transmembrane protein 120A

Overview
Nametransmembrane protein 120A
Smed IDSMED30008371
Length (bp)1173
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of transmembrane protein 120A (SMED30008371) t-SNE clustered cells

Violin plots show distribution of expression levels for transmembrane protein 120A (SMED30008371) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of transmembrane protein 120A (SMED30008371) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for transmembrane protein 120A (SMED30008371) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008371

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30008371SMESG000052598.1 dd_Smed_v4_3041_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008371SMESG000052598.1 dd_Smed_v4_3041_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008371SMESG000052598.1 dd_Smed_v4_3041_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of transmembrane protein 120A vs. Ensembl Human
Match: TMEM120B (transmembrane protein 120B [Source:HGNC Symbol;Acc:HGNC:32008])

HSP 1 Score: 297.745 bits (761), Expect = 2.162e-98
Identity = 147/326 (45.09%), Postives = 218/326 (66.87%), Query Frame = 3
Query:   72 MEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLK---STDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIH 1040
            +E  E+E  EL  E + L+E H  Y   ++ + + Q  C+  +  Q   +K L   L + K   S +  + ++++  ++K R+    ++   LP+KNG+YLN+V+G+VNV+LLS   KFAYK++YEKFKL +T +  +      F +  R+ D  F+FLLVWYYCTLTIRE IL+ NGSRIKGWW++ H++ T LSG+ML WP    Y +FR+QF+ +S++   VQF+QYYYQ+G LY++RALGER+ +D+TV+GF SWM++ LTF+LP LF  +F+QLYNA TL++++     +EW V V+A  FL L +GN LT L V+  K+ 
Sbjct:    5 LERCEREWHELEGEFQELQETHRIYKQKLEELAALQTLCSSSISKQKKHLKDLKLTLQRCKRHASREEAELVQQMAANIKERQDVFFDMEAYLPKKNGLYLNLVLGNVNVTLLSNQAKFAYKDEYEKFKLYLTIILLLGAVACRFVLHYRVTDEVFNFLLVWYYCTLTIRESILISNGSRIKGWWVSHHYVSTFLSGVMLTWPNGPIYQKFRNQFLAFSIFQSCVQFLQYYYQRGCLYRLRALGERNHLDLTVEGFQSWMWRGLTFLLPFLFCGHFWQLYNAVTLFELSSHEECREWQVFVLAFTFLILFLGNFLTTLKVVHAKLQ 330          
BLAST of transmembrane protein 120A vs. Ensembl Human
Match: TMEM120B (transmembrane protein 120B [Source:HGNC Symbol;Acc:HGNC:32008])

HSP 1 Score: 297.745 bits (761), Expect = 2.162e-98
Identity = 147/326 (45.09%), Postives = 218/326 (66.87%), Query Frame = 3
Query:   72 MEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLK---STDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIH 1040
            +E  E+E  EL  E + L+E H  Y   ++ + + Q  C+  +  Q   +K L   L + K   S +  + ++++  ++K R+    ++   LP+KNG+YLN+V+G+VNV+LLS   KFAYK++YEKFKL +T +  +      F +  R+ D  F+FLLVWYYCTLTIRE IL+ NGSRIKGWW++ H++ T LSG+ML WP    Y +FR+QF+ +S++   VQF+QYYYQ+G LY++RALGER+ +D+TV+GF SWM++ LTF+LP LF  +F+QLYNA TL++++     +EW V V+A  FL L +GN LT L V+  K+ 
Sbjct:    5 LERCEREWHELEGEFQELQETHRIYKQKLEELAALQTLCSSSISKQKKHLKDLKLTLQRCKRHASREEAELVQQMAANIKERQDVFFDMEAYLPKKNGLYLNLVLGNVNVTLLSNQAKFAYKDEYEKFKLYLTIILLLGAVACRFVLHYRVTDEVFNFLLVWYYCTLTIRESILISNGSRIKGWWVSHHYVSTFLSGVMLTWPNGPIYQKFRNQFLAFSIFQSCVQFLQYYYQRGCLYRLRALGERNHLDLTVEGFQSWMWRGLTFLLPFLFCGHFWQLYNAVTLFELSSHEECREWQVFVLAFTFLILFLGNFLTTLKVVHAKLQ 330          
BLAST of transmembrane protein 120A vs. Ensembl Human
Match: TMEM120A (transmembrane protein 120A [Source:HGNC Symbol;Acc:HGNC:21697])

HSP 1 Score: 276.559 bits (706), Expect = 4.445e-90
Identity = 152/323 (47.06%), Postives = 222/323 (68.73%), Query Frame = 3
Query:   87 KEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKST---DNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIHSR 1046
            ++ ++L ++ +N++E H  Y   ++ +   Q  C   +  Q  R+++L   L K K +   +     ++L+  +K R+    ++   LP+KNG+YL++V+G+VNV+LLSK  KFAYK++YEKFKL +T +  + +F   F + +R+ DAAF+FLLVWYYCTLTIRE IL+ NGSRIKGWW+  H++ T LSG+ML WP    Y +FR+QF+ +S+Y  FVQF+QYYYQ G LY++RALGERH MD+TV+GF SWM++ LTF+LP LFF +F+QL+NA TL+ +  D + KEW VL+    FL L +GN  T L V+  K HS+
Sbjct:   14 RDWEDLQQDFQNIQETHRLYRLKLEELTKLQNNCTSSITRQKKRLQELALALKKCKPSLPAEAEGAAQELENQMKERQGLFFDMEAYLPKKNGLYLSLVLGNVNVTLLSKQAKFAYKDEYEKFKLYLTIILILISFTCRFLLNSRVTDAAFNFLLVWYYCTLTIRESILINNGSRIKGWWVFHHYVSTFLSGVMLTWPDGLMYQKFRNQFLSFSMYQSFVQFLQYYYQSGCLYRLRALGERHTMDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLFNALTLFNLAQDPQCKEWQVLMCGFPFLLLFLGNFFTTLRVVHHKFHSQ 336          
BLAST of transmembrane protein 120A vs. Ensembl Human
Match: TMEM120A (transmembrane protein 120A [Source:HGNC Symbol;Acc:HGNC:21697])

HSP 1 Score: 273.092 bits (697), Expect = 2.501e-88
Identity = 139/293 (47.44%), Postives = 205/293 (69.97%), Query Frame = 3
Query:   87 KEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKST---DNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWH 956
            ++ ++L ++ +N++E H  Y   ++ +   Q  C   +  Q  R+++L   L K K +   +     ++L+  +K R+    ++   LP+KNG+YL++V+G+VNV+LLSK  KFAYK++YEKFKL +T +  + +F   F + +R+ DAAF+FLLVWYYCTLTIRE IL+ NGSRIKGWW+  H++ T LSG+ML WP    Y +FR+QF+ +S+Y  FVQF+QYYYQ G LY++RALGERH MD+TV+GF SWM++ LTF+LP LFF +F+QL+NA TL+ +  D + KEW 
Sbjct:   14 RDWEDLQQDFQNIQETHRLYRLKLEELTKLQNNCTSSITRQKKRLQELALALKKCKPSLPAEAEGAAQELENQMKERQGLFFDMEAYLPKKNGLYLSLVLGNVNVTLLSKQAKFAYKDEYEKFKLYLTIILILISFTCRFLLNSRVTDAAFNFLLVWYYCTLTIRESILINNGSRIKGWWVFHHYVSTFLSGVMLTWPDGLMYQKFRNQFLSFSMYQSFVQFLQYYYQSGCLYRLRALGERHTMDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLFNALTLFNLAQDPQCKEWQ 306          
BLAST of transmembrane protein 120A vs. Ensembl Human
Match: TMEM120B (transmembrane protein 120B [Source:HGNC Symbol;Acc:HGNC:32008])

HSP 1 Score: 226.483 bits (576), Expect = 7.105e-72
Identity = 106/236 (44.92%), Postives = 159/236 (67.37%), Query Frame = 3
Query:  123 LKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLK---STDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITV 821
            L+E H  Y   ++ + + Q  C+  +  Q   +K L   L + K   S +  + ++++  ++K R+    ++   LP+KNG+YLN+V+G+VNV+LLS   KFAYK++YEKFKL +T +  +      F +  R+ D  F+FLLVWYYCTLTIRE IL+ NGSRIKGWW++ H++ T LSG+ML WP    Y +FR+QF+ +S++   VQF+QYYYQ+G LY++RALGER+ +D+TV
Sbjct:    1 LQETHRIYKQKLEELAALQTLCSSSISKQKKHLKDLKLTLQRCKRHASREEAELVQQMAANIKERQDVFFDMEAYLPKKNGLYLNLVLGNVNVTLLSNQAKFAYKDEYEKFKLYLTIILLLGAVACRFVLHYRVTDEVFNFLLVWYYCTLTIRESILISNGSRIKGWWVSHHYVSTFLSGVMLTWPNGPIYQKFRNQFLAFSIFQSCVQFLQYYYQRGCLYRLRALGERNHLDLTV 236          
BLAST of transmembrane protein 120A vs. Ensembl Celegans
Match: M01G5.3 (pep chromosome:WBcel235:III:1468643:1517993:-1 gene:WBGene00019716.1 transcript:M01G5.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M01G5.3)

