Si:ch211-215k15.4

Overview
NameSi:ch211-215k15.4
Smed IDSMED30008372
Length (bp)1056
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Si:ch211-215k15.4 (SMED30008372) t-SNE clustered cells

Violin plots show distribution of expression levels for Si:ch211-215k15.4 (SMED30008372) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Si:ch211-215k15.4 (SMED30008372) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Si:ch211-215k15.4 (SMED30008372) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008372

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30008372SMESG000011037.1 SmedASXL_070357SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Si:ch211-215k15.4 vs. Ensembl Zebrafish
Match: si:ch211-215k15.4 (si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127-215])

HSP 1 Score: 62.3882 bits (150), Expect = 1.832e-10
Identity = 42/139 (30.22%), Postives = 61/139 (43.88%), Query Frame = 1
Query:  364 SSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYD------------SISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVYGH 744
            +S A+DGNRD   Y+G C ++   ++ WW + L   YVV  I I  R DCC  RL    ++                 IS + +G S  ++++        GIS           R + V    S+  L LCE EVYG+
Sbjct:   45 ASNAIDGNRDPDFYHGSCTATEVQDDPWWRLDLLDTYVVKSITITNRKDCCPERLDGAEVHIGNSLLNNGNSNPLAAKISSIPAGRSLTFKWKK-------GIS----------GRYINVILRGSNRILTLCELEVYGY 166          
BLAST of Si:ch211-215k15.4 vs. Ensembl Zebrafish
Match: si:ch211-215k15.4 (si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127-215])

HSP 1 Score: 62.003 bits (149), Expect = 2.012e-10
Identity = 42/139 (30.22%), Postives = 61/139 (43.88%), Query Frame = 1
Query:  364 SSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYD------------SISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVYGH 744
            +S A+DGNRD   Y+G C ++   ++ WW + L   YVV  I I  R DCC  RL    ++                 IS + +G S  ++++        GIS           R + V    S+  L LCE EVYG+
Sbjct:   50 ASNAIDGNRDPDFYHGSCTATEVQDDPWWRLDLLDTYVVKSITITNRKDCCPERLDGAEVHIGNSLLNNGNSNPLAAKISSIPAGRSLTFKWKK-------GIS----------GRYINVILRGSNRILTLCELEVYGY 171          
BLAST of Si:ch211-215k15.4 vs. Ensembl Zebrafish
Match: si:ch73-359m17.2 (si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-90])

HSP 1 Score: 55.4546 bits (132), Expect = 3.395e-8
Identity = 34/114 (29.82%), Postives = 53/114 (46.49%), Query Frame = 1
Query:  325 SAYYFASTNTTW----DSSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTL------SLYASYDS------ISQVTSGSSSFYEFQYYQG 618
            +A   A  ++TW    D+  AVDG+ +     G C  +    N WW V L  V+ + R+ I  R DCC  RL+        SL  + +S      +  + +G++  +EFQ  QG
Sbjct:  169 AAGAAAIQSSTWPHDGDAGNAVDGSTESEYQEGSCSHTLGETNPWWRVDLGRVFSIRRVSITNRGDCCEERLNGAEIRIGNSLENNGNSNHLVATVEHIPAGNTETFEFQPVQG 282          

HSP 2 Score: 50.0618 bits (118), Expect = 1.584e-6
Identity = 40/153 (26.14%), Postives = 59/153 (38.56%), Query Frame = 1
Query:  319 SSSAYYFASTNTTWDSSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSIS-------------QVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVY 738
             ++A   ++ +   ++  AVDGN +     G C  +    N WW V L GV  V ++ I  R DCC  R+    +    DS+                  GS +F EFQ  QG                  R + V    +  +L LCE EV+
Sbjct:   29 GAAAVQSSTGDPNGNAEHAVDGNTEADYRKGSCTHTSREFNPWWRVDLGGVSSVNKVTITNRGDCCEERIRGAQIRIG-DSLENNGNNNQLAATLLDAIKGSQTF-EFQPIQG------------------RYLNVFLPGNDETLSLCEVEVF 161          
BLAST of Si:ch211-215k15.4 vs. Ensembl Zebrafish
Match: si:ch73-359m17.2 (si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-90])

HSP 1 Score: 50.447 bits (119), Expect = 3.464e-7
Identity = 40/153 (26.14%), Postives = 59/153 (38.56%), Query Frame = 1
Query:  319 SSSAYYFASTNTTWDSSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSIS-------------QVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVY 738
             ++A   ++ +   ++  AVDGN +     G C  +    N WW V L GV  V ++ I  R DCC  R+    +    DS+                  GS +F EFQ  QG                  R + V    +  +L LCE EV+
Sbjct:   29 GAAAVQSSTGDPNGNAEHAVDGNTEADYRKGSCTHTSREFNPWWRVDLGGVSSVNKVTITNRGDCCEERIRGAQIRIG-DSLENNGNNNQLAATLLDAIKGSQTF-EFQPIQG------------------RYLNVFLPGNDETLSLCEVEVF 161          
BLAST of Si:ch211-215k15.4 vs. Ensembl Zebrafish
Match: si:ch73-359m17.2 (si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-90])

HSP 1 Score: 49.2914 bits (116), Expect = 2.013e-6
Identity = 40/153 (26.14%), Postives = 59/153 (38.56%), Query Frame = 1
Query:  319 SSSAYYFASTNTTWDSSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSIS-------------QVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVY 738
             ++A   ++ +   ++  AVDGN +     G C  +    N WW V L GV  V ++ I  R DCC  R+    +    DS+                  GS +F EFQ  QG                  R + V    +  +L LCE EV+
Sbjct:   29 GAAAVQSSTGDPNGNAEHAVDGNTEADYRKGSCTHTSREFNPWWRVDLGGVSSVNKVTITNRGDCCEERIRGAQIRIG-DSLENNGNNNQLAATLLDAIKGSQTF-EFQPIQG------------------RYLNVFLPGNDETLSLCEVEVF 161          
BLAST of Si:ch211-215k15.4 vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 58.151 bits (139), Expect = 6.542e-9
Identity = 35/132 (26.52%), Postives = 62/132 (46.97%), Query Frame = 1
Query:  358 WDSSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRL--STLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVYGHQ 747
            ++++ A+DGN+D  +  G C  + S N  WW + L   Y V +++I  R DCC  RL  + + +  S D+ + V +  +   +              ++ +   +  R V V     +  L+LCE EVYG +
Sbjct:  208 YNAAAAIDGNKDTNMMAGSCSHTNSDNPAWWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEIRVGDSPDNNNPVCATVTDVSQL------------TLTLSCKGIPGRYVSVVIPGRAEYLQLCEVEVYGKE 327          

