEHWSDDFTDFVKKCLVKNPEQRATATQLLQHPFI 277          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: T1G1N2 (Protein kinase domain-containing protein OS=Helobdella robusta OX=6412 GN=20214980 PE=4 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 4.348e-43
Identity = 92/237 (38.82%), Postives = 137/237 (57.81%), Query Frame = 1
Query:  829 NVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELR-FCDRS--FSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGS-----LNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVP 1515
            N  K  ++  G FG VY C  +++  E A+K++  +C       E+     EI +L  L + PRIV++     + + L I ME+VPGGS+   I+ +G L E    R ++++LE +++LH L I+HRDIKG N+L D+E ++KL DF  +K L    +K +     L G AK+  GT  +M+PEII GK+Y    DIWS G TV+EM TG PP+ E    A IF+I  +    Y++P
Sbjct:    4 NWKKGKILGAGGFGQVYLCYDVDTGVELAVKQVNVYCQSEDISKEVRALQSEIKLLQDLSN-PRIVQYYGSQKEPHMLSIFMEFVPGGSVKDQIQDYGPLTESVTKRYTKQVLEGLEFLHSLMIVHRDIKGANILRDHEGNIKLTDFGAAKRLSSIVNKTADVSKNLTG-AKTMTGTPYYMSPEIIEGKRYGRKVDIWSLGCTVVEMLTGHPPWHEYEGVAAIFKIATQPHPSYKLP 238          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A0C3BRW7 (Protein kinase domain-containing protein (Fragment) OS=Serendipita vermifera MAFF 305830 OX=933852 GN=M408DRAFT_59422 PE=3 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 7.053e-43
Identity = 90/212 (42.45%), Postives = 124/212 (58.49%), Query Frame = 1
Query:  850 IDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSEL-GYYAVIFRI 1482
            I RG FG+VY+ + LN+ +  A+K +   D S  EI    KE+ +L  L  HP IVK+E      + L I++EYV  GSLG  IR+ G+LNE+ +     +ILE + YLH  H++H D+K  N+L     +VKL DF +S + +HA    +L        GT NWMAPE+I  K    A+DIWS G T IE+ TG PPY E+    +V+FRI
Sbjct:    4 IGRGQFGAVYRALNLNTGQMVAVKRIGLQDLSEDEISNLMKEVDVLKRL-SHPSIVKYEGMVRSTDTLSIVLEYVENGSLGQTIRAFGKLNERLVASYITKILEGLHYLHTSHVVHCDLKAANILTTKNGNVKLSDFGVS-LNLHAK---ALEEIKNDVAGTPNWMAPEVIELKGASTASDIWSLGCTAIELLTGHPPYHEIHNGLSVMFRI 210          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A7S4G7 (Predicted protein (Fragment) OS=Nematostella vectensis OX=45351 GN=v1g104385 PE=4 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 1.334e-42
Identity = 90/224 (40.18%), Postives = 130/224 (58.04%), Query Frame = 1
Query:  829 NVIKQDLIDRGSFGSVYKCVQLNSRKEFALKEL---RFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFE 1491
            N  K  L+  G+FG VY C  L++ +E A+K++   +    + +E+     EI  + +  +  RIV++      +  +YI MEY+PGGS+  +I+ HG LNE    + S++ILE I YLH   I+HRDIKG N+L D   +VKL DF  SK L    SK       +S  GT  WMAPE+ING+ Y   AD+WS G TV+EM T KPP+++    A +F+I  +
Sbjct:    3 NWRKGKLLGAGAFGQVYMCHDLDTGRELAVKQIETGQLNSSTKNEVKALEGEIEFMKAFRNE-RIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRLQTIRSKTGF----RSVHGTPYWMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPPWADFEPMAALFKIATQ 221          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: K1PKP1 (Mitogen-activated protein kinase kinase kinase 2 OS=Crassostrea gigas OX=29159 GN=CGI_10008499 PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.565e-41
Identity = 89/229 (38.86%), Postives = 130/229 (56.77%), Query Frame = 1
Query:  847 LIDRGSFGSVYKCVQLNSRKEFALKELRFCD---RSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHF 1524
            L+  G+FG VY C   ++ ++ A+K +R       +  E+     EI +L +  +H RIV +      +  LYI MEY+PGGS+   I  +G L E    + ++++LE + YLH   I+HRDIKG N+L D   ++KL DF  SK L    S   L+    S VGT  WMAPE+ING+ Y   ADIWS G T++EM T KPP++E    A +++I  EK+  + +P H 
Sbjct:   69 LLGSGAFGEVYVCHDKDTGRDLAMKVVRLEQMNAETSKEVRALENEIHLLRNF-EHERIVSYFGCAQDKQSLYIFMEYLPGGSVKDEITKYGSLTENVSRKYTKQMLEGLAYLHKNVIVHRDIKGANILRDGNGNIKLGDFGASKRLQTIVSATGLH----SVVGTPYWMAPEVINGEGYGRKADIWSVGCTIVEMLTTKPPWAEFESMAALYKIAMEKRPHFTLPNHI 292          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A212D6K2 (Protein kinase domain-containing protein (Fragment) OS=Cervus elaphus hippelaphus OX=46360 GN=Celaphus_00001436 PE=4 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 3.176e-41
Identity = 110/357 (30.81%), Postives = 174/357 (48.74%), Query Frame = 1
Query:  475 RYLCFTHNESYVDTTRTFSDCNLNDGDLILMENLLETKHEHFCEITLESINHNYESISLFVTRQETIDYIKLKLSKEINIPVKNIQLFNNETQLELCENSENLCMEKRIFYNIFPDFE-NVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRF---CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTA-KSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHF 1524
            RY    H++ Y D  RTF     + G+L  +              +  S++ N E++ L V                        Q  +   +L   ++   L +++R      P    N  +  L+ +G+FG VY C  +++ +E A K+++F      +  E+     EI +L +L  H RIV++    +   E  L I MEY+PGGS+   ++++G L E    + +++ILE + YLH   I+HRDIKG N+L D   +VKL DF  SK L        ++GT  +S  GT  WM+PE+I+G+ Y   AD+WS G TV+EM T KPP++E    A IF+I  +     ++P H 
Sbjct:  151 RYHVSVHHKDYSDGRRTFPRIRRHQGNLFTLVP------------SSRSLSTNGENMGLAV------------------------QYLDPRGRLRSADSENALSVQERSVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNL-QHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC----MSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ-PTNPQLPSHI 465          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 157.147 bits (396), Expect = 1.637e-43
Identity = 89/237 (37.55%), Postives = 133/237 (56.12%), Query Frame = 1
Query:  838 KQDLIDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEI-----DLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHFKKE 1533
            K +++ RG++G+VY C   +  +  A+K++   D S SE          +E+ +L +L +HP IV F      +N + I MEYVPGGS+ S +   G L EK     ++++LE + YLH   +IHRD+KG+N++L     VKL DF  ++ L      G  +   KS  GT  WMAPE+IN   +   +D+WS G TV EM TGKPP + +G  A +F IG  K ++  +P  F +E
Sbjct:   18 KGEVLGRGAYGTVY-CGLTSQGQLIAVKQV-LLDVSTSETAEKEYSRLEREVDLLKNL-EHPNIVGFLGTALTDNVISIFMEYVPGGSISSVLNRFGPLPEKVFALYTRQVLEGVAYLHENRVIHRDLKGNNLMLMPTGVVKLIDFGCARRLNRLTHSGGNSDLLKSVHGTPYWMAPEVINETGHGKKSDVWSIGCTVFEMATGKPPLAHMGKMAALFYIGARKGLMPPLPDDFSEE 251          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3-like [Source:NCBI gene;Acc:103044968])