HSP 1 Score: 237.269 bits (604), Expect = 9.994e-75
Identity = 132/356 (37.08%), Postives = 207/356 (58.15%), Query Frame = 3
Query:   69 GMEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKS------------TDNLDKIEKLQEDLKSRKIYLREIGETLPRK-NGVYLNVVIG-HVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQ-INYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIHSRTT-RRIEYLIHKYHT 1088
              E+++ E   +  + + L++IH++Y+     V   Q+   + ++H  Y +K L   + + +             TD L  + KL+E+L    + +R++   LP + NG YLN+++G ++NVSLL+K +KF YK++YE FK S+T +  +     + +   R+ D+   FL+VWYYCTLTIRE +L +NGS+IKGWWL+ H++   + GI+L W     Y  FR  F++++ Y+  VQ  Q  YQ G L ++ +LG+ H+MDITV+GF SW FK LTF+LP L F Y YQLY AW L+   N +T    W V  ++L+   +A GNI+T   V  +K  + T+   I  L  KY +
Sbjct:    2 ATEKLDSEWKLVQDDFQKLEKIHDEYIQKSRQVSKFQETAGKAMKHHNYLLKNLKETMRQAQQSAEKLDEADTSKTDVLSHVAKLREELAVANLRIRDMQGELPAQTNGFYLNLILGSNLNVSLLTKAEKFKYKQEYEGFKWSITILICLLALCAWIW-PFRVFDSILCFLMVWYYCTLTIRESVLRVNGSKIKGWWLSHHYLSCAVPGIVLTWKDGLCYQEFRPYFLIFTFYISLVQLAQNQYQSGCLRRLHSLGQGHQMDITVEGFTSWQFKGLTFLLPFLAFGYLYQLYLAWKLFGYTNSETCDGIWQVWTLSLLLGLIAGGNIVTTSMVCIRKFKTSTSYTNIVTLTRKYSS 356          
BLAST of transmembrane protein 120A vs. Ensembl Fly
Match: CG32795 (gene:FBgn0040384 transcript:FBtr0070492)

HSP 1 Score: 307.375 bits (786), Expect = 7.707e-102
Identity = 154/332 (46.39%), Postives = 223/332 (67.17%), Query Frame = 3
Query:   72 MEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKS---TDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIHSRTTRR 1058
            ++ ++ E +ELNKE   L+  +  Y+  ++ + S Q+ C   ++HQ YRM Q+ + L + K     ++ +K++ L +    RK  L EI ++LP K+G YL +++G VNVS+L+++DK  YK+DYEKFKL +  +  I  FF   F   R L+ AF FLLVWYYCTLTIRE IL +NGSRIKGWW A HFI T  +G++L+WP  + +  FR QFM +++Y+  VQ++Q+ YQKG LY+++ALGERH MDIT++GF SWM++ L+F+LP LF  Y YQ YNAWTLY++ Y      WHV V++ +FL L +GN+ T L V+ +KI  R   R
Sbjct:    3 IDSLKNEWEELNKEFAELESCNRRYIELLEQLHSHQQICFNEIKHQRYRMNQITTSLRQFKGPVPAEDKEKVDDLHKMTLKRKAQLHEIEQSLPAKSGRYLQIILGDVNVSILNRNDKVRYKDDYEKFKLILNVIGLIMAFFNLIF-NYRALELAFIFLLVWYYCTLTIRESILKVNGSRIKGWWRAHHFISTVAAGVLLVWPQGEHWQIFRMQFMYFNVYISIVQYLQFGYQKGLLYRLKALGERHNMDITIEGFHSWMWRGLSFLLPFLFIGYGYQAYNAWTLYKLAYSPPDAPWHVSVMSGLFLLLFVGNMATTLWVVPEKIRERAKER 333          
BLAST of transmembrane protein 120A vs. Ensembl Fly
Match: CG32795 (gene:FBgn0040384 transcript:FBtr0070493)

HSP 1 Score: 307.375 bits (786), Expect = 7.707e-102
Identity = 154/332 (46.39%), Postives = 223/332 (67.17%), Query Frame = 3
Query:   72 MEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKS---TDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIHSRTTRR 1058
            ++ ++ E +ELNKE   L+  +  Y+  ++ + S Q+ C   ++HQ YRM Q+ + L + K     ++ +K++ L +    RK  L EI ++LP K+G YL +++G VNVS+L+++DK  YK+DYEKFKL +  +  I  FF   F   R L+ AF FLLVWYYCTLTIRE IL +NGSRIKGWW A HFI T  +G++L+WP  + +  FR QFM +++Y+  VQ++Q+ YQKG LY+++ALGERH MDIT++GF SWM++ L+F+LP LF  Y YQ YNAWTLY++ Y      WHV V++ +FL L +GN+ T L V+ +KI  R   R
Sbjct:    3 IDSLKNEWEELNKEFAELESCNRRYIELLEQLHSHQQICFNEIKHQRYRMNQITTSLRQFKGPVPAEDKEKVDDLHKMTLKRKAQLHEIEQSLPAKSGRYLQIILGDVNVSILNRNDKVRYKDDYEKFKLILNVIGLIMAFFNLIF-NYRALELAFIFLLVWYYCTLTIRESILKVNGSRIKGWWRAHHFISTVAAGVLLVWPQGEHWQIFRMQFMYFNVYISIVQYLQFGYQKGLLYRLKALGERHNMDITIEGFHSWMWRGLSFLLPFLFIGYGYQAYNAWTLYKLAYSPPDAPWHVSVMSGLFLLLFVGNMATTLWVVPEKIRERAKER 333          
BLAST of transmembrane protein 120A vs. Ensembl Fly
Match: CG32795 (gene:FBgn0040384 transcript:FBtr0070491)

HSP 1 Score: 307.375 bits (786), Expect = 7.707e-102
Identity = 154/332 (46.39%), Postives = 223/332 (67.17%), Query Frame = 3
Query:   72 MEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKS---TDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIHSRTTRR 1058
            ++ ++ E +ELNKE   L+  +  Y+  ++ + S Q+ C   ++HQ YRM Q+ + L + K     ++ +K++ L +    RK  L EI ++LP K+G YL +++G VNVS+L+++DK  YK+DYEKFKL +  +  I  FF   F   R L+ AF FLLVWYYCTLTIRE IL +NGSRIKGWW A HFI T  +G++L+WP  + +  FR QFM +++Y+  VQ++Q+ YQKG LY+++ALGERH MDIT++GF SWM++ L+F+LP LF  Y YQ YNAWTLY++ Y      WHV V++ +FL L +GN+ T L V+ +KI  R   R
Sbjct:    3 IDSLKNEWEELNKEFAELESCNRRYIELLEQLHSHQQICFNEIKHQRYRMNQITTSLRQFKGPVPAEDKEKVDDLHKMTLKRKAQLHEIEQSLPAKSGRYLQIILGDVNVSILNRNDKVRYKDDYEKFKLILNVIGLIMAFFNLIF-NYRALELAFIFLLVWYYCTLTIRESILKVNGSRIKGWWRAHHFISTVAAGVLLVWPQGEHWQIFRMQFMYFNVYISIVQYLQFGYQKGLLYRLKALGERHNMDITIEGFHSWMWRGLSFLLPFLFIGYGYQAYNAWTLYKLAYSPPDAPWHVSVMSGLFLLLFVGNMATTLWVVPEKIRERAKER 333          
BLAST of transmembrane protein 120A vs. Ensembl Fly
Match: CG32795 (gene:FBgn0040384 transcript:FBtr0309881)