HSP 2 Score: 56.9954 bits (136), Expect = 1.562e-8
Identity = 44/174 (25.29%), Postives = 75/174 (43.10%), Query Frame = 1
Query:  238 LLKFLFAFGIGFTSSADLLLSGNKFTNSSSAYYFASTNTTWDSSKAVDGNRDGVIYNGHCFSSYSSNNK--WWLVVLDGVYVVTRIIIYARTDCCTSRL--STLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVYGHQ 747
            ++  L    +G+  S       N    S      ++    + + KAVDGN+D  ++   C  S+++N+K  WW + L   Y +  I+I  R DCC  RL  + + +  S D+ + V +  +   +  +           V  N   +  R V V     +  L+LCE EVYG +
Sbjct:   25 IVVLLVGISMGWVHSCSPPPGANNLAQSGDVKQSSTFGAQYTAQKAVDGNKDTNMFQNSC--SHTNNDKPSWWQLDLKKNYNIDTIVIANRGDCCAERLLRAEIRVGNSPDNNNPVCATITDVSKLTFP----------VCCNG--MEGRYVSVVISDRAEYLQLCEVEVYGQE 184          
BLAST of Si:ch211-215k15.4 vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 57.7658 bits (138), Expect = 8.621e-9
Identity = 35/132 (26.52%), Postives = 62/132 (46.97%), Query Frame = 1
Query:  358 WDSSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRL--STLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVYGHQ 747
            ++++ A+DGN+D  +  G C  + S N  WW + L   Y V +++I  R DCC  RL  + + +  S D+ + V +  +   +              ++ +   +  R V V     +  L+LCE EVYG +
Sbjct:  187 YNAAAAIDGNKDTNMMAGSCSHTNSDNPAWWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEIRVGDSPDNNNPVCATVTDVSQL------------TLTLSCKGIPGRYVSVVIPGRAEYLQLCEVEVYGKE 306          

HSP 2 Score: 56.225 bits (134), Expect = 2.367e-8
Identity = 44/174 (25.29%), Postives = 75/174 (43.10%), Query Frame = 1
Query:  238 LLKFLFAFGIGFTSSADLLLSGNKFTNSSSAYYFASTNTTWDSSKAVDGNRDGVIYNGHCFSSYSSNNK--WWLVVLDGVYVVTRIIIYARTDCCTSRL--STLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVYGHQ 747
            ++  L    +G+  S       N    S      ++    + + KAVDGN+D  ++   C  S+++N+K  WW + L   Y +  I+I  R DCC  RL  + + +  S D+ + V +  +   +  +           V  N   +  R V V     +  L+LCE EVYG +
Sbjct:    4 IVVLLVGISMGWVHSCSPPPGANNLAQSGDVKQSSTFGAQYTAQKAVDGNKDTNMFQNSC--SHTNNDKPSWWQLDLKKNYNIDTIVIANRGDCCAERLLRAEIRVGNSPDNNNPVCATITDVSKLTFP----------VCCNG--MEGRYVSVVISDRAEYLQLCEVEVYGQE 163          
BLAST of Si:ch211-215k15.4 vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 57.3806 bits (137), Expect = 1.048e-8
Identity = 35/132 (26.52%), Postives = 62/132 (46.97%), Query Frame = 1
Query:  358 WDSSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRL--STLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVYGHQ 747
            ++++ A+DGN+D  +  G C  + S N  WW + L   Y V +++I  R DCC  RL  + + +  S D+ + V +  +   +              ++ +   +  R V V     +  L+LCE EVYG +
Sbjct:  186 YNAAAAIDGNKDTNMMAGSCSHTNSDNPAWWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEIRVGDSPDNNNPVCATVTDVSQL------------TLTLSCKGIPGRYVSVVIPGRAEYLQLCEVEVYGKE 305          

HSP 2 Score: 53.5286 bits (127), Expect = 1.782e-7
Identity = 37/132 (28.03%), Postives = 62/132 (46.97%), Query Frame = 1
Query:  358 WDSSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRL--STLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVYGHQ 747
            ++++ AVDGN++  +  G C  + S N  WW + L   Y V +++I  R DCC  RL  + + +  S D+ + V +  +   +  +           V  N   +  R V V     +  L+LCE EVYG +
Sbjct:   43 YNAATAVDGNKNSNMMLGSCSHTNSDNPAWWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEVRVGNSADNNNPVCATITDVSKLTFP----------VCCNG--MEGRYVSVVISDRAEYLQLCEVEVYGQE 162          
BLAST of Si:ch211-215k15.4 vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 56.9954 bits (136), Expect = 1.304e-8
Identity = 35/132 (26.52%), Postives = 62/132 (46.97%), Query Frame = 1
Query:  358 WDSSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRL--STLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVYGHQ 747
            ++++ A+DGN+D  +  G C  + S N  WW + L   Y V +++I  R DCC  RL  + + +  S D+ + V +  +   +              ++ +   +  R V V     +  L+LCE EVYG +
Sbjct:  186 YNAAAAIDGNKDTNMMAGSCSHTNSDNPAWWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEIRVGDSPDNNNPVCATVTDVSQL------------TLTLSCKGIPGRYVSVVIPGRAEYLQLCEVEVYGKE 305          

HSP 2 Score: 50.447 bits (119), Expect = 1.753e-6
Identity = 37/130 (28.46%), Postives = 57/130 (43.85%), Query Frame = 1
Query:  358 WDSSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVYGHQ 747
            ++++ AVDGN++  +  G C  + S N  WW + L   Y V  ++I  R DCC  RL    +    DS +      ++  +      P       V  N   +  R V V     +  L+LCE EVYG +
Sbjct:   43 YNAATAVDGNKNSNMMLGSCSHTNSDNPAWWQLDLKKRYKVETVVIVNRGDCCWERLRGAVIRVG-DSANNNNPVCATITDVSKLTFP-------VCCNG--MEGRYVSVVISDRAEYLQLCEVEVYGQE 162          
BLAST of Si:ch211-215k15.4 vs. Ensembl Xenopus
Match: ncapg2 (non-SMC condensin II complex subunit G2 [Source:Xenbase;Acc:XB-GENE-1002744])

HSP 1 Score: 55.8398 bits (133), Expect = 4.861e-8
Identity = 43/173 (24.86%), Postives = 66/173 (38.15%), Query Frame = 1
Query:  238 LLKFLFAFGIGFTSSADLLLSGNKFTNSSSAYYFASTNTTWDSSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRL--STLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVYGHQF 750
            ++  L    IG+  S ++L        S  A   ++    + +  A DGNR   +    C S+   N  WW V L   Y V  ++I  R DCC  RL  + + +  S D+ + V    + F               + +        R V V     +  L LCE EVYG + 
Sbjct:    5 IVVLLVCISIGWVHSCNVLPGAINLAKSGDAKQSSTYAPRYSAQAAADGNRATNLLTAPCASTAYDNPAWWQVDLKKTYSVDTVVIVNRGDCCRERLRGAEIRVGNSPDNNNPVCGIINDFSNL------------ITTLCCDGKEGRYVSVVIPGRNEYLNLCELEVYGQEV 165          