HSP 1 Score: 158.688 bits (400), Expect = 2.847e-41
Identity = 87/227 (38.33%), Postives = 135/227 (59.47%), Query Frame = 1
Query:  829 NVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRF---CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTA-KSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFE 1491
            N  +  L+ RG+FG VY C   ++ +E A+K++ F   C  +  E++    EI +L +L  H RIV++    +  ++  L I +E++PGGS+   ++++G L EK   R +++IL+ + YLH   I+HRDIKG N+L D   +VKL DF  SK +        ++GT  K+  GT  WM+PE+ING+ Y   AD+WS   TV+EM T KPP++E    A IF+I  +
Sbjct:  353 NWRQGKLLGRGAFGEVYLCYDADTGRELAVKQVPFDPECHETSKEVNALECEIQLLKNL-RHERIVQYYGCLRDPEQRKLSIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVFYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTIC----MSGTGIKTVTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIATQ 574          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3-like [Source:NCBI gene;Acc:103044968])

HSP 1 Score: 158.303 bits (399), Expect = 3.363e-41
Identity = 87/227 (38.33%), Postives = 135/227 (59.47%), Query Frame = 1
Query:  829 NVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRF---CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTA-KSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFE 1491
            N  +  L+ RG+FG VY C   ++ +E A+K++ F   C  +  E++    EI +L +L  H RIV++    +  ++  L I +E++PGGS+   ++++G L EK   R +++IL+ + YLH   I+HRDIKG N+L D   +VKL DF  SK +        ++GT  K+  GT  WM+PE+ING+ Y   AD+WS   TV+EM T KPP++E    A IF+I  +
Sbjct:  356 NWRQGKLLGRGAFGEVYLCYDADTGRELAVKQVPFDPECHETSKEVNALECEIQLLKNL-RHERIVQYYGCLRDPEQRKLSIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVFYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTIC----MSGTGIKTVTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIATQ 577          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 157.918 bits (398), Expect = 5.553e-41
Identity = 88/222 (39.64%), Postives = 130/222 (58.56%), Query Frame = 1
Query:  847 LIDRGSFGSVYKCVQLNSRKEFALKELRF---CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKIL--IHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFE 1491
            L+ +G+FG VY C  +++ +E A K+++F      +  E+     EI +L +L  H RIV++    +   E  L I MEY+PGGS+   ++++G L E    + +++ILE + YLH   I+HRDIKG N+L D   +VKL DF  SK L  I  +S G      +S  GT  WM+PE+I+G  Y   AD+WS G TV+EM T KPP++E    A IF+I  +
Sbjct:  361 LLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEIQLLKNL-HHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTG-----VRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ 576          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 157.918 bits (398), Expect = 5.553e-41
Identity = 88/222 (39.64%), Postives = 130/222 (58.56%), Query Frame = 1
Query:  847 LIDRGSFGSVYKCVQLNSRKEFALKELRF---CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKIL--IHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFE 1491
            L+ +G+FG VY C  +++ +E A K+++F      +  E+     EI +L +L  H RIV++    +   E  L I MEY+PGGS+   ++++G L E    + +++ILE + YLH   I+HRDIKG N+L D   +VKL DF  SK L  I  +S G      +S  GT  WM+PE+I+G  Y   AD+WS G TV+EM T KPP++E    A IF+I  +
Sbjct:  361 LLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEIQLLKNL-HHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTG-----VRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ 576          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 165.236 bits (417), Expect = 2.573e-44
Identity = 90/226 (39.82%), Postives = 135/226 (59.73%), Query Frame = 1
Query:  829 NVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRFCDRSF---SEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFE 1491
            N  +  L+ +G+FG VY C   ++ +E A+K+++F   S     E++    EI +L +L  H RIV++    +  ++  L I MEY+PGGS+   +R++G L E    + +++ILE + +LH   I+HRDIKG N+L D   +VKL DF  SK L    S+G+     +S  GT  WM+PE+ING+ Y   ADIWS G TV+EM T KPP++E    A IF+I  +
Sbjct:  358 NWQRGKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPGSVETSKEVNALECEIQLLKNL-QHERIVQYFGCLRDPQQKTLSIFMEYMPGGSIKDQLRAYGALTENVTRKYTRQILEGVSFLHGNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICSQGT---AMRSVTGTPYWMSPEVINGEGYGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIATQ 579          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 142.895 bits (359), Expect = 8.402e-39
Identity = 83/245 (33.88%), Postives = 127/245 (51.84%), Query Frame = 1
Query:  835 IKQDLIDRGSFGSVYKCVQLNSRKEFALKELRFCD----------RSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHFKKEFQ 1539
            IK + + +G+FG+V+  +  N  K  A+KEL   D          +  SE+     E+ +L +L  HP +V++     + N   I ME+VPGG++   +R  G L E        ++   + YLH   ++H D+KG N ++     VKL DF  ++ +  A S    NG   S  GTA WMAPE+ING  Y   AD+WS G T+ EM  G+PP++++   A +  IG    I+  +P+ F KE Q
Sbjct:   16 IKGNRLGKGAFGTVFLGLT-NQGKLIAVKELELRDAQSANGNQGGQKQSELQKLQDEVELLTTL-HHPNVVEYLGTEMEGNRFSIFMEFVPGGTVAETVRGFGPLGESVCRSYIAQMTRGLAYLHGHGVMHGDVKGSNAVITPAGVVKLIDFGCAQRVALALSC-HENGGLHSVHGTAYWMAPEVINGTGYARRADVWSLGCTLHEMAVGRPPFADMAPMAALLHIGIRNGIMPGLPQAFSKEAQ 257          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: stk25a (serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-GENE-041010-92])