HSP 1 Score: 307.375 bits (786), Expect = 7.707e-102
Identity = 154/332 (46.39%), Postives = 223/332 (67.17%), Query Frame = 3
Query:   72 MEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKS---TDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIHSRTTRR 1058
            ++ ++ E +ELNKE   L+  +  Y+  ++ + S Q+ C   ++HQ YRM Q+ + L + K     ++ +K++ L +    RK  L EI ++LP K+G YL +++G VNVS+L+++DK  YK+DYEKFKL +  +  I  FF   F   R L+ AF FLLVWYYCTLTIRE IL +NGSRIKGWW A HFI T  +G++L+WP  + +  FR QFM +++Y+  VQ++Q+ YQKG LY+++ALGERH MDIT++GF SWM++ L+F+LP LF  Y YQ YNAWTLY++ Y      WHV V++ +FL L +GN+ T L V+ +KI  R   R
Sbjct:    3 IDSLKNEWEELNKEFAELESCNRRYIELLEQLHSHQQICFNEIKHQRYRMNQITTSLRQFKGPVPAEDKEKVDDLHKMTLKRKAQLHEIEQSLPAKSGRYLQIILGDVNVSILNRNDKVRYKDDYEKFKLILNVIGLIMAFFNLIF-NYRALELAFIFLLVWYYCTLTIRESILKVNGSRIKGWWRAHHFISTVAAGVLLVWPQGEHWQIFRMQFMYFNVYISIVQYLQFGYQKGLLYRLKALGERHNMDITIEGFHSWMWRGLSFLLPFLFIGYGYQAYNAWTLYKLAYSPPDAPWHVSVMSGLFLLLFVGNMATTLWVVPEKIRERAKER 333          
BLAST of transmembrane protein 120A vs. Ensembl Fly
Match: CG32795 (gene:FBgn0040384 transcript:FBtr0345318)

HSP 1 Score: 307.375 bits (786), Expect = 7.707e-102
Identity = 154/332 (46.39%), Postives = 223/332 (67.17%), Query Frame = 3
Query:   72 MEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKS---TDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIHSRTTRR 1058
            ++ ++ E +ELNKE   L+  +  Y+  ++ + S Q+ C   ++HQ YRM Q+ + L + K     ++ +K++ L +    RK  L EI ++LP K+G YL +++G VNVS+L+++DK  YK+DYEKFKL +  +  I  FF   F   R L+ AF FLLVWYYCTLTIRE IL +NGSRIKGWW A HFI T  +G++L+WP  + +  FR QFM +++Y+  VQ++Q+ YQKG LY+++ALGERH MDIT++GF SWM++ L+F+LP LF  Y YQ YNAWTLY++ Y      WHV V++ +FL L +GN+ T L V+ +KI  R   R
Sbjct:    3 IDSLKNEWEELNKEFAELESCNRRYIELLEQLHSHQQICFNEIKHQRYRMNQITTSLRQFKGPVPAEDKEKVDDLHKMTLKRKAQLHEIEQSLPAKSGRYLQIILGDVNVSILNRNDKVRYKDDYEKFKLILNVIGLIMAFFNLIF-NYRALELAFIFLLVWYYCTLTIRESILKVNGSRIKGWWRAHHFISTVAAGVLLVWPQGEHWQIFRMQFMYFNVYISIVQYLQFGYQKGLLYRLKALGERHNMDITIEGFHSWMWRGLSFLLPFLFIGYGYQAYNAWTLYKLAYSPPDAPWHVSVMSGLFLLLFVGNMATTLWVVPEKIRERAKER 333          
BLAST of transmembrane protein 120A vs. Ensembl Zebrafish
Match: tmem120a (transmembrane protein 120A [Source:NCBI gene;Acc:100005623])

HSP 1 Score: 288.886 bits (738), Expect = 4.209e-95
Identity = 154/325 (47.38%), Postives = 223/325 (68.62%), Query Frame = 3
Query:   69 GMEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKST---DNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQK 1034
            G+ E  +E ++L K+ + +++ H  Y + ++ V   Q+ C+  +  Q  ++K L+  L + K     ++++KI+ +QE +K R     E+   LP+KNG+YL++V+G+VNV+LL+K  KFAYK++YEKFKL +T +   ++F   F +  R++DA F+FLLVWYYCTLTIRE IL+ NGS+IKGWW+  H++ T LSG+ML WP  + Y  FR+QF+ YS+Y+ FVQF QYYYQ G LY++RALGERH MD+TV+GF SWM++ LTF+LP LF  +F+QLYN  TL+Q+      KEW VL+    FL L MGN  T L V+  K
Sbjct:    7 GLTECLQEWEDLEKDYQQIQDTHRHYKHKLEEVSKLQESCSSSIARQRKKLKDLSESLEECKGAVNPEDVNKIDDIQESIKERPNVFFEMEAFLPKKNGLYLSLVLGNVNVTLLNKQSKFAYKDEYEKFKLYLTVLLLFFSFTCRFLVSYRVVDALFNFLLVWYYCTLTIRESILINNGSKIKGWWVFQHYVSTFLSGVMLTWPDGELYQMFRNQFLSYSMYINFVQFFQYYYQSGCLYRLRALGERHNMDLTVEGFQSWMWRGLTFLLPFLFLGHFFQLYNGITLFQMTQLPEWKEWQVLMCGSTFLVLFMGNFFTTLGVVYHK 331          
BLAST of transmembrane protein 120A vs. Ensembl Zebrafish
Match: tmem120b (transmembrane protein 120B [Source:NCBI gene;Acc:798580])

HSP 1 Score: 274.248 bits (700), Expect = 1.934e-89
Identity = 152/326 (46.63%), Postives = 215/326 (65.95%), Query Frame = 3
Query:   69 GMEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKSTDN---LDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKI 1037
             +E  + E  E+ +E + L+E H  Y   ++ + + Q  C+  +  Q   +K L   L K K + N    + I  LQ  +K R+    ++   LP++NG+YLN+V+G+VNV+LLS   KFAYK++YEKFKL +T +         F +  R+ D  F+FLLVWYYCTLTIRE IL  NGSRIKGWW++ H++ T LSG+ML WP    Y  FR QF+ +S+Y   VQF+QYYYQ G LY++RALGER+++D+TV+GF SWM++ LTF+LP LFF +F+QLYNA TL++++     KEW V ++AL FL L +GN LT L V+ QK+
Sbjct:    2 SLERCQSEWTEIEQEYQQLQETHKVYRQKLEELTNLQAICSSAISKQRKGLKDLKQSLYKCKKSCNGKDSEVINDLQVQIKERQNVFFDMEAYLPKRNGLYLNLVLGNVNVTLLSNQAKFAYKDEYEKFKLYMTIILMFGAVTCLFLLNYRVTDEIFNFLLVWYYCTLTIRESILRSNGSRIKGWWVSHHYVSTFLSGVMLTWPEGPMYQMFRSQFLAFSIYQSCVQFLQYYYQSGCLYRLRALGERNQLDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLYNAVTLFRLSALDDCKEWQVFMLALTFLVLFLGNFLTTLKVVHQKL 327          
BLAST of transmembrane protein 120A vs. Ensembl Zebrafish
Match: tmem120b (transmembrane protein 120B [Source:NCBI gene;Acc:798580])

HSP 1 Score: 274.248 bits (700), Expect = 1.934e-89
Identity = 152/326 (46.63%), Postives = 215/326 (65.95%), Query Frame = 3
Query:   69 GMEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKSTDN---LDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKI 1037
             +E  + E  E+ +E + L+E H  Y   ++ + + Q  C+  +  Q   +K L   L K K + N    + I  LQ  +K R+    ++   LP++NG+YLN+V+G+VNV+LLS   KFAYK++YEKFKL +T +         F +  R+ D  F+FLLVWYYCTLTIRE IL  NGSRIKGWW++ H++ T LSG+ML WP    Y  FR QF+ +S+Y   VQF+QYYYQ G LY++RALGER+++D+TV+GF SWM++ LTF+LP LFF +F+QLYNA TL++++     KEW V ++AL FL L +GN LT L V+ QK+
Sbjct:    2 SLERCQSEWTEIEQEYQQLQETHKVYRQKLEELTNLQAICSSAISKQRKGLKDLKQSLYKCKKSCNGKDSEVINDLQVQIKERQNVFFDMEAYLPKRNGLYLNLVLGNVNVTLLSNQAKFAYKDEYEKFKLYMTIILMFGAVTCLFLLNYRVTDEIFNFLLVWYYCTLTIRESILRSNGSRIKGWWVSHHYVSTFLSGVMLTWPEGPMYQMFRSQFLAFSIYQSCVQFLQYYYQSGCLYRLRALGERNQLDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLYNAVTLFRLSALDDCKEWQVFMLALTFLVLFLGNFLTTLKVVHQKL 327          
BLAST of transmembrane protein 120A vs. Ensembl Zebrafish
Match: zgc:103681 (zgc:103681 [Source:ZFIN;Acc:ZDB-GENE-041010-17])