HSP 2 Score: 55.4546 bits (132), Expect = 6.023e-8
Identity = 36/130 (27.69%), Postives = 58/130 (44.62%), Query Frame = 1
Query:  352 TTWDSSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVYG 741
            + + +S A DGN++  +  G C  + S N  WW + L   Y V +++I  R DCC  RL            ++V  GSS+  +              ++ +   +  R V V     + +L+LCE EVYG
Sbjct:  186 SEYGASNANDGNKNANMMKGSCSLTGSDNPAWWQLDLKKPYSVEKVVIVNRGDCCWERLQG----------AEVRVGSSTNNKNPVCGTVTDTSQGTITLSCNGMEGRYVSVVIPRRAETLQLCEVEVYG 305          

HSP 3 Score: 51.6026 bits (122), Expect = 1.255e-6
Identity = 36/133 (27.07%), Postives = 59/133 (44.36%), Query Frame = 1
Query:  358 WDSSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGI------SVVSFNFTRLVARTVMVAQEISSTSLELCEFEVY 738
            ++++ A+DGN +  +  G C  + + N  WW + L   Y V +++I  R DCC  RL            ++V  GSSS  +       P  G+        ++ +   +  R V V       +L+LCE EVY
Sbjct:  328 YNAATAIDGNTNSNMMAGSCSHTGNDNPAWWQLDLKKPYRVEKVLIVNRGDCCGERLLG----------AEVRVGSSSSRDN------PVCGVVTDVSKPTITLSCNGMGGRYVSVVIPGRPETLQLCEVEVY 444          
BLAST of Si:ch211-215k15.4 vs. UniProt/SwissProt
Match: sp|Q7SIC1|FUCL_ANGAN (Fucolectin OS=Anguilla anguilla OX=7936 PE=1 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 7.931e-10
Identity = 44/133 (33.08%), Postives = 58/133 (43.61%), Query Frame = 1
Query:  361 DSSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTS-------GSSSFYEFQYYQGP-PAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEV 735
            ++S A+DGNRD   Y+G C  S    N WW V L  VY +T + I  R DCC  R+S   +       S   +       GS +  E + +  P P  G  VV++  T              S SL LCE EV
Sbjct:   32 EASNAIDGNRDSNFYHGSCTHSSGQANPWWRVDLLQVYTITSVTITNRGDCCGERISGAEINIGQHLASNGVNNPECSVIGSMATGETKTFHCPAPMIGRYVVTYLPT--------------SESLHLCEVEV 150          
BLAST of Si:ch211-215k15.4 vs. UniProt/SwissProt
Match: sp|Q9I925|FUCL7_ANGJA (Fucolectin-7 OS=Anguilla japonica OX=7937 PE=2 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 1.498e-8
Identity = 43/140 (30.71%), Postives = 62/140 (44.29%), Query Frame = 1
Query:  319 SSSAYYFASTNTTWDSSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLS-LYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEV 735
            + SA      +    +S A+DGNRD V Y+G C +   ++  WW V L  VY +T + I  R DCC  R+S    L   +   + + +   S        GP A G +        ++ R V V     + SL LCE EV
Sbjct:   50 TQSAQLRGDHSGIAHASNAIDGNRDSVFYHGSC-THTEADKPWWRVDLLQVYTITSVTITNRGDCCEERISGARILIGKHLENNGINNPQCSVI------GPMAAGETKTFRCPQPMIGRYVTVYLP-KAESLHLCEVEV 181          
BLAST of Si:ch211-215k15.4 vs. UniProt/SwissProt
Match: sp|Q9I929|FUCL3_ANGJA (Fucolectin-3 OS=Anguilla japonica OX=7937 PE=2 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 3.129e-8
Identity = 39/131 (29.77%), Postives = 57/131 (43.51%), Query Frame = 1
Query:  364 SSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTR-------LVARTVMVAQEISSTSLELCEFEV 735
            +S A+DGNRD   ++G C S    +N WW V L  VY +T + I  R DCC  R+S   +                  E      P    I++++   T+       ++ R V V     + SL+LCE EV
Sbjct:   56 ASNAIDGNRDSNYHHGSC-SHTEGDNSWWRVDLKQVYTITSVTITNRGDCCGERISGARILI------------GKHLENNGINNPECSTINIMAAGETKTFHCPQPMIGRYVTVYLP-KAESLQLCEVEV 172          
BLAST of Si:ch211-215k15.4 vs. UniProt/SwissProt
Match: sp|Q9I931|FUCL1_ANGJA (Fucolectin-1 OS=Anguilla japonica OX=7937 PE=2 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 3.170e-7
Identity = 34/112 (30.36%), Postives = 51/112 (45.54%), Query Frame = 1
Query:  226 FEMNLLKFLFA-FGIGFTSSADLLLSGNKFTNSSSAYYFASTNTTWDSSK---------AVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLS 531
             ++  +  LF    I    SAD+    N++   + A    +T +T  S           A+DGNRD    +G C  + +S N WW V L  +Y +T + I  R DCC  R+S
Sbjct:    1 MKVKTIMLLFQILAISTIKSADV---PNRYIQENVAVRGKATQSTLPSGAGAVLSLPGFAIDGNRDSDFSHGSCSHTTNSPNPWWRVDLLQLYTITSVTITNRGDCCGERIS 109          
BLAST of Si:ch211-215k15.4 vs. UniProt/SwissProt
Match: sp|Q9I930|FUCL2_ANGJA (Fucolectin-2 OS=Anguilla japonica OX=7937 PE=2 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 5.258e-7
Identity = 40/131 (30.53%), Postives = 55/131 (41.98%), Query Frame = 1
Query:  364 SSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTR-------LVARTVMVAQEISSTSLELCEFEV 735
            +S A+DGNRD   Y+G C S    +N  W V L  VY +T + I  R DCC  R+S   +                  E      P    I++++   TR       ++ R V V    + T L LCE EV
Sbjct:   56 ASNAIDGNRDSYFYHGSC-SHTEGDNPLWRVDLLQVYTITSVTITNRGDCCGERISGARILI------------GKHLENNGINNPECSTINIMAAGETRTFHCPQPMIGRYVTVYLPKTGT-LHLCEVEV 172          
BLAST of Si:ch211-215k15.4 vs. TrEMBL
Match: A0A3P8NSG3 (Si:ch211-215k15.4 OS=Astatotilapia calliptera OX=8154 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.692e-11
Identity = 44/130 (33.85%), Postives = 66/130 (50.77%), Query Frame = 1
Query:  361 DSSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLV-ARTVMVAQEISSTSLELCEFEVYGHQ 747
            D+S A+DGNR+   + G C  +    N WW V L   Y+VT +II  R DCC  RL+   ++   +S+    +G+       +      P    ++  FTRLV  R V V    ++  L+LCE EVYG++
Sbjct:   21 DASNAIDGNRESHYWAGSCIHTDQQTNPWWRVDLLDSYIVTSVIITNRGDCCPERLNGAEIHIG-NSLQDNGAGNPVVAVISHI-----PAGRSLTITFTRLVEGRYVTVVLPGANRILQLCEVEVYGYR 144          
BLAST of Si:ch211-215k15.4 vs. TrEMBL
Match: A0A3Q0T5M5 (Uncharacterized protein OS=Amphilophus citrinellus OX=61819 PE=4 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 8.745e-11
Identity = 65/203 (32.02%), Postives = 89/203 (43.84%), Query Frame = 1
Query:  265 IGF---TSSADLLLSGNKFTNSSSAYYFASTNTTWDSS-----KAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVYGHQFYHPNPMIYTLKPSL-----YVNASAILTTKTMS 834
            IGF    S  +L L G      SS Y FA+ +T +DS       A+DGNRD     G C  +      WW V L   Y++T + I  R DCC  RL+ L ++   +S++    G+               G S V+F   R+  R V +    S   L LCE EVYG    +P P    L   +     + +AS  LT K+MS
Sbjct:    3 IGFCYRLSGENLALQGK--ATQSSLYAFATQSTRYDSPLASAHNAIDGNRDSAFSAGSCTHTNEQTGPWWRVDLLESYIITSVFITNRGDCCQHRLNGLEIHVG-NSLNNEGLGNPKVGTVSEGHA----GDSNVTFT-DRVEGRYVTLTLPGSQRILTLCEVEVYG----YPAPTGEDLSHYIQCYEKWEDASCTLTRKSMS 193          
BLAST of Si:ch211-215k15.4 vs. TrEMBL
Match: A0A3Q0TDF0 (Uncharacterized protein OS=Amphilophus citrinellus OX=61819 PE=4 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 3.034e-10
Identity = 61/196 (31.12%), Postives = 86/196 (43.88%), Query Frame = 1
Query:  277 SSADLLLSGNKFTNSSSAYYFASTNTTWDSS-----KAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVYGHQFYHPNPMIYTLKPSL-----YVNASAILTTKTMS 834
            +  +L L G      SS Y FA+ +T +DS       A+DGNRD     G C  +      WW V L   Y++T + I  R DCC  RL+ L ++   +S++    G+               G S V+F   R+  R V +    S   L LCE EVYG    +P P    L   +     + +AS  LT K+MS
Sbjct:   16 AEENLALQGK--ATQSSLYAFATQSTRYDSPLASAHNAIDGNRDSAFSAGSCTHTNEQTGPWWRVDLLESYIITSVFITNRGDCCQHRLNGLEIHVG-NSLNNEGLGNPKVGTVSEGHA----GDSNVTFT-DRVEGRYVTLTLPGSQRILTLCEVEVYG----YPAPTGEDLSHYIQCYEKWEDASCTLTRKSMS 199          
BLAST of Si:ch211-215k15.4 vs. TrEMBL
Match: A0A5E6NCZ1 (F5/8 type C domain-containing protein OS=uncultured Gammaproteobacteria bacterium OX=86473 GN=BSPWISOXPB_5830 PE=4 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 4.031e-10
Identity = 57/176 (32.39%), Postives = 78/176 (44.32%), Query Frame = 1
Query:  232 MNLLKFLFAFGIGFTSSADLLLSGNKFTNSSSAYYFASTNTTWDSSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGP-PAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVYGHQFYH 756
            M LL  + A G+G   +A+L L   K    SS Y + S N    +  AVDGN DG   N     +      WW V L G   + +IIIY RTDCC  RLS   +     SIS     S+  Y+  ++  P P     ++  + +    R V + Q + S  L L E +V G    H
Sbjct:    1 MTLLTVVIAVGVG---TANLAL--RKHATQSSTYLYHSINPV--AGYAVDGNTDGYFLNKSTTHTKYEQGAWWQVDLGGQKNIKQIIIYNRTDCCADRLSNYQV-----SISDKADFSTHTYQQDFHVAPNPK---KIIQLDASGKQGRYVRI-QLLDSDYLSLAEVQVMGVDPLH 160          
BLAST of Si:ch211-215k15.4 vs. TrEMBL
Match: A0A1S3JYD2 (uncharacterized protein LOC106177245 OS=Lingula unguis OX=7574 GN=LOC106177245 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 5.848e-10
Identity = 62/218 (28.44%), Postives = 98/218 (44.95%), Query Frame = 1
Query:  295 LSGNKFTNSSSAYYFASTNTTWDSSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYA--SYDSISQVTSGSSSFYEFQY---YQGPPAPGISVVSFNFTRLVARTVMVAQEISSTS-LELCEFEVYGHQFYHPNPMIYTLKPSLYVNASAILTTKTMSVVKCSKICLETVNCVSFTLTSNG----TCEIF 918
            L+  K  N SS Y+      T D+  AVDGN D V+ +G C ++     +WWLV L+    V  +II  R DCC+ RL+   +    SY++       +SSF +++    Y G    G + +S   + L  R V++ +  S  S L+LCE EV+G            +      +   I T    S+ +CS  C++   C +  +   G     CE+ 
Sbjct:   26 LAKGKPANQSSTYH------TCDARLAVDGNYDDVLSHGSCSNTNGGQGQWWLVDLETTARVAGVIITNRGDCCSDRLNNFEVRVGTSYEN-------NSSFTQYKLCASYPGVAPVGTTSLSCG-SPLRGRYVLIIKVGSDYSYLQLCEVEVHG---ISSATTFQQVAADARASLVPISTLNVRSLTECSISCMQHWKCAAINVLCAGNDQCVCELL 226          
BLAST of Si:ch211-215k15.4 vs. Ensembl Cavefish
Match: ENSAMXT00000056118.1 (fucolectin-4-like [Source:NCBI gene;Acc:103037148])