HSP 1 Score: 133.265 bits (334), Expect = 3.918e-34
Identity = 90/236 (38.14%), Postives = 122/236 (51.69%), Query Frame = 1
Query:  784 CMEKRIFYNIFPDFENV-IKQDLIDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGD--NVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRI 1482
            C   R   N   D E +  KQ+ I +GSFG V+K +   +++  A+K +   +          +EI +L S  D P +  +   + K   L+I+MEY+ GGS    I+  G L E +I    +EIL+ + YLH    IHRDIKG   NVLL  +  VKL DF ++  L     K        +FVGT  WMAPE+I    YD  ADIWS G T IE+  G+PP SEL    V+F I
Sbjct:    9 CPHPRPPQNSCADPEELFTKQERIGKGSFGEVFKGIDNRTKEVVAIKIIDLEEAEDEIE-DIQQEITVL-SQCDSPYVTHYFGSYLKGTKLWIIMEYLGGGSALDLIKP-GPLEEHQIATILREILKGLDYLHSERKIHRDIKGPAANVLLSEQGDVKLADFGVAGQLTDTQIK------RNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSELHPMRVLFLI 235          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: slka (STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-050411-66])

HSP 1 Score: 132.88 bits (333), Expect = 1.125e-32
Identity = 87/232 (37.50%), Postives = 121/232 (52.16%), Query Frame = 1
Query:  859 GSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGR-LNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEII-----NGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHFKKEF 1536
            G+FG VYK     S    A K +    +S  E++ +  EI IL +L DHP IV     F  EN L+I +E+ PGG++ + +    R L E +I    +++LEA+ YLH   IIHRD+K  N+LL +E  VKL DF +S     A +  +L     SF+GT  WMAPE++         YD  ADIWS G T+IE+   +PP  EL    V+ +I          P  +  EF
Sbjct:   42 GAFGKVYKAQNKESGVLAAAKVIET--KSEEELEDYMVEIEIL-ALCDHPNIVGLLNAFYYENKLWIFIEFCPGGAVDAIMLELERGLAEPQIRVVCKQMLEALNYLHTHRIIHRDLKAGNILLTFEGDVKLADFGVS-----AKNTRTLQ-RRDSFIGTPYWMAPEVVMCETMKDAPYDYKADIWSLGITLIELAQMEPPNHELNPMRVMLKIAKNDPPSLSFPSKWSAEF 264          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 122.479 bits (306), Expect = 2.315e-30
Identity = 66/200 (33.00%), Postives = 109/200 (54.50%), Query Frame = 1
Query:  850 IDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCA-ADIWSFGATVIEMFTGKPPY 1446
            I +G+F  V       + +E A+K +     + S +   ++E+ I+  L +HP IVK  +    E  LY++MEY  GG +  Y+ +HGR+ EKE     ++I+ A+QY H  HI+HRD+K +N+LLD + ++K+ DF  S          +L     +F G+  + APE+  GK+YD    D+WS G  +  + +G  P+
Sbjct:   74 IGKGNFAKVKLAKHTLTGQEVAVKIIDKTQLNTSSLQKLFREVRIMKVL-NHPNIVKLFEVIEMEKTLYLVMEYSSGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAENLLLDADMNIKIADFGFSNEF-------TLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPF 265          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 154.451 bits (389), Expect = 5.538e-40
Identity = 85/227 (37.44%), Postives = 130/227 (57.27%), Query Frame = 1
Query:  835 IKQDLIDRGSFGSVYKCVQLNSRKEFALKELRFCDRS------FSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQ-YDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEK 1494
            +K ++I +GSFG+VY C+ + + +  A+K++     S       S ++    E++ L  L DH  IV++     K N   + +EYV GGS+GS IR +GR +E  I   + ++L+ + YLH   I+HRD+K DN+LLD +   K+ DF +S+      SK   + +  +  GT  WMAPE+++ KQ Y    DIWS G  V+EMF GK P+S L   A +F+IG  K
Sbjct: 1176 MKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-DHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISR-----KSKDIYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSK 1396          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 141.739 bits (356), Expect = 8.112e-36
Identity = 86/215 (40.00%), Postives = 120/215 (55.81%), Query Frame = 1
Query:  841 QDLIDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYI-RSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELG----YYAV 1470
            + +I RGS+G VYK +  ++ +  A+KE+ + +    E++    EI++L +L +H  IVK+     K   LYIL+EY   GSL   I RS   L+E E      + L  ++YLH   +IHRDIK  N+LL  +  VKL DF +S I+         N +A +  GT NWMAPEI+  +     +DIWS GATV+EM T  PPY  L     YYAV
Sbjct:   28 KQVIGRGSYGVVYKAINKHTDQVVAIKEVVYENDE--ELNDIMAEISLLKNL-NHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIV---------NSSALTLAGTLNWMAPEILGNRGASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAV 230          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 138.272 bits (347), Expect = 1.002e-34
Identity = 77/204 (37.75%), Postives = 117/204 (57.35%), Query Frame = 1
Query:  838 KQDLIDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEII-NGKQYDCAADIWSFGATVIEMFTGKPPY 1446
            + ++I RG FG VYK   + + + +A+K L   D    E++   +EI  L SL     I ++   + K+  L+I+ME+  GGSL S +R  G+++EK I    +E+L A++ +H  ++IHRDIK  NVL+  E +VKLCDF ++  +   + +       ++  GT  WMAPE+I  G  YD   DIWS G T  E+ TG PPY
Sbjct:   25 RTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNL-DSDSDEVEDVQREIQFLASLKQISNITRYYGSYLKDTSLWIIMEHCAGGSLRSLLRP-GKIDEKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLR------RQTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPY 220          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 132.109 bits (331), Expect = 8.496e-33
Identity = 73/208 (35.10%), Postives = 111/208 (53.37%), Query Frame = 1
Query:  823 FENVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPY 1446
            + N++K   I +G+ G VY   ++ +    A+K++    +   E  L   EI ++     HP IV F   +  +  L+++MEY+ GGSL   + +H  L E +I    +E L  +++LH   ++HRDIK DN+LL  E  +KL DF         A    LN    + VGT  WMAPE+++ K+Y    DIWS G  +IEM  G+PPY
Sbjct:  620 YANLVK---IGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKE--LIINEILVMKG-SKHPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVV-THCILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGF------CAQINELNLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPY 814          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: PKH2 (Serine/threonine protein kinase; involved in sphingolipid-mediated signaling pathway that controls endocytosis; activates Ypk1p and Ykr2p, components of signaling cascade required for maintenance of cell wall integrity; contains a PH-like domain; redundant with Pkh1p; PKH2 has a paralog, PKH1, that arose from the whole genome duplication [Source:SGD;Acc:S000005460])