HSP 1 Score: 270.781 bits (691), Expect = 5.197e-88
Identity = 144/324 (44.44%), Postives = 210/324 (64.81%), Query Frame = 3
Query:  108 KELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLK---STDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIHSRTTRRIEYL 1070
            KE + L+E H  Y+  ++ V   QK  A  L  Q   +K+    L+KL    + +  + +++ ++ +++    + ++   LP+KNG+YL++V+G VNV+L SKD K  YK++YE+FKL VT   F+  F   FF+  R LDA  +FLLVWYYCTLTIRE IL+ NGSRIKGWW+  H+I T LSG+ML WP  ++Y  FR QF+ Y LY  FVQ++QYYYQ G LY+++ALGERH +D+TV+GF SWM++ LTF+LP LF  +F+Q  N ++L+++      +EW V +    F+ L  GN  T L V++   H R T+R + L
Sbjct:   17 KEFQQLQETHRLYLQKLEEVSKLQKSFAASLARQKKNLKENLKSLIKLNKGLTEEESNAVKEAKDHIRNMPSQIFQMEAFLPKKNGIYLSLVLGSVNVNLPSKDAKAEYKDEYERFKLYVTVTHFLLTFICCFFVNYRFLDALLNFLLVWYYCTLTIRESILISNGSRIKGWWVFHHYISTFLSGVMLTWPDGETYQSFRTQFLAYCLYQSFVQYLQYYYQSGCLYRLKALGERHNLDLTVEGFQSWMWRGLTFLLPFLFLGHFWQFCNGFSLFRLARLPECREWQVSMCGFCFMVLFAGNFFTTLAVVQ---HKRKTQRTKSL 337          
BLAST of transmembrane protein 120A vs. Ensembl Zebrafish
Match: tmem120b (transmembrane protein 120B [Source:NCBI gene;Acc:798580])

HSP 1 Score: 264.618 bits (675), Expect = 8.003e-86
Identity = 148/307 (48.21%), Postives = 205/307 (66.78%), Query Frame = 3
Query:  126 KEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKSTDN---LDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKI 1037
            KE H  Y   ++ + + Q  C+  +  Q   +K L   L K K + N    + I  LQ  +K R+    ++   LP++NG+YLN+V+G+VNV+LLS   KFAYK++YEKFKL +T +         F +  R+ D  F+FLLVWYYCTLTIRE IL  NGSRIKGWW++ H++ T LSG+ML WP    Y  FR QF+ +S+Y   VQF+QYYYQ G LY++RALGER+++D+TV+GF SWM++ LTF+LP LFF +F+QLYNA TL++++     KEW V ++AL FL L +GN LT L V+ QK+
Sbjct:    7 KETHKVYRQKLEELTNLQAICSSAISKQRKGLKDLKQSLYKCKKSCNGKDSEVINDLQVQIKERQNVFFDMEAYLPKRNGLYLNLVLGNVNVTLLSNQAKFAYKDEYEKFKLYMTIILMFGAVTCLFLLNYRVTDEIFNFLLVWYYCTLTIRESILRSNGSRIKGWWVSHHYVSTFLSGVMLTWPEGPMYQMFRSQFLAFSIYQSCVQFLQYYYQSGCLYRLRALGERNQLDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLYNAVTLFRLSALDDCKEWQVFMLALTFLVLFLGNFLTTLKVVHQKL 313          
BLAST of transmembrane protein 120A vs. Ensembl Xenopus
Match: magoh (mago homolog, exon junction complex subunit [Source:Xenbase;Acc:XB-GENE-493540])

HSP 1 Score: 286.189 bits (731), Expect = 6.253e-94
Identity = 152/331 (45.92%), Postives = 224/331 (67.67%), Query Frame = 3
Query:   69 GMEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKST-----DNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIHSR 1046
             +++  ++  EL +  ++++E H  Y   ++ +   Q +C+  +  Q  ++K+L+ +L K KS+     +  ++I  L   ++ R+    E+   LP+KNG+YL++V+G+VNV+LLSK  KFAYK++YEKFKL +T +  + +F   F + +R+ DA F+FLLVWYYCTLTIRE IL+ NGSRIKGWW+ +H+I T LSG+ML WP    Y  FR+QF+ +S+Y  FVQF+QYYYQ G LY++RALGERH MD+TV+GF SWM++ LTF+LP LFF  F+QLYNA TL+++      KEW V++  L FL   +GN  T L V+ QK   +
Sbjct:    5 ALQDCVRDWGELQENYQDIQETHRLYKQKLEELAKLQTRCSGTIARQKKKLKELSVELKKYKSSVKNVEEEEEQISVLNNQIRIREKTFFEMESFLPKKNGLYLSLVLGNVNVTLLSKQSKFAYKDEYEKFKLYLTMILMVLSFICRFVLNSRVTDAVFNFLLVWYYCTLTIRESILINNGSRIKGWWVLNHYISTFLSGVMLTWPDGLMYQMFRNQFLSFSMYQSFVQFLQYYYQSGCLYRLRALGERHNMDLTVEGFQSWMWRGLTFLLPFLFFGQFWQLYNAITLFKLARHPECKEWQVIMCGLPFLVHFLGNFFTTLRVVHQKFQKK 335          
BLAST of transmembrane protein 120A vs. Ensembl Xenopus
Match: magoh (mago homolog, exon junction complex subunit [Source:Xenbase;Acc:XB-GENE-493540])

HSP 1 Score: 285.804 bits (730), Expect = 9.145e-94
Identity = 152/331 (45.92%), Postives = 224/331 (67.67%), Query Frame = 3
Query:   69 GMEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKST-----DNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIHSR 1046
             +++  ++  EL +  ++++E H  Y   ++ +   Q +C+  +  Q  ++K+L+ +L K KS+     +  ++I  L   ++ R+    E+   LP+KNG+YL++V+G+VNV+LLSK  KFAYK++YEKFKL +T +  + +F   F + +R+ DA F+FLLVWYYCTLTIRE IL+ NGSRIKGWW+ +H+I T LSG+ML WP    Y  FR+QF+ +S+Y  FVQF+QYYYQ G LY++RALGERH MD+TV+GF SWM++ LTF+LP LFF  F+QLYNA TL+++      KEW V++  L FL   +GN  T L V+ QK   +
Sbjct:    5 ALQDCVRDWGELQENYQDIQETHRLYKQKLEELAKLQTRCSGTIARQKKKLKELSVELKKYKSSVKNVEEEEEQISVLNNQIRIREKTFFEMESFLPKKNGLYLSLVLGNVNVTLLSKQSKFAYKDEYEKFKLYLTMILMVLSFICRFVLNSRVTDAVFNFLLVWYYCTLTIRESILINNGSRIKGWWVLNHYISTFLSGVMLTWPDGLMYQMFRNQFLSFSMYQSFVQFLQYYYQSGCLYRLRALGERHNMDLTVEGFQSWMWRGLTFLLPFLFFGQFWQLYNAITLFKLARHPECKEWQVIMCGLPFLVHFLGNFFTTLRVVHQKFQKQ 335          
BLAST of transmembrane protein 120A vs. Ensembl Xenopus
Match: magoh (mago homolog, exon junction complex subunit [Source:Xenbase;Acc:XB-GENE-493540])

HSP 1 Score: 270.781 bits (691), Expect = 1.195e-88
Identity = 144/290 (49.66%), Postives = 201/290 (69.31%), Query Frame = 3
Query:  177 QKKCAEGLRHQTYRMKQLNSDLLKLKSTDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIHSR 1046
            Q +C+  +  Q  ++K+L+S        +  ++I  L   ++ R+    E+   LP+KNG+YL++V+G+VNV+LLSK  KFAYK++YEKFKL +T +  + +F   F + +R+ DA F+FLLVWYYCTLTIRE IL+ NGSRIKGWW+ +H+I T LSG+ML WP    Y  FR+QF+ +S+Y  FVQF+QYYYQ G LY++RALGERH MD+TV+GF SWM++ LTF+LP LFF  F+QLYNA TL+++      KEW V++  L FL   +GN  T L V+ QK   +
Sbjct:    2 QTRCSGTIARQKKKLKELSS-------ANAEEQISVLNNQIRIREKTFFEMESFLPKKNGLYLSLVLGNVNVTLLSKQSKFAYKDEYEKFKLYLTMILMVLSFICRFVLNSRVTDAVFNFLLVWYYCTLTIRESILINNGSRIKGWWVLNHYISTFLSGVMLTWPDGLMYQMFRNQFLSFSMYQSFVQFLQYYYQSGCLYRLRALGERHNMDLTVEGFQSWMWRGLTFLLPFLFFGQFWQLYNAITLFKLARHPECKEWQVIMCGLPFLVHFLGNFFTTLRVVHQKFQKQ 284          
BLAST of transmembrane protein 120A vs. Ensembl Xenopus
Match: pacrgl (parkin coregulated like [Source:Xenbase;Acc:XB-GENE-954377])