HSP 1 Score: 58.9214 bits (141), Expect = 3.470e-10
Identity = 43/131 (32.82%), Postives = 63/131 (48.09%), Query Frame = 1
Query:  370 KAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTL------SLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVYGH 744
             A+DGN +   ++G C  + + NN WW V L   Y +T I I  R DCC +R++        SLY + +S ++V   SS             PG S V+F  + +  R + V     +  L LCE EVYG+
Sbjct:   48 NAIDGNPNSNYHDGSCSHTSTQNNPWWRVDLLYKYKITSITITNRGDCCANRINGAEIRVGNSLYNNGNSNTRVAVVSSIL-----------PGKS-VTFKLSNISGRYINVILPGYNRILTLCEVEVYGY 166          
BLAST of Si:ch211-215k15.4 vs. Ensembl Cavefish
Match: ENSAMXT00000035078.1 (pep primary_assembly:Astyanax_mexicanus-2.0:2:30955763:30962150:-1 gene:ENSAMXG00000041548.1 transcript:ENSAMXT00000035078.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 1.147e-9
Identity = 46/178 (25.84%), Postives = 73/178 (41.01%), Query Frame = 1
Query:  322 SSAYYFASTNTTWDSSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVYGHQFYHPNPMIYTLKPSLYVNASAILTTKTMSVVKCSKI 855
            S A   ++ N   D+  AVDGN D     G C  +    + W  V L GVY +T + I+ R DCC+ R     ++ +   I      + +  +     GP    + + ++ F     R V +        L LCE +VY  + + P       K  L  +  A+  T T S +  S+I
Sbjct:   28 SRAVQSSTYNELADAEHAVDGNIDSNYMRGSCTHTMPETDPWLRVELPGVYKITSVTIFNRGDCCSER-----IHGAQVRIGNSLKNNGNENKIVAVIGPMGSEV-IKTYKFKATEGRFVNIFLPGQRKILTLCEVKVYADEIFDPKSFYLHDKEDL--DNIALRGTATQSSLHSSEI 197          