HSP 1 Score: 131.724 bits (330), Expect = 1.397e-32
Identity = 75/219 (34.25%), Postives = 120/219 (54.79%), Query Frame = 1
Query:  847 LIDRGSFGSVYKCVQLNSRKEFALKEL--RFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKIL---IHAASKG--SLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRI 1482
            +I  G++ +V     ++++K +A K L   +  R   ++     E   L  L + P +V+    F  E+ LY L+EY P G   S ++ +G L+E      + +I++AI YLH   IIHRDIK +N+LLD E  +KL DF  +K+L    ++ SK    L+  +KSFVGTA +++PE++N    D   DIW+FG  + +M  GKPP+     Y    ++
Sbjct:  184 VIGDGAYSTVMLATSIDTKKRYAAKVLNKEYLIRQ-KKVKYVSIEKTALQKLNNSPSVVRLFSTFQDESSLYFLLEYAPNGDFLSLMKKYGSLDETCARYYAAQIIDAIDYLHSNGIIHRDIKPENILLDGEMKIKLTDFGTAKLLNPTNNSVSKPEYDLSTRSKSFVGTAEYVSPELLNDSFTDYRCDIWAFGCILFQMIAGKPPFKATNEYLTFQKV 401          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 164.081 bits (414), Expect = 1.682e-46
Identity = 90/224 (40.18%), Postives = 130/224 (58.04%), Query Frame = 1
Query:  829 NVIKQDLIDRGSFGSVYKCVQLNSRKEFALKEL---RFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFE 1491
            N  K  L+  G+FG VY C  L++ +E A+K++   +    + +E+     EI  + +  +  RIV++      +  +YI MEY+PGGS+  +I+ HG LNE    + S++ILE I YLH   I+HRDIKG N+L D   +VKL DF  SK L    SK       +S  GT  WMAPE+ING+ Y   AD+WS G TV+EM T KPP+++    A +F+I  +
Sbjct:    3 NWRKGKLLGAGAFGQVYMCHDLDTGRELAVKQIETGQLNSSTKNEVKALEGEIEFMKAFRNE-RIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRLQTIRSKTGF----RSVHGTPYWMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPPWADFEPMAALFKIATQ 221          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO42845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A9])

HSP 1 Score: 142.895 bits (359), Expect = 3.212e-38
Identity = 81/231 (35.06%), Postives = 126/231 (54.55%), Query Frame = 1
Query:  850 IDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCS-QEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHFKKEFQ 1539
            +  GS+GSV+K +   S +  A+K++   D    EI    KEI+++    D P +VK+   + K   L+I+MEY   GS+   ++   +   +E I+C  +  L+ ++YLH    IHRDIK  N+LL+ E H KL DF ++  L    +K +      + +GT  WMAPE+I    YDC ADIWS G T +EM  GKPPY+++     IF I  +    +  P  + ++F+
Sbjct:   30 LGEGSYGSVFKAMHKESGQVVAIKQVP-VDTDLQEI---IKEISMMQQC-DSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDLMKIRNKTLTEEEIKCVLKYTLKGLEYLHLRRKIHRDIKAGNILLNSEGHAKLADFGVAGQLTDTMAKRN------TVIGTPFWMAPEVIQEVGYDCLADIWSLGITAMEMAEGKPPYADIHPMRAIFMIPTKPPPTFRDPGQWSEDFK 249          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO47821 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL88])

HSP 1 Score: 130.954 bits (328), Expect = 2.384e-34
Identity = 74/222 (33.33%), Postives = 125/222 (56.31%), Query Frame = 1
Query:  838 KQDLIDRGSFGSVYKCVQLNSRKEFALKELRF----CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKEN--CLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIG 1485
            K +++ +G+FG+V+  + +N+ +  A+K++       D +  + +   +E+ +L SL  H  IV++      ++   + I ME+VPGGS+   ++  G   E    R +++IL+ + YLH  ++IHRDIKG N++L     +KL DF  +K +    +  S +   +S  GT  WMAPE+I    +   +DIWS G TV EM TG+PP+S +   + IF IG
Sbjct:    7 KGNVLGKGAFGTVFLGL-VNTGELIAVKQVELHPNNVDAAERQYEKLQEEVGLLKSL-KHKNIVQYIGTCMDDSQCTINIFMEFVPGGSIAQALKRFGAFVEPVFRRYTRQILDGVSYLHNNNVIHRDIKGGNIMLMPNGVIKLIDFGCAKKICMVGAHVSKSNILRSMRGTPYWMAPEVIRETGHGRKSDIWSIGCTVFEMATGQPPWSNVPPLSAIFAIG 226          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO33667 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRJ0])

HSP 1 Score: 132.109 bits (331), Expect = 3.864e-33
Identity = 87/257 (33.85%), Postives = 131/257 (50.97%), Query Frame = 1
Query:  850 IDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHFKKEFQXXXXXXXXXXXXXXXXXXXXXEHPFLK 1620
            I +G+ G+VY  +++ +  E A+K++    +   E  L   EI ++     HP IV +   +     L+++MEY+ GGSL   + +   ++E +I    +E L+A+++LH   +IHRDIK DN+LL  +  VKL DF     +    +K S      + VGT  WMAPE++  KQY    D+WS G   IEM  G+PPY        ++ I          P+     F+ FL   L     KR SA  LL+HPFLK
Sbjct:  232 IGQGASGTVYTAIEVATGHEVAIKQMNLSQQPKKE--LIINEILVMRE-NKHPNIVNYVDSYLVGEELWVVMEYLAGGSLTDVV-TETCMDEGQIAAVCRECLQALEFLHSNGVIHRDIKSDNILLGMDGQVKLTDFGFCATITPEQNKRS------TMVGTPYWMAPEVVTRKQYGPRVDVWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELAHPEKLSPVFKDFLAQSLEMDVEKRSSARELLQHPFLK 478          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO36150 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJF2])