HSP 1 Score: 265.003 bits (676), Expect = 1.200e-85
Identity = 152/332 (45.78%), Postives = 219/332 (65.96%), Query Frame = 3
Query:   72 MEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKSTDNLDKIEKLQE---DLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIHSRTTRR 1058
            +++ ++E  EL KE + L+E H  Y   ++ +   Q  C+  +     R+ +L  +L   K T N+++ E +Q+    +K R     ++   LP+KNG+YLN+V+G+VNV+LLS   KFAYK++YEKFKL +T +  +      F +  R+ D  F+FLLVWYYCTLTIRE IL+ NGSRIKGWW++ H++ T LSG+ML WP    Y  FR+QF+ +S+Y   VQF+QYYYQ G LY++RALGER+ +D+TV+GF SWM++ LTF+LP LFF +F+QLYNA TL+ ++     KEW V V+AL FL L +GN LT L V+  K      ++
Sbjct:    3 LQKCQEEWGELEKEFQQLQETHKVYKQKLEELNGLQNLCSSYINKHKRRLTELKGNLHGYKHTSNVEEKELVQQINSTIKERHNAFFDMEAYLPKKNGLYLNLVLGNVNVTLLSNQAKFAYKDEYEKFKLYLTIILLLGAITCRFVLHYRVTDEVFNFLLVWYYCTLTIRESILISNGSRIKGWWVSHHYVSTFLSGVMLTWPDGLMYQIFRNQFLAFSIYQSCVQFLQYYYQSGCLYRLRALGERNHLDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLYNAITLFGLSRHEECKEWQVFVLALTFLLLFLGNFLTTLKVVHTKFQKNKLKK 334          
BLAST of transmembrane protein 120A vs. Ensembl Xenopus
Match: pacrgl (parkin coregulated like [Source:Xenbase;Acc:XB-GENE-954377])

HSP 1 Score: 259.61 bits (662), Expect = 1.759e-83
Identity = 137/299 (45.82%), Postives = 200/299 (66.89%), Query Frame = 3
Query:   72 MEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKSTDNLDKIEKLQE---DLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIR-NRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWH 956
            +++ ++E  EL KE + L+E H  Y   ++ +   Q  C+  +     R+ +L  +L   K T N+++ E +Q+    +K R     ++   LP+KNG+YLN+V+G+VNV+LLS   KFAYK++YEKFKL +T +  +      F +  + + D  F+FLLVWYYCTLTIRE IL+ NGSRIKGWW++ H++ T LSG+ML WP    Y  FR+QF+ +S+Y   VQF+QYYYQ G LY++RALGER+ +D+TV+GF SWM++ LTF+LP LFF +F+QLYNA TL+ ++     KEW 
Sbjct:    3 LQKCQEEWGELEKEFQQLQETHKVYKQKLEELNGLQNLCSSYINKHKRRLTELKGNLHGYKHTSNVEEKELVQQINSTIKERHNAFFDMEAYLPKKNGLYLNLVLGNVNVTLLSNQAKFAYKDEYEKFKLYLTIILLLGAITCRFVLHYSEVTDEVFNFLLVWYYCTLTIRESILISNGSRIKGWWVSHHYVSTFLSGVMLTWPDGLMYQIFRNQFLAFSIYQSCVQFLQYYYQSGCLYRLRALGERNHLDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLYNAITLFGLSRHEECKEWQ 301          
BLAST of transmembrane protein 120A vs. Ensembl Mouse
Match: Tmem120b (transmembrane protein 120B [Source:MGI Symbol;Acc:MGI:3603158])

HSP 1 Score: 297.745 bits (761), Expect = 1.437e-98
Identity = 151/326 (46.32%), Postives = 219/326 (67.18%), Query Frame = 3
Query:   72 MEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLK---STDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIH 1040
            +E  E+E  EL  E + L+E H  Y   ++ + S Q  C+  +  Q   +K L   L + K   S +    I+++  ++K R+    ++   LP+KNG+YLN+V+G+V+V+LLS   KFAYK++YEKFKL +T +  +      F +  R+ D  F+FLLVWYYCTLTIRE IL+ NGSRIKGWW++ H++ T LSG+ML WP    Y +FR+QF+ +S++   VQF+QYYYQ+G LY++RALGER+ +D+TV+GF SWM++ LTF+LP LF  +F+QLYNA TL++++     KEW V V+AL FL L +GN LT L V+  K+H
Sbjct:    5 LERCEREWHELEGEFQELQETHRIYKQKLEELTSLQTLCSTSISKQKRHLKDLKHTLQRYKRHSSHEEAALIQQMTANIKERQNVFFDMEAYLPKKNGLYLNLVLGNVSVTLLSNQAKFAYKDEYEKFKLYLTIILLLGAVACRFVLHYRVTDEVFNFLLVWYYCTLTIRESILISNGSRIKGWWVSHHYVSTFLSGVMLTWPNGLIYQKFRNQFLAFSIFQSCVQFLQYYYQRGCLYRLRALGERNHLDLTVEGFQSWMWRGLTFLLPFLFCGHFWQLYNAVTLFELSTHEECKEWQVFVLALTFLILFLGNFLTTLKVVHAKLH 330          
BLAST of transmembrane protein 120A vs. Ensembl Mouse
Match: Tmem120a (transmembrane protein 120A [Source:MGI Symbol;Acc:MGI:2686991])

HSP 1 Score: 283.108 bits (723), Expect = 8.516e-93
Identity = 151/320 (47.19%), Postives = 222/320 (69.38%), Query Frame = 3
Query:   96 DELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKST---DNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIHSR 1046
            ++L ++ + ++E H  Y   ++ +   Q  C   +  Q  R+++L   L K + +   ++++  ++L+  +K R+    ++   LP+KNG+YL++V+G+VNV+LLSK  KFAYK++YEKFKL +T +  + +F   F + +R+ DAAF+FLLVWYYCTLTIRE IL+ NGSRIKGWW+  H++ T LSG+ML WP    Y +FR+QF+ +S+Y  FVQF+QYYYQ G LY++RALGERH MD+TV+GF SWM++ LTF+LP LFF +F+QL+NA TL+ +  D   KEW VL+    FL L +GN  T L V+ QK HS+
Sbjct:   17 EDLQQDFQGIQETHRLYRLKLEELTKLQANCTNSITRQKKRLQELALVLKKCRPSLPSESMEAAQELENQMKERQGLFFDMEAYLPKKNGLYLSLVLGNVNVTLLSKQAKFAYKDEYEKFKLYLTIILIVISFTCRFLLNSRVTDAAFNFLLVWYYCTLTIRESILINNGSRIKGWWVFHHYVSTFLSGVMLTWPDGLMYQKFRNQFLSFSMYQSFVQFLQYYYQSGCLYRLRALGERHTMDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLFNALTLFNLARDPECKEWQVLMCGFPFLLLFLGNFFTTLRVVHQKFHSQ 336          
BLAST of transmembrane protein 120A vs. Ensembl Mouse
Match: Tmem120b (transmembrane protein 120B [Source:MGI Symbol;Acc:MGI:3603158])

HSP 1 Score: 268.47 bits (685), Expect = 1.179e-87
Identity = 143/323 (44.27%), Postives = 203/323 (62.85%), Query Frame = 3
Query:   72 MEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKSTDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIH 1040
            +E  E+E  EL  E + L+E H  Y   ++ + S Q  C+  +  Q                                 K +L+++  TL R   +YLN+V+G+V+V+LLS   KFAYK++YEKFKL +T +  +      F +  R+ D  F+FLLVWYYCTLTIRE IL+ NGSRIKGWW++ H++ T LSG+ML WP    Y +FR+QF+ +S++   VQF+QYYYQ+G LY++RALGER+ +D+TV+GF SWM++ LTF+LP LF  +F+QLYNA TL++++     KEW V V+AL FL L +GN LT L V+  K+H
Sbjct:    5 LERCEREWHELEGEFQELQETHRIYKQKLEELTSLQTLCSTSISKQ---------------------------------KRHLKDLKHTLQR---LYLNLVLGNVSVTLLSNQAKFAYKDEYEKFKLYLTIILLLGAVACRFVLHYRVTDEVFNFLLVWYYCTLTIRESILISNGSRIKGWWVSHHYVSTFLSGVMLTWPNGLIYQKFRNQFLAFSIFQSCVQFLQYYYQRGCLYRLRALGERNHLDLTVEGFQSWMWRGLTFLLPFLFCGHFWQLYNAVTLFELSTHEECKEWQVFVLALTFLILFLGNFLTTLKVVHAKLH 291          
BLAST of transmembrane protein 120A vs. Ensembl Mouse
Match: Tmem120b (transmembrane protein 120B [Source:MGI Symbol;Acc:MGI:3603158])