HSP 2 Score: 48.9062 bits (115), Expect = 3.577e-6
Identity = 34/133 (25.56%), Postives = 56/133 (42.11%), Query Frame = 1
Query:  373 AVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVS---------FNFTRLVART-VMVAQEISSTSLELCEFEVYG 741
            A+DGNR+  +  G C  +    + WW + L   YV++ + +  R DCC+  +    +    DS+                +G   P  ++VS         +N T L+  + V V       +L LCE EV+G
Sbjct:  207 AIDGNRNSDLMKGSCMRTQQETSPWWRLSLPRRYVISSVALTNRGDCCSEHVDGAEIRIG-DSLEN--------------EGKDNPLCTIVSSIPAGQTEHYNCTDLLEGSYVTVVLPGEERTLSLCEVEVFG 324          
BLAST of Si:ch211-215k15.4 vs. Ensembl Cavefish
Match: ENSAMXT00000008051.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000995.1:49634:61503:-1 gene:ENSAMXG00000007830.2 transcript:ENSAMXT00000008051.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 3.169e-9
Identity = 40/132 (30.30%), Postives = 60/132 (45.45%), Query Frame = 1
Query:  367 SKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLV-ARTVMVAQEISSTSLELCEFEVYGHQFYHP 759
            SKA+D N+D   + G C  +    N WW V L   + +T I+I  R DCC  RL    ++   +S+    +G+      +       P     +F+  + V  R V +    S+  L LCE EV+G   YHP
Sbjct:  195 SKAIDKNKDTNYHQGSCTHTVIQQNPWWRVDLLDEFTITSIVITNRGDCCAGRLEGAEIHVG-NSLINNGNGNPRVEVIKSI-----PAGKSQTFHLKKEVSGRYVNLIIPGSNQILTLCEVEVFG---YHP 317          

HSP 2 Score: 52.7582 bits (125), Expect = 3.436e-7
Identity = 43/160 (26.88%), Postives = 66/160 (41.25%), Query Frame = 1
Query:  370 KAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYA----SYDS--------ISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVYGHQFYHPNPMIYTLKPSLYVNASAI 813
            KA+DG        G C  + + +N WW + L   Y+VT + +  R DCC+ RL+   +      S D         IS +++G S    F   QG     ++V+     R+               L LCE EV+G   YHP+  +  L P      S++
Sbjct:   50 KAIDGKTTSEYSQGSCTHTETQDNPWWRLDLQDEYIVTSVTVTNRGDCCSERLNGAEIRIGNSLSNDGNSNPRVGVISSISAGKSQ--TFTLNQGVSGRYVNVIIPGKKRI---------------LTLCEVEVFG---YHPS-QVKNLAPRGKATQSSL 188          
BLAST of Si:ch211-215k15.4 vs. Ensembl Cavefish
Match: ENSAMXT00000041629.1 (pep primary_assembly:Astyanax_mexicanus-2.0:2:30955763:30962150:-1 gene:ENSAMXG00000041548.1 transcript:ENSAMXT00000041629.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 3.806e-9
Identity = 51/194 (26.29%), Postives = 78/194 (40.21%), Query Frame = 1
Query:  274 TSSADLLLSGNKFTNSSSAYYFASTNTTWDSSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVYGHQFYHPNPMIYTLKPSLYVNASAILTTKTMSVVKCSKI 855
            T+S + L  G K   SS+  +        D++ AVDGN +       C  ++S NN W  V L  VY VT + I  R DCC  R++   +      I        +  +     GP    + + ++ F     R V +        L LCE +VY  + + P       K  L  +  A+  T T S +  S+I
Sbjct:   18 TASKENLALGAKAVQSSTYDFLG------DAANAVDGNSNTNYLKKSCSHTHSDNNPWLRVELPDVYNVTSVTIVNRKDCCGDRINGAQI-----RIGNSLDNKGNDNKLVAVIGPMGSEV-IKTYKFKATEGRFVNIFLPGQRKILTLCEVKVYADEIFDPKSFYLHDKEDL--DNIALRGTATQSSLHSSEI 197          

HSP 2 Score: 49.2914 bits (116), Expect = 2.937e-6
Identity = 34/133 (25.56%), Postives = 56/133 (42.11%), Query Frame = 1
Query:  373 AVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVS---------FNFTRLVART-VMVAQEISSTSLELCEFEVYG 741
            A+DGNR+  +  G C  +    + WW + L   YV++ + +  R DCC+  +    +    DS+                +G   P  ++VS         +N T L+  + V V       +L LCE EV+G
Sbjct:  207 AIDGNRNSDLMKGSCMRTQQETSPWWRLSLPRRYVISSVALTNRGDCCSEHVDGAEIRIG-DSLEN--------------EGKDNPLCTIVSSIPAGQTEHYNCTDLLEGSYVTVVLPGEERTLSLCEVEVFG 324          
BLAST of Si:ch211-215k15.4 vs. Ensembl Cavefish
Match: ENSAMXT00000052178.1 (pep primary_assembly:Astyanax_mexicanus-2.0:2:30955763:30962678:-1 gene:ENSAMXG00000041548.1 transcript:ENSAMXT00000052178.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 3.806e-9
Identity = 51/194 (26.29%), Postives = 78/194 (40.21%), Query Frame = 1
Query:  274 TSSADLLLSGNKFTNSSSAYYFASTNTTWDSSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVYGHQFYHPNPMIYTLKPSLYVNASAILTTKTMSVVKCSKI 855
            T+S + L  G K   SS+  +        D++ AVDGN +       C  ++S NN W  V L  VY VT + I  R DCC  R++   +      I        +  +     GP    + + ++ F     R V +        L LCE +VY  + + P       K  L  +  A+  T T S +  S+I
Sbjct:   18 TASKENLALGAKAVQSSTYDFLG------DAANAVDGNSNTNYLKKSCSHTHSDNNPWLRVELPDVYNVTSVTIVNRKDCCGDRINGAQI-----RIGNSLDNKGNDNKLVAVIGPMGSEV-IKTYKFKATEGRFVNIFLPGQRKILTLCEVKVYADEIFDPKSFYLHDKEDL--DNIALRGTATQSSLHSSEI 197          