HSP 1 Score: 128.642 bits (322), Expect = 3.205e-31
Identity = 79/245 (32.24%), Postives = 128/245 (52.24%), Query Frame = 1
Query:  823 FENV--IKQDLIDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEID----LFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYE-RHVKLCDF-SLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSE---LGYYAVIFRIGFEKKIVYEVPKHF 1524
             ENV   K +L+  G+F S Y    + +    A+K++ FC  S SE D        EIAIL  L  HP ++K            I +E++ GGS+   +  +G   E  +IR  ++IL+ + YLH   ++HRDIKG N+L+D   + +++ DF + +++       G   G     +GT  +MAPE++ G+ Y  + D+WS G  +IEM TGKPP++      + A+IF+I        ++P+H 
Sbjct:  572 LENVHWKKGELLGTGAFSSCYGARDVMTGSLMAVKQVSFCRNSKSEQDKVCQTIMDEIAILARL-KHPHLIKCLGATRHTGHFNIFLEWMAGGSISMLLSKYGPFEEAILIRYLRQILQGVSYLHENQVVHRDIKGANILVDSTGQDIRIADFGAAARLATQITGAGEFQG---QLLGTIAFMAPEVLRGESYGRSCDVWSVGCVLIEMATGKPPWNAHEHSNHLALIFKIACAIG-PPDIPEHL 811          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 161.77 bits (408), Expect = 1.752e-42
Identity = 95/272 (34.93%), Postives = 148/272 (54.41%), Query Frame = 1
Query:  712 IPVKNIQLFNNETQLELCE------NSENLCMEKRIFYNIFPDFENVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRF---CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTA-KSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFE 1491
            +P    + +N E+ L+  E      +++  C          P   N  +  L+ RG+FG VY C   ++ +E A K++ F   C  +  E++    EI +L +L  H RIV++    +   +  L I +E++PGGS+   ++++G L EK   R +++IL+ + YLH   I+HRDIKG N+L D   +VKL DF  SK +        ++GT  KS  GT  WM+PE+ING+ Y   AD+WS   TV+EM T KPP++E    A IF+I  +
Sbjct:  283 VPSSRTRSYNGESTLQFTELRSLGRSADKSCQRGTAKSPRAP--VNWRQGKLLGRGAFGEVYLCYDADTGRELAAKQVPFDPDCQETSKEVNALECEIQLLKNL-RHDRIVQYYGCLRDLDQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVSYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTIC----MSGTGIKSVTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIATQ 547          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 162.155 bits (409), Expect = 1.976e-42
Identity = 95/272 (34.93%), Postives = 148/272 (54.41%), Query Frame = 1
Query:  712 IPVKNIQLFNNETQLELCE------NSENLCMEKRIFYNIFPDFENVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRF---CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTA-KSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFE 1491
            +P    + +N E+ L+  E      +++  C          P   N  +  L+ RG+FG VY C   ++ +E A K++ F   C  +  E++    EI +L +L  H RIV++    +   +  L I +E++PGGS+   ++++G L EK   R +++IL+ + YLH   I+HRDIKG N+L D   +VKL DF  SK +        ++GT  KS  GT  WM+PE+ING+ Y   AD+WS   TV+EM T KPP++E    A IF+I  +
Sbjct:  313 VPSSRTRSYNGESTLQFTELRSLGRSADKSCQRGTAKSPRAP--VNWRQGKLLGRGAFGEVYLCYDADTGRELAAKQVPFDPDCQETSKEVNALECEIQLLKNL-RHDRIVQYYGCLRDLDQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVSYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTIC----MSGTGIKSVTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIATQ 577          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 162.155 bits (409), Expect = 1.976e-42
Identity = 95/272 (34.93%), Postives = 148/272 (54.41%), Query Frame = 1
Query:  712 IPVKNIQLFNNETQLELCE------NSENLCMEKRIFYNIFPDFENVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRF---CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTA-KSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFE 1491
            +P    + +N E+ L+  E      +++  C          P   N  +  L+ RG+FG VY C   ++ +E A K++ F   C  +  E++    EI +L +L  H RIV++    +   +  L I +E++PGGS+   ++++G L EK   R +++IL+ + YLH   I+HRDIKG N+L D   +VKL DF  SK +        ++GT  KS  GT  WM+PE+ING+ Y   AD+WS   TV+EM T KPP++E    A IF+I  +
Sbjct:  313 VPSSRTRSYNGESTLQFTELRSLGRSADKSCQRGTAKSPRAP--VNWRQGKLLGRGAFGEVYLCYDADTGRELAAKQVPFDPDCQETSKEVNALECEIQLLKNL-RHDRIVQYYGCLRDLDQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVSYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTIC----MSGTGIKSVTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIATQ 577          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:101160297])

HSP 1 Score: 159.458 bits (402), Expect = 2.109e-41
Identity = 92/231 (39.83%), Postives = 135/231 (58.44%), Query Frame = 1
Query:  847 LIDRGSFGSVYKCVQLNSRKEFALKELRF---CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTA-KSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKH 1521
            L+ +G+FG VY C   ++ +E A+K+++F      +  E+     EI +L +L  H RIV++    +   E  L I ME++PGGS+   ++S+G L E    R +++ILE + YLH   I+HRDIKG N+L D   +VKL DF  S+ L        L+GT  KS  GT  WM+PE+I+G+ Y   ADIWS G TV+EM T +PP++E    A IF+I  +     E+P H
Sbjct:  394 LLGQGAFGRVYLCYDADTGRELAVKQVQFDPESPETSKEVSALECEIQLLKNLC-HERIVQYYGCLRDTMERTLSIFMEHMPGGSIKDQLKSYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSVGNVKLGDFGASRRLQTIC----LSGTGIKSVTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTQRPPWAEFEAMAAIFKIATQ-PTNPELPVH 618          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101169290])

HSP 1 Score: 157.147 bits (396), Expect = 8.343e-41
Identity = 87/221 (39.37%), Postives = 131/221 (59.28%), Query Frame = 1
Query:  847 LIDRGSFGSVYKCVQLNSRKEFALKELRF---CDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQ--KFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTA-KSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFE 1491
            L+ +G+FG VY C  +++ +E A K+++F      +  E+     EI +L +L  H RIV++    +   E  L I MEY+PGGS+   ++++G L E    + +++ILE + YLH   I+HRDIKG N+L D   +VKL DF  SK L        ++GT  +S  GT  WM+PE+I+G+ Y   AD+WS G TV+EM T KPP++E    A IF+I  +
Sbjct:  358 LLGQGAFGLVYLCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEIQLLKNL-HHERIVQYYGCLRDHSEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC----MSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ 573          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000003368.1 (SMESG000003368.1)

HSP 1 Score: 1010.36 bits (2611), Expect = 0.000e+0
Identity = 519/524 (99.05%), Postives = 521/524 (99.43%), Query Frame = 1
Query:   55 MKIISFDNIIYKIDVDENDDSYKVKQKLSEKINTRPDNIGLVYKNRILFDDILIKDYQISPDDFVLVCIIENERKFSDKVSVDLTDSSCANHTNNDNRFHDMFSLITIIVESVTYSDTYIIKTNPNEIVFDALKRHLPSLRYLCFTHNESYVDTTRTFSDCNLNDGDLILMENLLETKHEHFCEITLESINHNYESISLFVTRQETIDYIKLKLSKEINIPVKNIQLFNNETQLELCENSENLCMEKRIFYNIFPDFENVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHFKKEFQXXXXXXXXXXXXXXXXXXXXXEHPFLKCE 1626
            MKIISFDNIIYKIDVDENDDSYKVKQKLSEKINTRPDNIGLVYKNRILFDDILIKDYQISPDDFVLVCIIENERKFSDKVSVDLTDSSCANHTNNDNRFHDMFSLITIIV+SVTYSDTYIIKT PNEIVFDALKRHLPSLRYLCFTHNESYVDTTRTFSDCNLNDGDLILMENLLETKHEHF EITLESINHNYESISLFVTRQETIDYIKLKLSKEINIPVKNIQLFNNETQLELCENSENLCMEKRIFYNIFPDFENVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKF+KENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILI AASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHFKKEFQSFLDSCLCSSSSKRLSADALLEHPFLKCE
Sbjct:    1 MKIISFDNIIYKIDVDENDDSYKVKQKLSEKINTRPDNIGLVYKNRILFDDILIKDYQISPDDFVLVCIIENERKFSDKVSVDLTDSSCANHTNNDNRFHDMFSLITIIVKSVTYSDTYIIKTKPNEIVFDALKRHLPSLRYLCFTHNESYVDTTRTFSDCNLNDGDLILMENLLETKHEHFYEITLESINHNYESISLFVTRQETIDYIKLKLSKEINIPVKNIQLFNNETQLELCENSENLCMEKRIFYNIFPDFENVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFSKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIQAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHFKKEFQSFLDSCLCSSSSKRLSADALLEHPFLKCE 524          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000003368.1 (SMESG000003368.1)