HSP 1 Score: 78.5666 bits (192), Expect = 2.250e-17
Identity = 31/58 (53.45%), Postives = 44/58 (75.86%), Query Frame = 3
Query:  600 RIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSL 773
            RIKGWW++ H++ T LSG+ML WP    Y +FR+QF+ +S++   VQF+QYYYQ+G L
Sbjct:   63 RIKGWWVSHHYVSTFLSGVMLTWPNGLIYQKFRNQFLAFSIFQSCVQFLQYYYQRGCL 120          
BLAST of transmembrane protein 120A vs. UniProt/SwissProt
Match: sp|Q9U1M2|TM120_DROME (Transmembrane protein 120 homolog OS=Drosophila melanogaster OX=7227 GN=CG32795 PE=1 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 7.726e-101
Identity = 154/332 (46.39%), Postives = 223/332 (67.17%), Query Frame = 3
Query:   72 MEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKS---TDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIHSRTTRR 1058
            ++ ++ E +ELNKE   L+  +  Y+  ++ + S Q+ C   ++HQ YRM Q+ + L + K     ++ +K++ L +    RK  L EI ++LP K+G YL +++G VNVS+L+++DK  YK+DYEKFKL +  +  I  FF   F   R L+ AF FLLVWYYCTLTIRE IL +NGSRIKGWW A HFI T  +G++L+WP  + +  FR QFM +++Y+  VQ++Q+ YQKG LY+++ALGERH MDIT++GF SWM++ L+F+LP LF  Y YQ YNAWTLY++ Y      WHV V++ +FL L +GN+ T L V+ +KI  R   R
Sbjct:    3 IDSLKNEWEELNKEFAELESCNRRYIELLEQLHSHQQICFNEIKHQRYRMNQITTSLRQFKGPVPAEDKEKVDDLHKMTLKRKAQLHEIEQSLPAKSGRYLQIILGDVNVSILNRNDKVRYKDDYEKFKLILNVIGLIMAFFNLIF-NYRALELAFIFLLVWYYCTLTIRESILKVNGSRIKGWWRAHHFISTVAAGVLLVWPQGEHWQIFRMQFMYFNVYISIVQYLQFGYQKGLLYRLKALGERHNMDITIEGFHSWMWRGLSFLLPFLFIGYGYQAYNAWTLYKLAYSPPDAPWHVSVMSGLFLLLFVGNMATTLWVVPEKIRERAKER 333          
BLAST of transmembrane protein 120A vs. UniProt/SwissProt
Match: sp|A6QPF8|T120B_BOVIN (Transmembrane protein 120B OS=Bos taurus OX=9913 GN=TMEM120B PE=2 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 1.643e-99
Identity = 150/331 (45.32%), Postives = 223/331 (67.37%), Query Frame = 3
Query:   72 MEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLK---STDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIHSRTTR 1055
            +E  E+E  EL  E + L+E H  Y   ++ + + Q  C+  +  Q  R+K L   L + K   S +  + ++++  ++K R+    ++   LP+KNG+YLN+V+G+VNV+LLS   KFAYK++YEKFKL +T +  +      FF+  R+ D  F+FLLVWYYCTLTIRE IL+ NGSRIKGWW++ H++ T LSG+ML WP    Y +FR+QF+ +S++   VQF+QYYYQ+G LY++RALGER+ +D+TV+GF SWM++ LTF+LP LF  +F+QLYNA TL++++     +EW V V+AL FL L +GN LT L V+  K+    ++
Sbjct:    5 LERCEREWHELEGEFQELQETHRIYKQKLEELNALQTSCSSSINKQKTRLKDLKLTLQRYKRHASREEAELVQQMGANIKERQNVFFDMEAYLPKKNGLYLNLVLGNVNVTLLSNQAKFAYKDEYEKFKLYLTIILLLGAVACRFFLHYRVTDEVFNFLLVWYYCTLTIRESILISNGSRIKGWWVSHHYVSTFLSGVMLTWPNGLIYQKFRNQFLAFSIFQSCVQFLQYYYQRGCLYRLRALGERNHLDLTVEGFQSWMWRGLTFLLPFLFCGHFWQLYNAVTLFELSSHEECREWQVFVLALTFLVLFLGNFLTTLKVVHTKLQQNRSK 335          
BLAST of transmembrane protein 120A vs. UniProt/SwissProt
Match: sp|Q3TA38|T120B_MOUSE (Transmembrane protein 120B OS=Mus musculus OX=10090 GN=Tmem120b PE=2 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 1.005e-97
Identity = 151/326 (46.32%), Postives = 219/326 (67.18%), Query Frame = 3
Query:   72 MEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLK---STDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIH 1040
            +E  E+E  EL  E + L+E H  Y   ++ + S Q  C+  +  Q   +K L   L + K   S +    I+++  ++K R+    ++   LP+KNG+YLN+V+G+V+V+LLS   KFAYK++YEKFKL +T +  +      F +  R+ D  F+FLLVWYYCTLTIRE IL+ NGSRIKGWW++ H++ T LSG+ML WP    Y +FR+QF+ +S++   VQF+QYYYQ+G LY++RALGER+ +D+TV+GF SWM++ LTF+LP LF  +F+QLYNA TL++++     KEW V V+AL FL L +GN LT L V+  K+H
Sbjct:    5 LERCEREWHELEGEFQELQETHRIYKQKLEELTSLQTLCSTSISKQKRHLKDLKHTLQRYKRHSSHEEAALIQQMTANIKERQNVFFDMEAYLPKKNGLYLNLVLGNVSVTLLSNQAKFAYKDEYEKFKLYLTIILLLGAVACRFVLHYRVTDEVFNFLLVWYYCTLTIRESILISNGSRIKGWWVSHHYVSTFLSGVMLTWPNGLIYQKFRNQFLAFSIFQSCVQFLQYYYQRGCLYRLRALGERNHLDLTVEGFQSWMWRGLTFLLPFLFCGHFWQLYNAVTLFELSTHEECKEWQVFVLALTFLILFLGNFLTTLKVVHAKLH 330          
BLAST of transmembrane protein 120A vs. UniProt/SwissProt
Match: sp|A0PK00|T120B_HUMAN (Transmembrane protein 120B OS=Homo sapiens OX=9606 GN=TMEM120B PE=1 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 1.038e-97
Identity = 147/326 (45.09%), Postives = 218/326 (66.87%), Query Frame = 3
Query:   72 MEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLK---STDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIH 1040
            +E  E+E  EL  E + L+E H  Y   ++ + + Q  C+  +  Q   +K L   L + K   S +  + ++++  ++K R+    ++   LP+KNG+YLN+V+G+VNV+LLS   KFAYK++YEKFKL +T +  +      F +  R+ D  F+FLLVWYYCTLTIRE IL+ NGSRIKGWW++ H++ T LSG+ML WP    Y +FR+QF+ +S++   VQF+QYYYQ+G LY++RALGER+ +D+TV+GF SWM++ LTF+LP LF  +F+QLYNA TL++++     +EW V V+A  FL L +GN LT L V+  K+ 
Sbjct:    5 LERCEREWHELEGEFQELQETHRIYKQKLEELAALQTLCSSSISKQKKHLKDLKLTLQRCKRHASREEAELVQQMAANIKERQDVFFDMEAYLPKKNGLYLNLVLGNVNVTLLSNQAKFAYKDEYEKFKLYLTIILLLGAVACRFVLHYRVTDEVFNFLLVWYYCTLTIRESILISNGSRIKGWWVSHHYVSTFLSGVMLTWPNGPIYQKFRNQFLAFSIFQSCVQFLQYYYQRGCLYRLRALGERNHLDLTVEGFQSWMWRGLTFLLPFLFCGHFWQLYNAVTLFELSSHEECREWQVFVLAFTFLILFLGNFLTTLKVVHAKLQ 330          
BLAST of transmembrane protein 120A vs. UniProt/SwissProt
Match: sp|A3KNK1|T120A_DANRE (Transmembrane protein 120A OS=Danio rerio OX=7955 GN=tmem120a PE=2 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 3.177e-94
Identity = 154/325 (47.38%), Postives = 223/325 (68.62%), Query Frame = 3
Query:   69 GMEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKST---DNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQK 1034
            G+ E  +E ++L K+ + +++ H  Y + ++ V   Q+ C+  +  Q  ++K L+  L + K     ++++KI+ +QE +K R     E+   LP+KNG+YL++V+G+VNV+LL+K  KFAYK++YEKFKL +T +   ++F   F +  R++DA F+FLLVWYYCTLTIRE IL+ NGS+IKGWW+  H++ T LSG+ML WP  + Y  FR+QF+ YS+Y+ FVQF QYYYQ G LY++RALGERH MD+TV+GF SWM++ LTF+LP LF  +F+QLYN  TL+Q+      KEW VL+    FL L MGN  T L V+  K
Sbjct:    7 GLTECLQEWEDLEKDYQQIQDTHRHYKHKLEEVSKLQESCSSSIARQRKKLKDLSESLEECKGAVNPEDVNKIDDIQESIKERPNVFFEMEAFLPKKNGLYLSLVLGNVNVTLLNKQSKFAYKDEYEKFKLYLTVLLLFFSFTCRFLVSYRVVDALFNFLLVWYYCTLTIRESILINNGSKIKGWWVFQHYVSTFLSGVMLTWPDGELYQMFRNQFLSYSMYINFVQFFQYYYQSGCLYRLRALGERHNMDLTVEGFQSWMWRGLTFLLPFLFLGHFFQLYNGITLFQMTQLPEWKEWQVLMCGSTFLVLFMGNFFTTLGVVYHK 331          
BLAST of transmembrane protein 120A vs. TrEMBL
Match: A0A267GKC3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034229g2 PE=4 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 1.438e-118
Identity = 180/339 (53.10%), Postives = 239/339 (70.50%), Query Frame = 3
Query:   75 EEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQ-LNS--DLLKLKSTDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIHSRTTRRIEYLIHKY 1082
            +  E  +D+LN+E + LK+ H  Y   VD +K  Q KC +G++HQ YR KQ LNS   L ++   D  DK+EKL + L  RK    ++ +TLP KNG+YLN+V+G VNVSLLSK DKFAYK+DYE FKL +T +  +   FL+ F+ +R+ DAAF FLLVWYYCTLTIRE IL++NGSRIKGWW+A HF+    SGI+L WP   SY RFR+QF L+ +Y+G VQ +QYYYQ+G LYK+RALGERH MDITVDGFMSWM++ L F+LP LF  Y +QLYN++ L+++ Y+   +EW V+ ++ +FL L +GN  T L V++QK+ S      E L  KY
Sbjct:   10 QSCEAALDKLNEEFQTLKKDHELYTEKVDEMKKMQTKCLDGIKHQRYRAKQILNSLTSLERVAQGDEKDKVEKLMKRLAQRKALFADLEDTLPHKNGLYLNIVLGQVNVSLLSKVDKFAYKQDYEAFKLVLTLIILVAAIFLFLFLEHRVFDAAFQFLLVWYYCTLTIRESILIVNGSRIKGWWVAHHFVSVVCSGIVLTWPREVSYYRFRNQFNLFCVYVGIVQVVQYYYQRGCLYKLRALGERHSMDITVDGFMSWMWRRLGFVLPFLFLGYGFQLYNSFVLFKLFYEPDCQEWQVIALSGLFLLLFLGNTTTTLGVVKQKMKSEGYSLREKLKRKY 348          
BLAST of transmembrane protein 120A vs. TrEMBL
Match: A0A1I8I4X3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034229g1 PE=4 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 1.438e-118
Identity = 180/339 (53.10%), Postives = 239/339 (70.50%), Query Frame = 3
Query:   75 EEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQ-LNS--DLLKLKSTDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIHSRTTRRIEYLIHKY 1082
            +  E  +D+LN+E + LK+ H  Y   VD +K  Q KC +G++HQ YR KQ LNS   L ++   D  DK+EKL + L  RK    ++ +TLP KNG+YLN+V+G VNVSLLSK DKFAYK+DYE FKL +T +  +   FL+ F+ +R+ DAAF FLLVWYYCTLTIRE IL++NGSRIKGWW+A HF+    SGI+L WP   SY RFR+QF L+ +Y+G VQ +QYYYQ+G LYK+RALGERH MDITVDGFMSWM++ L F+LP LF  Y +QLYN++ L+++ Y+   +EW V+ ++ +FL L +GN  T L V++QK+ S      E L  KY
Sbjct:   10 QSCEAALDKLNEEFQTLKKDHELYTEKVDEMKKMQTKCLDGIKHQRYRAKQILNSLTSLERVAQGDEKDKVEKLMKRLAQRKALFADLEDTLPHKNGLYLNIVLGQVNVSLLSKVDKFAYKQDYEAFKLVLTLIILVAAIFLFLFLEHRVFDAAFQFLLVWYYCTLTIRESILIVNGSRIKGWWVAHHFVSVVCSGIVLTWPREVSYYRFRNQFNLFCVYVGIVQVVQYYYQRGCLYKLRALGERHSMDITVDGFMSWMWRRLGFVLPFLFLGYGFQLYNSFVLFKLFYEPDCQEWQVIALSGLFLLLFLGNTTTTLGVVKQKMKSEGYSLREKLKRKY 348          
BLAST of transmembrane protein 120A vs. TrEMBL
Match: A0A1S3JTB2 (transmembrane protein 120A OS=Lingula unguis OX=7574 GN=LOC106175724 PE=4 SV=1)