HSP 2 Score: 49.2914 bits (116), Expect = 2.937e-6
Identity = 34/133 (25.56%), Postives = 56/133 (42.11%), Query Frame = 1
Query:  373 AVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVS---------FNFTRLVART-VMVAQEISSTSLELCEFEVYG 741
            A+DGNR+  +  G C  +    + WW + L   YV++ + +  R DCC+  +    +    DS+                +G   P  ++VS         +N T L+  + V V       +L LCE EV+G
Sbjct:  207 AIDGNRNSDLMKGSCMRTQQETSPWWRLSLPRRYVISSVALTNRGDCCSEHVDGAEIRIG-DSLEN--------------EGKDNPLCTIVSSIPAGQTEHYNCTDLLEGSYVTVVLPGEERTLSLCEVEVFG 324          
BLAST of Si:ch211-215k15.4 vs. Ensembl Nematostella
Match: EDO42275 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1W6])

HSP 1 Score: 59.6918 bits (143), Expect = 2.960e-11
Identity = 43/125 (34.40%), Postives = 55/125 (44.00%), Query Frame = 1
Query:  364 SSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVY 738
            S  AVDG R G   +  C S+    N WW V L   YV+ R  I  R DCC  RL    +    DS+  V +G+ +      Y  P   G S+     T L  R V +  +    S+ LCE EVY
Sbjct:    1 SKHAVDGIRSGNYKDKSCASTARQTNPWWRVDLQKSYVILRFFIVNRADCCGERLDNFEIRIG-DSL--VNNGNDNPSCGSSYIIPQGRGKSIAC--HTLLKGRYVNIRIQGPDRSVTLCEVEVY 120          
BLAST of Si:ch211-215k15.4 vs. Ensembl Nematostella
Match: EDO40750 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6H5])

HSP 1 Score: 60.077 bits (144), Expect = 3.825e-11
Identity = 42/125 (33.60%), Postives = 56/125 (44.80%), Query Frame = 1
Query:  364 SSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVY 738
            S+ AVDGNR G  Y   C S+ +  N WW V L   +V  R+ +  R DCC  RL    +    DS+  V  G+ +      Y  P   G ++     T L  R V +  +     L LCE EVY
Sbjct:   24 SNHAVDGNRSGNYYQKSCSSTTAQTNPWWRVDLQKSHVNLRLFVVNRADCCGERLDNFEIRIG-DSL--VNDGNDNPSCGSSYIIPQGRGNTIAC--HTLLKGRYVNIWIQGPDKVLTLCEVEVY 143          
BLAST of Si:ch211-215k15.4 vs. Ensembl Nematostella
Match: EDO34462 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPB1])

HSP 1 Score: 56.9954 bits (136), Expect = 3.443e-10
Identity = 40/130 (30.77%), Postives = 54/130 (41.54%), Query Frame = 1
Query:  364 SSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFN-----FTRLVARTVMVAQEISSTSLELCEFEVY 738
            +  AVDGNR+G  ++  C  +   +N WW V L   YV+ R+ I  R DCC  RL    +    DS+           E      P   G  ++  N      T L  R V +     +  L LCE EVY
Sbjct:   11 AEHAVDGNRNGRYFDLSCTETKVQSNPWWRVDLQKSYVILRLFIVNRADCCNHRLDNFEIRIG-DSL-----------ENNGNDNPTCGGSYIIPKNGSIACHTLLKGRYVNIWIPGPNRLLTLCEVEVY 128          
BLAST of Si:ch211-215k15.4 vs. Ensembl Nematostella
Match: EDO25871 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TDH1])

HSP 1 Score: 54.6842 bits (130), Expect = 1.965e-9
Identity = 39/125 (31.20%), Postives = 52/125 (41.60%), Query Frame = 1
Query:  364 SSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVY 738
            +  AVDG+R G   +  C  +   +N WW V L   YV+ R+ I  R DCC  RL    +       +  T   S    +      P  G   +S + T L  R V +    S   L LCE EVY
Sbjct:    3 AEHAVDGDRSGRFADLSCTETKVQSNPWWRVDLQKSYVILRLFIVNRADCCGERLDNFEIRIGDSLENNGTDNPSCGSSYII----PHGGSKSISCH-TLLKGRYVNIWIPGSDRRLTLCEVEVY 122          
BLAST of Si:ch211-215k15.4 vs. Ensembl Nematostella
Match: EDO33194 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSX9])

HSP 1 Score: 53.1434 bits (126), Expect = 4.795e-9
Identity = 39/124 (31.45%), Postives = 51/124 (41.13%), Query Frame = 1
Query:  364 SSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEV 735
            +  AVDGNR G   +  C  +   +N WW V L   YV+ R+ I  R DCC  RL    +       +  T   S    +      P  G   +S + T L  R V +    S   L LCE EV
Sbjct:    1 AEHAVDGNRSGRFSDLSCTETKVQSNPWWRVDLQKSYVILRLFIVNRADCCGERLDNFEIRIGDSLENNGTDNPSCGSSYII----PHGGSKSISCH-TLLKGRYVNIWIPGSDRRLTLCEVEV 119          
BLAST of Si:ch211-215k15.4 vs. Planmine SMEST
Match: SMESG000011037.1 (SMESG000011037.1)

HSP 1 Score: 396.741 bits (1018), Expect = 2.398e-140
Identity = 204/241 (84.65%), Postives = 206/241 (85.48%), Query Frame = 1
Query:  232 MNLLKFLFAFGIGFTSSADLLLSGNKFTNSSSAYYFASTNTTWDSSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVYGHQFYHPNPMIYTLKPSLYVNASAILTTKTMSVVKCSKICLETVNCVSFTLTSNGTCEIFSHAGGVYSMIPE 954
            MNLLKFLFAFGIGFTSSADLLLSGNKFTNSSSAYYFASTNTTWDSSKAVDGN DGVIYNGHCFSSYSSN+KWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRL                                 +I TLKPSLYVNASAILTTKTMSVVKCSKICLETVNCVSFTLTSNGTCEIFSHAGGVYSMIPE
Sbjct:    1 MNLLKFLFAFGIGFTSSADLLLSGNKFTNSSSAYYFASTNTTWDSSKAVDGNMDGVIYNGHCFSSYSSNDKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRL---------------------------------LIDTLKPSLYVNASAILTTKTMSVVKCSKICLETVNCVSFTLTSNGTCEIFSHAGGVYSMIPE 208          
BLAST of Si:ch211-215k15.4 vs. Planmine SMEST
Match: SMESG000024841.1 (SMESG000024841.1)