HSP 1 Score: 1006.13 bits (2600), Expect = 0.000e+0
Identity = 517/522 (99.04%), Postives = 519/522 (99.43%), Query Frame = 1
Query:   55 MKIISFDNIIYKIDVDENDDSYKVKQKLSEKINTRPDNIGLVYKNRILFDDILIKDYQISPDDFVLVCIIENERKFSDKVSVDLTDSSCANHTNNDNRFHDMFSLITIIVESVTYSDTYIIKTNPNEIVFDALKRHLPSLRYLCFTHNESYVDTTRTFSDCNLNDGDLILMENLLETKHEHFCEITLESINHNYESISLFVTRQETIDYIKLKLSKEINIPVKNIQLFNNETQLELCENSENLCMEKRIFYNIFPDFENVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHFKKEFQXXXXXXXXXXXXXXXXXXXXXEHPFLK 1620
            MKIISFDNIIYKIDVDENDDSYKVKQKLSEKINTRPDNIGLVYKNRILFDDILIKDYQISPDDFVLVCIIENERKFSDKVSVDLTDSSCANHTNNDNRFHDMFSLITIIV+SVTYSDTYIIKT PNEIVFDALKRHLPSLRYLCFTHNESYVDTTRTFSDCNLNDGDLILMENLLETKHEHF EITLESINHNYESISLFVTRQETIDYIKLKLSKEINIPVKNIQLFNNETQLELCENSENLCMEKRIFYNIFPDFENVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKF+KENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILI AASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHFKKEFQSFLDSCLCSSSSKRLSADALLEHPFLK
Sbjct:    1 MKIISFDNIIYKIDVDENDDSYKVKQKLSEKINTRPDNIGLVYKNRILFDDILIKDYQISPDDFVLVCIIENERKFSDKVSVDLTDSSCANHTNNDNRFHDMFSLITIIVKSVTYSDTYIIKTKPNEIVFDALKRHLPSLRYLCFTHNESYVDTTRTFSDCNLNDGDLILMENLLETKHEHFYEITLESINHNYESISLFVTRQETIDYIKLKLSKEINIPVKNIQLFNNETQLELCENSENLCMEKRIFYNIFPDFENVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFSKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIQAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHFKKEFQSFLDSCLCSSSSKRLSADALLEHPFLK 522          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000003368.1 (SMESG000003368.1)

HSP 1 Score: 1005.36 bits (2598), Expect = 0.000e+0
Identity = 517/522 (99.04%), Postives = 519/522 (99.43%), Query Frame = 1
Query:   55 MKIISFDNIIYKIDVDENDDSYKVKQKLSEKINTRPDNIGLVYKNRILFDDILIKDYQISPDDFVLVCIIENERKFSDKVSVDLTDSSCANHTNNDNRFHDMFSLITIIVESVTYSDTYIIKTNPNEIVFDALKRHLPSLRYLCFTHNESYVDTTRTFSDCNLNDGDLILMENLLETKHEHFCEITLESINHNYESISLFVTRQETIDYIKLKLSKEINIPVKNIQLFNNETQLELCENSENLCMEKRIFYNIFPDFENVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHFKKEFQXXXXXXXXXXXXXXXXXXXXXEHPFLK 1620
            MKIISFDNIIYKIDVDENDDSYKVKQKLSEKINTRPDNIGLVYKNRILFDDILIKDYQISPDDFVLVCIIENERKFSDKVSVDLTDSSCANHTNNDNRFHDMFSLITIIV+SVTYSDTYIIKT PNEIVFDALKRHLPSLRYLCFTHNESYVDTTRTFSDCNLNDGDLILMENLLETKHEHF EITLESINHNYESISLFVTRQETIDYIKLKLSKEINIPVKNIQLFNNETQLELCENSENLCMEKRIFYNIFPDFENVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKF+KENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILI AASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHFKKEFQSFLDSCLCSSSSKRLSADALLEHPFLK
Sbjct:    1 MKIISFDNIIYKIDVDENDDSYKVKQKLSEKINTRPDNIGLVYKNRILFDDILIKDYQISPDDFVLVCIIENERKFSDKVSVDLTDSSCANHTNNDNRFHDMFSLITIIVKSVTYSDTYIIKTKPNEIVFDALKRHLPSLRYLCFTHNESYVDTTRTFSDCNLNDGDLILMENLLETKHEHFYEITLESINHNYESISLFVTRQETIDYIKLKLSKEINIPVKNIQLFNNETQLELCENSENLCMEKRIFYNIFPDFENVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFSKENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIQAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHFKKEFQSFLDSCLCSSSSKRLSADALLEHPFLK 522          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000009500.1 (SMESG000009500.1)

HSP 1 Score: 190.274 bits (482), Expect = 7.422e-53
Identity = 113/305 (37.05%), Postives = 170/305 (55.74%), Query Frame = 1
Query:  637 ESISLFVTRQETIDYIKLKLSKEINIPVKNIQLFNNETQLELCENSEN--LCMEKRIFYNIFPDFENVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRFC-DRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAK-ENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHFKKEFQ 1539
            E I++   ++   D +K +L +EI I +K+ Q   ++  +   E S +    +   I Y      EN++ QD +  G FG VY+C  L + K  A+KE++   ++  S++    KEI     L  H RI+++   F K E    I MEY+  GSL SY+  +G L E+EI R S ++LE + YLH   I+HRDIKG N+LLD + + KL DF LSK     +S     G  +S VGT NW APE++N + Y   ADIWSFGATV+EM  G+ PY++     + F++  +KKI +  PK   ++ +
Sbjct:  257 EKITVSDCKKAVADRVK-RLPEEI-ILIKSNQCLKDDETISNYEYSPDSYFALRSGISYFRLSKLENIVNQDPVGEGGFGKVYQCEDLATNKVMAVKEIKIPKNKKLSDVTSAIKEILTFSKLECHQRIIQYFDFFQKDEKTFCITMEYMANGSLSSYLEINGPLEEREIARISTQVLEGLLYLHNNQILHRDIKGGNILLDDKLNAKLADFGLSKCSEEISSWDFYTGILQSNVGTQNWTAPEVLNDEAYGLKADIWSFGATVVEMVVGERPYADYESVQLTFKLLTDKKIEFTPPKTMTRQLE 559          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000009500.1 (SMESG000009500.1)