HSP 1 Score: 356.295 bits (913), Expect = 6.186e-118
Identity = 179/326 (54.91%), Postives = 234/326 (71.78%), Query Frame = 3
Query:   69 GMEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKSTDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIHSR 1046
             ++ +  E +EL  E K L+E H +Y++ VD VK+ Q KC  G+ HQ YRMKQ+ +D LK     N  +I  L + ++ RK   RE  + LP KNG+YL++V+G VNVSLLSK DK+ YK+DYEKFKL V+T+S +  F L FFI +R LDAA+HFLLVWYYCTLTIRE IL++NGSRIKGWW+A HF+ T  +G++LIWP   +Y  FR QFM++S+Y+ FVQ +Q+YYQ G LY++RALGERH MDITV+GF SWM+K L+FILP LF  Y +Q YNA+TLY + +  +S E  V VV  +F  LA GN  T L VIR+K+ SR
Sbjct:    3 SLQSVIAEWEELETEFKELEENHKNYVSKVDEVKNLQAKCVNGIAHQRYRMKQV-ADNLKKYGKSNDQEIASLYQTIEERKTQFREFEDVLPHKNGIYLSIVLGQVNVSLLSKKDKYLYKQDYEKFKLIVSTISMVLAFCLLFFISSRYLDAAYHFLLVWYYCTLTIRESILIVNGSRIKGWWVAHHFVSTVCTGVLLIWPDGVTYRLFRQQFMIFSVYLSFVQVLQFYYQSGCLYRLRALGERHNMDITVEGFQSWMWKGLSFILPFLFGGYIFQFYNAYTLYHLAFHPQS-ELQVPVVCFMFFVLASGNAWTTLLVIREKLKSR 326          
BLAST of transmembrane protein 120A vs. TrEMBL
Match: A0A075A4I9 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_00133 PE=4 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 1.637e-111
Identity = 168/341 (49.27%), Postives = 237/341 (69.50%), Query Frame = 3
Query:   72 MEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLK---STDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIHSRTTRRIEYLIHKYH 1085
            M + +K  +E  K+ + +K  H+ Y+++V+ +K+ Q  C++ ++H    M+ LN+++ +L+   +T+   K+  ++ +L+ +++ +R + + LPR+ G+YL +V+G +N+SL SK DKFAYK DYE+FK+ V+ +  +  F LYFFI++R+LD  FHFLLVWYYCTLTIRE+IL+ NGSRIKGWW   HFI T  +GIMLIWP S SYD FRDQFML+SL M  V   QY YQ G LYK+RALGE H M IT+DGF SWMFK LTFILP L+ VY +++YNA+ LY+I+     +EW VL VAL+    AMGN++T   VIRQK  S +      L  +YH
Sbjct:    1 MPDFDKIQEEFEKQWRIMKGKHSSYLSSVETMKTAQSNCSQSVKHCKSYMQFLNNEISRLEKSATTEEKKKLAGVKLELQRKEVEMRNVEDVLPRRPGLYLRIVLGALNISLSSKQDKFAYKNDYEQFKIVVSAICAVLTFLLYFFIQSRVLDTVFHFLLVWYYCTLTIRERILIANGSRIKGWWNIYHFISTASAGIMLIWPRSQSYDEFRDQFMLFSLCMSIVHCFQYQYQIGCLYKLRALGEIHPMYITIDGFKSWMFKRLTFILPFLYGVYAFEMYNAYCLYEISRQPYCQEWQVLAVALLDAIRAMGNLITMGLVIRQKFRSISAVEFYRLKSQYH 341          
BLAST of transmembrane protein 120A vs. TrEMBL
Match: A0A4S2LEF1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007736 PE=4 SV=1)