HSP 1 Score: 314.309 bits (804), Expect = 3.926e-108
Identity = 149/182 (81.87%), Postives = 164/182 (90.11%), Query Frame = 1
Query:  406 NGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVYGHQFYHPNPMIYTLKPSLYVNASAILTTKTMSVVKCSKICLETVNCVSFTLTSNGTCEIFSHAGGVYSMIP 951
             GHCFSSYSS ++WWLVVLD  YVVT+I IYARTDCCT+RLSTLSLYASYDS+SQ+TSGSSSFYEFQY+QGPPA G SVVSFNFTRLVARTVMVAQ+ISSTS+ELCEFEVYGH FY PNP+IYT KP+LY  A AI   +TMSVVKCS++C ETVNCVSFTL SNGTCEIFSHAGG+YSMIP
Sbjct:    3 EGHCFSSYSSYDRWWLVVLDDAYVVTQITIYARTDCCTNRLSTLSLYASYDSVSQMTSGSSSFYEFQYFQGPPASGTSVVSFNFTRLVARTVMVAQKISSTSIELCEFEVYGHPFYQPNPIIYTSKPALYATAIAIRAFQTMSVVKCSQVCRETVNCVSFTLISNGTCEIFSHAGGIYSMIP 184          
BLAST of Si:ch211-215k15.4 vs. Planmine SMEST
Match: SMESG000011037.1 (SMESG000011037.1)

HSP 1 Score: 293.508 bits (750), Expect = 1.467e-100
Identity = 144/146 (98.63%), Postives = 145/146 (99.32%), Query Frame = 1
Query:  232 MNLLKFLFAFGIGFTSSADLLLSGNKFTNSSSAYYFASTNTTWDSSKAVDGNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLV 669
            MNLLKFLFAFGIGFTSSADLLLSGNKFTNSSSAYYFASTNTTWDSSKAVDGN DGVIYNGHCFSSYSSN+KWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLV
Sbjct:    1 MNLLKFLFAFGIGFTSSADLLLSGNKFTNSSSAYYFASTNTTWDSSKAVDGNMDGVIYNGHCFSSYSSNDKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLV 146          
BLAST of Si:ch211-215k15.4 vs. Planmine SMEST
Match: SMESG000046841.1 (SMESG000046841.1)

HSP 1 Score: 170.244 bits (430), Expect = 6.856e-51
Identity = 91/234 (38.89%), Postives = 136/234 (58.12%), Query Frame = 1
Query:  247 FLFAFGIGFTSSADLLLSGNKFTNSSSAYYFASTNTTWDSSKAVDGNRDGVIYNGHCFSSYSSNN-KWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVYGHQFYHPNPMI--YTLKPSLYVNASAILTTKTMSVVKCSKICLETVNCVSFTLTSNGTCEIFSHAGGVY 939
             LF F I  T++ + LLS  + T +++          W S KAVDGN DG + +GHC+ S   N+ KWWL++LD + VVTR++IY+RT+CCT R S LS Y SY + + +++ S+ F    YY G P PG  + + NFTRL ART+ +++  +     LCE EVYG+ F    PM   Y    S+Y +   I T   +S +  + ICL+   C+SF++  +  C I++H GG +
Sbjct:   12 LLFVFQI--TTAQNALLSRGRPTFAANV---IDNQPYWSSDKAVDGNYDGNMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRTECCTQRTSLLSFYVSYTNSTSLSTNSNDFTNVSYYPGSPPPGEFITTLNFTRLYARTLAISKPFAEQPFNLCELEVYGYPFIKTMPMTFKYLRALSIYDSLGNIGTFPVLSNLDSAMICLQEAKCISFSVQFSVKCFIYAHIGGEF 240          
BLAST of Si:ch211-215k15.4 vs. Planmine SMEST
Match: SMESG000024496.1 (SMESG000024496.1)