HSP 1 Score: 189.889 bits (481), Expect = 1.397e-52
Identity = 113/305 (37.05%), Postives = 170/305 (55.74%), Query Frame = 1
Query:  637 ESISLFVTRQETIDYIKLKLSKEINIPVKNIQLFNNETQLELCENSEN--LCMEKRIFYNIFPDFENVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRFC-DRSFSEIDLFYKEIAILCSLGDHPRIVKFEQKFAK-ENCLYILMEYVPGGSLGSYIRSHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLCDFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSFGATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHFKKEFQ 1539
            E I++   ++   D +K +L +EI I +K+ Q   ++  +   E S +    +   I Y      EN++ QD +  G FG VY+C  L + K  A+KE++   ++  S++    KEI     L  H RI+++   F K E    I MEY+  GSL SY+  +G L E+EI R S ++LE + YLH   I+HRDIKG N+LLD + + KL DF LSK     +S     G  +S VGT NW APE++N + Y   ADIWSFGATV+EM  G+ PY++     + F++  +KKI +  PK   ++ +
Sbjct:  285 EKITVSDCKKAVADRVK-RLPEEI-ILIKSNQCLKDDETISNYEYSPDSYFALRSGISYFRLSKLENIVNQDPVGEGGFGKVYQCEDLATNKVMAVKEIKIPKNKKLSDVTSAIKEILTFSKLECHQRIIQYFDFFQKDEKTFCITMEYMANGSLSSYLEINGPLEEREIARISTQVLEGLLYLHNNQILHRDIKGGNILLDDKLNAKLADFGLSKCSEEISSWDFYTGILQSNVGTQNWTAPEVLNDEAYGLKADIWSFGATVVEMVVGERPYADYESVQLTFKLLTDKKIEFTPPKTMTRQLE 587          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP3K31.892e-4330.81mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K32.594e-4330.81mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K32.646e-4330.81mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K32.863e-4330.81mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K32.863e-4330.81mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nsy-18.766e-3736.60Mitogen-activated protein kinase kinase kinase nsy... [more]
nsy-19.129e-3736.60Mitogen-activated protein kinase kinase kinase nsy... [more]
cst-28.454e-3636.09Caenorhabditis STE20-like kinase [Source:UniProtK... [more]
cst-11.808e-3536.09Serine/threonine-protein kinase cst-1 Serine/threo... [more]
cst-12.064e-3536.09Serine/threonine-protein kinase cst-1 Serine/threo... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GckIII1.443e-3740.00gene:FBgn0266465 transcript:FBtr0083399[more]
Ask16.874e-3737.77gene:FBgn0014006 transcript:FBtr0300256[more]
Ask17.200e-3737.77gene:FBgn0014006 transcript:FBtr0083819[more]
hpo3.385e-3537.39gene:FBgn0261456 transcript:FBtr0331920[more]
hpo3.385e-3537.39gene:FBgn0261456 transcript:FBtr0086500[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k227.177e-4239.21mitogen-activated protein kinase kinase kinase 22 ... [more]
map3k33.206e-4138.63mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k33.864e-4138.63mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k36.007e-4138.63mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k27.806e-4139.82mitogen-activated protein kinase kinase kinase 2 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
samd82.520e-4436.26sterile alpha motif domain containing 8 [Source:Xe... [more]
samd83.701e-4436.26sterile alpha motif domain containing 8 [Source:Xe... [more]
MAP3K23.825e-4240.26mitogen-activated protein kinase kinase kinase 2 [... [more]
MAP3K24.939e-4240.26mitogen-activated protein kinase kinase kinase 2 [... [more]
dennd1a5.769e-4039.04DENN domain containing 1A [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Map3k31.094e-4230.53mitogen-activated protein kinase kinase kinase 3 [... [more]
Map3k26.413e-4240.27mitogen-activated protein kinase kinase kinase 2 [... [more]
Stk43.041e-4037.07serine/threonine kinase 4 [Source:MGI Symbol;Acc:M... [more]
Stk31.190e-3936.82serine/threonine kinase 3 [Source:MGI Symbol;Acc:M... [more]
Stk31.747e-3936.82serine/threonine kinase 3 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99759|M3K3_HUMAN9.085e-4330.81Mitogen-activated protein kinase kinase kinase 3 O... [more]
sp|Q61084|M3K3_MOUSE7.652e-4230.53Mitogen-activated protein kinase kinase kinase 3 O... [more]
sp|Q9Y2U5|M3K2_HUMAN4.486e-4140.27Mitogen-activated protein kinase kinase kinase 2 O... [more]
sp|Q61083|M3K2_MOUSE1.133e-3939.82Mitogen-activated protein kinase kinase kinase 2 O... [more]
sp|Q7ZUQ3|STK3_DANRE1.448e-3936.58Serine/threonine-protein kinase 3 OS=Danio rerio O... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1G1N24.348e-4338.82Protein kinase domain-containing protein OS=Helobd... [more]
A0A0C3BRW77.053e-4342.45Protein kinase domain-containing protein (Fragment... [more]
A7S4G71.334e-4240.18Predicted protein (Fragment) OS=Nematostella vecte... [more]
K1PKP11.565e-4138.86Mitogen-activated protein kinase kinase kinase 2 O... [more]
A0A212D6K23.176e-4130.81Protein kinase domain-containing protein (Fragment... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k191.637e-4337.55mitogen-activated protein kinase kinase kinase 19 ... [more]
map3k222.847e-4138.33mitogen-activated protein kinase kinase kinase 3-l... [more]
map3k223.363e-4138.33mitogen-activated protein kinase kinase kinase 3-l... [more]
map3k35.553e-4139.64mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k35.553e-4139.64mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k22.573e-4439.82mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k198.402e-3933.88mitogen-activated protein kinase kinase kinase 19 ... [more]
stk25a3.918e-3438.14serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-G... [more]
slka1.125e-3237.50STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
MARK32.315e-3033.00microtubule affinity regulating kinase 3 [Source:H... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
BCK15.538e-4037.44MAPKKK acting in the protein kinase C signaling pa... [more]
CDC158.112e-3640.00Protein kinase of the Mitotic Exit Network; locali... [more]
KIC11.002e-3437.75Protein kinase of the PAK/Ste20 family, required f... [more]
STE208.496e-3335.10Cdc42p-activated signal transducing kinase; involv... [more]
PKH21.397e-3234.25Serine/threonine protein kinase; involved in sphin... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO414101.682e-4640.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428453.212e-3835.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478212.384e-3433.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336673.864e-3333.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361503.205e-3132.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k221.752e-4234.93mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k221.976e-4234.93mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k221.976e-4234.93mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k22.109e-4139.83mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k38.343e-4139.37mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003368.10.000e+099.05SMESG000003368.1[more]
SMESG000003368.10.000e+099.04SMESG000003368.1[more]
SMESG000003368.10.000e+099.04SMESG000003368.1[more]
SMESG000009500.17.422e-5337.05SMESG000009500.1[more]
SMESG000009500.11.397e-5237.05SMESG000009500.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008378 ID=SMED30008378|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1722bp
AACATTTAAATAATTTTTTATCATCACAAACTCAGTTCAGACTTACTGAT
ATATATGAAAATAATAAGTTTTGATAATATAATTTATAAAATTGATGTTG
ACGAAAACGATGACTCTTACAAAGTCAAACAGAAGCTTTCTGAAAAAATA
AATACGAGACCAGATAATATTGGTTTGGTGTATAAAAATAGAATTCTTTT
CGATGATATTTTGATAAAGGACTACCAAATTTCGCCTGACGATTTCGTTC
TGGTTTGTATAATAGAAAATGAGAGAAAGTTTTCTGATAAAGTCTCAGTG
GACCTAACTGATAGTTCATGTGCCAATCATACAAATAATGACAACAGATT
TCATGACATGTTTAGTCTCATTACAATCATTGTTGAATCCGTCACTTATA
GCGATACTTACATTATTAAAACAAATCCAAACGAAATAGTATTTGACGCT
CTTAAAAGACATTTGCCAAGCTTGAGGTATTTGTGTTTCACTCATAATGA
ATCGTATGTCGACACGACTCGTACATTCTCCGACTGTAATCTCAATGATG
GAGATTTGATCTTGATGGAGAATTTGTTAGAAACGAAACATGAACACTTC
TGCGAGATCACCCTCGAATCGATAAATCATAATTATGAATCGATATCCCT
ATTTGTCACTCGCCAGGAAACAATCGACTATATCAAATTGAAATTGTCCA
AAGAGATCAATATCCCAGTGAAAAATATCCAGCTATTCAACAATGAAACT
CAACTGGAATTATGCGAAAATTCCGAAAATCTCTGTATGGAAAAGAGAAT
ATTTTACAATATATTTCCCGACTTCGAAAATGTTATCAAACAAGATTTGA
TTGATCGCGGCTCTTTCGGATCGGTTTATAAATGTGTCCAGTTGAATTCG
AGAAAAGAATTTGCATTAAAAGAGCTTCGATTCTGCGACAGAAGCTTTTC
GGAGATAGATTTATTTTACAAAGAAATTGCCATTTTATGTTCCTTGGGTG
ACCATCCGAGAATTGTTAAATTTGAACAGAAATTTGCTAAAGAAAACTGT
TTATACATTTTAATGGAATATGTACCAGGAGGTTCTCTCGGGAGTTATAT
TAGAAGTCATGGCCGATTAAATGAAAAAGAAATAATCAGATGTTCCCAAG
AAATATTAGAAGCTATCCAATATTTACATTACTTGCATATTATTCACAGA
GACATTAAAGGAGATAATGTTTTACTGGATTATGAGAGACACGTGAAACT
GTGCGATTTCAGTCTGTCTAAAATTCTTATTCACGCAGCCAGTAAAGGTA
GCTTAAATGGCACAGCGAAATCATTTGTCGGAACTGCTAATTGGATGGCC
CCGGAAATAATCAACGGCAAACAGTACGATTGCGCTGCTGACATATGGTC
TTTCGGAGCAACGGTAATTGAAATGTTTACGGGAAAACCACCATACTCAG
AACTGGGATACTACGCGGTAATATTCAGGATTGGCTTTGAAAAGAAAATT
GTATATGAAGTACCAAAACATTTTAAAAAGGAATTTCAAAGTTTCCTTGA
CTCTTGTTTATGTTCAAGTTCTTCAAAACGCTTGTCAGCTGATGCTTTAT
TGGAGCATCCATTTCTTAAATGTGAATAGAAACCTTGAATCAAAGTCCTT
GATCATCATACTTTTTCAGATAGATATTTTTTAAATTCAAATATTAAATA
TTCATTTTCCATCTTTCAAAAA
back to top