HSP 1 Score: 169.859 bits (429), Expect = 9.423e-51
Identity = 88/222 (39.64%), Postives = 134/222 (60.36%), Query Frame = 1
Query:  283 ADLLLSGNKFTNSSSAYYFASTN--TTWDSSKAVDGNRDGVIYNGHCFSSYSSN-NKWWLVVLDGVYVVTRIIIYARTDCCTSRLSTLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTVMVAQEISSTSLELCEFEVYGHQFYHPNPMIYTLKPS--LYVNASAILTTKTMSVVKCSKICLETVNCVSFTLTSNGTCEIFSHAGG 933
            +++LLS N+ TNSS+ Y     +   +   S AVDGN +G I    C+ S      KWWLV LD V V+TR++I++RTDCC +R S LS+Y SY++ +  ++ SS FY+  ++ GPP+     V+    R+V RT+++ + I   ++  CE EVYG+ +Y  NP IY L  +  LY N  AI      S ++C+++C E  +CVSFT  +N  C +++HAGG
Sbjct:   17 SEILLSKNRITNSSNVYRTDEGDGIASMVPSNAVDGNTNGDIKQNSCYHSKGEMFEKWWLVCLDDVSVITRVVIHSRTDCCYNRTSFLSIYTSYENETNFSTFSSLFYQINFFPGPPSGDKLAVAILLRRVVGRTIVIFKPIKEEAINFCEVEVYGYPYYRSNPSIYKLLGTYPLYSNIPAIQYRTCRSSIECARVCKELESCVSFTFDNNRLCNVYNHAGG 238          
The following BLAST results are available for this feature:
BLAST of Si:ch211-215k15.4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-215k15.4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-215k15.4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-215k15.4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-215k15.41.832e-1030.22si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127... [more]
si:ch211-215k15.42.012e-1030.22si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127... [more]
si:ch73-359m17.23.395e-829.82si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-... [more]
si:ch73-359m17.23.464e-726.14si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-... [more]
si:ch73-359m17.22.013e-626.14si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-... [more]
back to top
BLAST of Si:ch211-215k15.4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fucolectin6.542e-926.52x-epilectin [Source:NCBI gene;Acc:100144955][more]
fucolectin8.621e-926.52x-epilectin [Source:NCBI gene;Acc:100144955][more]
fucolectin1.048e-826.52x-epilectin [Source:NCBI gene;Acc:100144955][more]
fucolectin1.304e-826.52x-epilectin [Source:NCBI gene;Acc:100144955][more]
ncapg24.861e-824.86non-SMC condensin II complex subunit G2 [Source:Xe... [more]
back to top
BLAST of Si:ch211-215k15.4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-215k15.4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7SIC1|FUCL_ANGAN7.931e-1033.08Fucolectin OS=Anguilla anguilla OX=7936 PE=1 SV=1[more]
sp|Q9I925|FUCL7_ANGJA1.498e-830.71Fucolectin-7 OS=Anguilla japonica OX=7937 PE=2 SV=... [more]
sp|Q9I929|FUCL3_ANGJA3.129e-829.77Fucolectin-3 OS=Anguilla japonica OX=7937 PE=2 SV=... [more]
sp|Q9I931|FUCL1_ANGJA3.170e-730.36Fucolectin-1 OS=Anguilla japonica OX=7937 PE=2 SV=... [more]
sp|Q9I930|FUCL2_ANGJA5.258e-730.53Fucolectin-2 OS=Anguilla japonica OX=7937 PE=2 SV=... [more]
back to top
BLAST of Si:ch211-215k15.4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P8NSG32.692e-1133.85Si:ch211-215k15.4 OS=Astatotilapia calliptera OX=8... [more]
A0A3Q0T5M58.745e-1132.02Uncharacterized protein OS=Amphilophus citrinellus... [more]
A0A3Q0TDF03.034e-1031.12Uncharacterized protein OS=Amphilophus citrinellus... [more]
A0A5E6NCZ14.031e-1032.39F5/8 type C domain-containing protein OS=unculture... [more]
A0A1S3JYD25.848e-1028.44uncharacterized protein LOC106177245 OS=Lingula un... [more]
back to top
BLAST of Si:ch211-215k15.4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000056118.13.470e-1032.82fucolectin-4-like [Source:NCBI gene;Acc:103037148][more]
ENSAMXT00000035078.11.147e-925.84pep primary_assembly:Astyanax_mexicanus-2.0:2:3095... [more]
ENSAMXT00000008051.23.169e-930.30pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000041629.13.806e-926.29pep primary_assembly:Astyanax_mexicanus-2.0:2:3095... [more]
ENSAMXT00000052178.13.806e-926.29pep primary_assembly:Astyanax_mexicanus-2.0:2:3095... [more]
back to top
BLAST of Si:ch211-215k15.4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-215k15.4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-215k15.4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO422752.960e-1134.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407503.825e-1133.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO344623.443e-1030.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO258711.965e-931.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331944.795e-931.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Si:ch211-215k15.4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-215k15.4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000011037.12.398e-14084.65SMESG000011037.1[more]
SMESG000024841.13.926e-10881.87SMESG000024841.1[more]
SMESG000011037.11.467e-10098.63SMESG000011037.1[more]
SMESG000046841.16.856e-5138.89SMESG000046841.1[more]
SMESG000024496.19.423e-5139.64SMESG000024496.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008372 ID=SMED30008372|Name=Si:ch211-215k15.4|organism=Schmidtea mediterranea sexual|type=transcript|length=1056bp
CTAATTCTTAAGGAAGATTTATTTTAAGAAAAGAAGCATTAAAATAAAAC
AAATTCTTCAAGATTTGTCCATCCAGAACTCAAACTTATTTCTTAAGCCC
CAATGAGAATCAGCAAATGGAAATGGGATTCGAGATTTGTCCGACAAATA
TTAATATGCCCATTCTTTCTCGCAATTTATTTTAACATATAATCAAAATT
TTGTGTTAGTATTTCTCTTTAGCAATTTGAGATGAATCTTTTGAAATTTC
TTTTTGCTTTTGGGATTGGGTTTACTTCATCGGCTGATCTTCTGCTATCT
GGAAATAAATTCACGAATTCGTCTTCAGCTTACTATTTCGCGTCCACTAA
TACTACCTGGGACTCGTCGAAAGCTGTAGACGGAAATAGGGATGGAGTTA
TTTATAACGGACATTGCTTTTCAAGTTATTCATCTAATAATAAATGGTGG
CTTGTCGTACTCGATGGTGTCTATGTTGTGACCCGGATCATCATTTACGC
AAGAACGGATTGCTGTACAAGCAGATTAAGCACCTTGTCGTTATATGCCA
GTTATGACAGCATCAGTCAGGTGACTTCAGGATCCTCTTCATTTTATGAA
TTTCAATACTATCAAGGTCCTCCCGCTCCAGGAATATCGGTGGTGTCTTT
TAATTTTACTAGATTGGTGGCGAGAACAGTAATGGTCGCACAGGAAATAT
CAAGCACTAGTTTAGAGTTATGTGAATTTGAGGTATATGGCCATCAGTTT
TATCACCCGAATCCAATGATCTACACGCTTAAACCTTCGCTTTATGTCAA
CGCCTCTGCGATTCTGACTACCAAAACGATGTCGGTTGTGAAATGCTCTA
AAATATGCCTAGAGACCGTCAATTGTGTTTCTTTTACTTTAACATCAAAT
GGAACATGTGAGATCTTCAGCCATGCAGGAGGGGTGTATTCAATGATTCC
GGAATGATAATTAAGCTATACTTTCAATAAAATGATTTATCTTTTTGTTC
ACTTTTTGATCTGATTTTGTTTATTTCAATATTTTCTTTATTTTGCATTT
TTATAC
back to top

protein sequence of SMED30008372-orf-1

>SMED30008372-orf-1 ID=SMED30008372-orf-1|Name=SMED30008372-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=242bp
MNLLKFLFAFGIGFTSSADLLLSGNKFTNSSSAYYFASTNTTWDSSKAVD
GNRDGVIYNGHCFSSYSSNNKWWLVVLDGVYVVTRIIIYARTDCCTSRLS
TLSLYASYDSISQVTSGSSSFYEFQYYQGPPAPGISVVSFNFTRLVARTV
MVAQEISSTSLELCEFEVYGHQFYHPNPMIYTLKPSLYVNASAILTTKTM
SVVKCSKICLETVNCVSFTLTSNGTCEIFSHAGGVYSMIPE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR006585FTP1
IPR000421FA58C
IPR008979Galactose-bd-like_sf
IPR003609Pan_app
Vocabulary: biological process
TermDefinition
GO:0001868regulation of complement activation, lectin pathway
GO:0010185regulation of cellular defense response
GO:0045088regulation of innate immune response
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0030246carbohydrate binding
GO:0042806fucose binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 21..173
e-value: 2.7E-26
score: 94.3
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 25..173
IPR000421Coagulation factor 5/8 C-terminal domainPFAMPF00754F5_F8_type_Ccoord: 32..111
e-value: 1.5E-7
score: 31.5
NoneNo IPR availablePANTHERPTHR45713FAMILY NOT NAMEDcoord: 69..172
NoneNo IPR availablePANTHERPTHR45713:SF6SI:CABZ01040626.2-RELATEDcoord: 24..170
NoneNo IPR availablePANTHERPTHR45713:SF6SI:CABZ01040626.2-RELATEDcoord: 69..172
NoneNo IPR availablePANTHERPTHR45713FAMILY NOT NAMEDcoord: 24..170
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.697
IPR003609PAN/Apple domainPROSITEPS50948PANcoord: 164..241
score: 7.347