protein sequence of SMED30008378-orf-1

>SMED30008378-orf-1 ID=SMED30008378-orf-1|Name=SMED30008378-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=525bp
MKIISFDNIIYKIDVDENDDSYKVKQKLSEKINTRPDNIGLVYKNRILFD
DILIKDYQISPDDFVLVCIIENERKFSDKVSVDLTDSSCANHTNNDNRFH
DMFSLITIIVESVTYSDTYIIKTNPNEIVFDALKRHLPSLRYLCFTHNES
YVDTTRTFSDCNLNDGDLILMENLLETKHEHFCEITLESINHNYESISLF
VTRQETIDYIKLKLSKEINIPVKNIQLFNNETQLELCENSENLCMEKRIF
YNIFPDFENVIKQDLIDRGSFGSVYKCVQLNSRKEFALKELRFCDRSFSE
IDLFYKEIAILCSLGDHPRIVKFEQKFAKENCLYILMEYVPGGSLGSYIR
SHGRLNEKEIIRCSQEILEAIQYLHYLHIIHRDIKGDNVLLDYERHVKLC
DFSLSKILIHAASKGSLNGTAKSFVGTANWMAPEIINGKQYDCAADIWSF
GATVIEMFTGKPPYSELGYYAVIFRIGFEKKIVYEVPKHFKKEFQSFLDS
CLCSSSSKRLSADALLEHPFLKCE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
Vocabulary: INTERPRO
TermDefinition
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR000719Prot_kinase_dom
IPR000626Ubiquitin-like_dom
IPR008271Ser/Thr_kinase_AS
IPR029071Ubiquitin-like_domsf
IPR011009Kinase-like_dom_sf
IPR001024PLAT/LH2_dom
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0006915apoptotic process
GO:0007165signal transduction
GO:0016310phosphorylation
GO:0035329hippo signaling
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPRINTSPR00109TYRKINASEcoord: 445..467
score: 29.54
coord: 337..350
score: 37.85
coord: 373..391
score: 39.97
coord: 426..436
score: 40.21
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 260..521
e-value: 5.0E-86
score: 301.8
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 264..521
e-value: 1.7E-65
score: 221.0
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 260..521
score: 47.057
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 245..523
e-value: 6.6E-79
score: 266.8
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 2..70
e-value: 2.1E-8
score: 35.7
NoneNo IPR availablePANTHERPTHR11584SERINE/THREONINE PROTEIN KINASEcoord: 183..521
NoneNo IPR availablePANTHERPTHR11584:SF369APOPTOTIC SIGNAL-REGULATING KINASE 1, ISOFORM Ccoord: 183..521
NoneNo IPR availableCDDcd06606STKc_MAPKKKcoord: 261..521
e-value: 6.55267E-92
score: 279.405
IPR000626Ubiquitin-like domainPFAMPF00240ubiquitincoord: 6..68
e-value: 1.1E-7
score: 31.5
IPR000626Ubiquitin-like domainPROSITEPS50053UBIQUITIN_2coord: 1..67
score: 10.288
IPR000626Ubiquitin-like domainPROSITEPS50053UBIQUITIN_2coord: 183..235
score: 8.72
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 379..391
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 262..522
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 6..69