HSP 1 Score: 340.502 bits (872), Expect = 2.529e-111
Identity = 167/341 (48.97%), Postives = 234/341 (68.62%), Query Frame = 3
Query:   72 MEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKSTDNLDKIEKLQE---DLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIHSRTTRRIEYLIHKYH 1085
            M +  K  +E  K+ + LK  H+ Y+++V+ +K+ Q  C++ ++H    ++ LN+++ +L+ +   D+ +K  +   +L+ +++ +R + + LPR+ G+YL +V+G +N+SL SK DKFAYK DYE+FK+ V+ +  +  F LYFFI++R+LD  FHFLLVWYYCTLTIRE+IL+ NGSRIKGWW   HFI T  +GIMLIWP S SYD FRDQFML+SL M  V   QY YQ G LYK+RALGE H M IT+DGF SWMFK LTFILP L+ VY +++YNA+ LY+I+     +EW VL VA +    AMGN++T   VIRQK  S +      L  +YH
Sbjct:    1 MPDFNKIQEEFEKQWRILKGKHSSYLSSVETMKTAQSSCSQSVKHCKSYLQFLNNEISRLEKSATPDEKKKFADVKLELQRKEVEMRNVEDVLPRRPGLYLRIVLGALNISLSSKQDKFAYKNDYEQFKIVVSAICAVLTFLLYFFIQSRVLDTVFHFLLVWYYCTLTIRERILIANGSRIKGWWNIYHFISTASAGIMLIWPRSQSYDEFRDQFMLFSLCMSIVHCFQYQYQIGCLYKLRALGEIHPMYITIDGFKSWMFKRLTFILPFLYGVYAFEMYNAYCLYEISRQPYCQEWQVLAVAFLDAIRAMGNLITMGLVIRQKFRSISAVEFYRLKSQYH 341          
BLAST of transmembrane protein 120A vs. Ensembl Cavefish
Match: tmem120a (transmembrane protein 120A [Source:NCBI gene;Acc:103023179])

HSP 1 Score: 288.886 bits (738), Expect = 4.062e-95
Identity = 153/325 (47.08%), Postives = 219/325 (67.38%), Query Frame = 3
Query:   69 GMEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKSTDNLD---KIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQK 1034
             + E  +E  +L K+ + ++E H  Y   ++ V   Q  C+  +  Q  R+K+L+  L + +   N +   ++E +QE +  R     E+   LP+KNG+YL++V+G+VNV+LL+   KFAYK++YEKFKL +T +  +++F   F +  R++DA F+FLLVWYYCTLTIRE IL+ NGS+IKGWW+  H++ T LSG+ML WP  + Y  FR+QF+ YS+Y+ FVQF+QYYYQ G LY++RALGERH MD+TV+GF SWM++ L F+LP LFF +F+QLYN  TL+Q+      KEW VL+ A  FL L MGN  T L  + QK
Sbjct:    7 SLNECLQEWKDLEKDYQQVQETHRMYKQKLEEVSKLQSSCSASITRQKKRLKELSDSLEECRQKGNPEDIREVELIQESINERPNVFFEMEAFLPKKNGLYLSLVLGNVNVTLLNTQSKFAYKDEYEKFKLYLTVILLLFSFTCRFIVSYRVVDALFNFLLVWYYCTLTIRESILINNGSKIKGWWVFQHYVSTFLSGVMLTWPEGELYQMFRNQFLSYSMYINFVQFLQYYYQSGCLYRLRALGERHNMDLTVEGFQSWMWRGLAFLLPFLFFGHFWQLYNGITLFQMAQLPEWKEWQVLMCASTFLVLFMGNFFTTLGAVYQK 331          
BLAST of transmembrane protein 120A vs. Ensembl Cavefish
Match: zgc:103681 (transmembrane protein 120A-like [Source:NCBI gene;Acc:103035104])

HSP 1 Score: 280.411 bits (716), Expect = 6.185e-92
Identity = 149/317 (47.00%), Postives = 211/317 (66.56%), Query Frame = 3
Query:   87 KEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLK---STDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIR 1028
            KE + L KE + +++    YM  +D V   Q   A  + H    +K L+  L K     + +   ++E+++  ++ R   L ++   LP+KNG+YL++V+G VNV+LLSK  K +YK++YEKFKL VT ++F+  F   FF+  R+LDA  +FLLVWYYCTLTIRE +L+ NGSRIKGWW+  H+I T LSGIML WP  + Y  FR QF  Y LY  FVQF+QYYYQ G LY+++ALGERH +D+TV+GF SWM++ LTF+LP LFF + +Q +N+ TL+++    + KEW V +  + FL L  GN+LT L V+R
Sbjct:   10 KEWENLEKEFQQIQDTQQLYMQKLDEVSKLQNSFAASISHHRKFLKDLSQSLKKCSKGLTEEEAKQVEEIKGQMQERPNLLSQMESYLPKKNGIYLSLVLGSVNVNLLSKQSKASYKDEYEKFKLGVTVIAFLLAFICEFFVNYRVLDALLNFLLVWYYCTLTIRESVLISNGSRIKGWWVVHHYISTILSGIMLTWPDGELYQMFRIQFWGYCLYQCFVQFLQYYYQSGCLYRLKALGERHNLDLTVEGFQSWMWRGLTFLLPFLFFGHSWQFFNSITLFRMANLPQCKEWQVFMCGVCFLVLFTGNVLTTLAVVR 326          
BLAST of transmembrane protein 120A vs. Ensembl Cavefish
Match: tmem120a (transmembrane protein 120A [Source:NCBI gene;Acc:103023179])

HSP 1 Score: 278.485 bits (711), Expect = 1.286e-91
Identity = 140/299 (46.82%), Postives = 204/299 (68.23%), Query Frame = 3
Query:   69 GMEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKSTDNLD---KIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWH 956
             + E  +E  +L K+ + ++E H  Y   ++ V   Q  C+  +  Q  R+K+L+  L + +   N +   ++E +QE +  R     E+   LP+KNG+YL++V+G+VNV+LL+   KFAYK++YEKFKL +T +  +++F   F +  R++DA F+FLLVWYYCTLTIRE IL+ NGS+IKGWW+  H++ T LSG+ML WP  + Y  FR+QF+ YS+Y+ FVQF+QYYYQ G LY++RALGERH MD+TV+GF SWM++ L F+LP LFF +F+QLYN  TL+Q+      KEW 
Sbjct:    7 SLNECLQEWKDLEKDYQQVQETHRMYKQKLEEVSKLQSSCSASITRQKKRLKELSDSLEECRQKGNPEDIREVELIQESINERPNVFFEMEAFLPKKNGLYLSLVLGNVNVTLLNTQSKFAYKDEYEKFKLYLTVILLLFSFTCRFIVSYRVVDALFNFLLVWYYCTLTIRESILINNGSKIKGWWVFQHYVSTFLSGVMLTWPEGELYQMFRNQFLSYSMYINFVQFLQYYYQSGCLYRLRALGERHNMDLTVEGFQSWMWRGLAFLLPFLFFGHFWQLYNGITLFQMAQLPEWKEWQ 305          
BLAST of transmembrane protein 120A vs. Ensembl Cavefish
Match: tmem120b (transmembrane protein 120B [Source:NCBI gene;Acc:798580])

HSP 1 Score: 269.24 bits (687), Expect = 1.635e-87
Identity = 149/323 (46.13%), Postives = 213/323 (65.94%), Query Frame = 3
Query:   69 GMEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKSTDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKI 1037
             +E  E +  E+ +E + L+E H  Y   ++ + S Q  C+  +  Q   +K+L   L K    D       LQ  +K ++    ++   LP++NG+YLN+V+G+VNV+LLS   KFAYK++YEKFKL +T +         F +  R+ D  F+FLLVWYYCTLTIRE IL+ NGSRIKGWW++ H++ T LSG+ML WP    Y  FR QF+ +S+Y   VQF+QYYYQ G LY++RALGER+++D+TV+GF SWM++ LTF+LP LFF +F+QLYN+ TL++++     KEW V ++AL FL L +GN LT L V+ QK+
Sbjct:    8 SLERCESDWREIEQEYQQLQETHKVYRQKLEELTSLQAICSSSICKQRKGLKELRKTLHKYVIAD-------LQTQIKEKQNVFFDMESYLPKRNGLYLNLVLGNVNVTLLSNQAKFAYKDEYEKFKLYMTIILMFGAVTCLFLLNYRVTDEIFNFLLVWYYCTLTIRESILMSNGSRIKGWWVSHHYVSTFLSGVMLTWPEGAIYQLFRSQFLAFSIYQSLVQFLQYYYQSGCLYRLRALGERNQLDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLYNSVTLFRLSAREDCKEWQVFMLALTFLVLFLGNFLTTLKVVHQKL 323          
BLAST of transmembrane protein 120A vs. Ensembl Sea Lamprey
Match: zgc:103681 (zgc:103681 [Source:ZFIN;Acc:ZDB-GENE-041010-17])

HSP 1 Score: 218.394 bits (555), Expect = 2.538e-70
Identity = 111/201 (55.22%), Postives = 151/201 (75.12%), Query Frame = 3
Query:  357 VYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNR-ILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWH 956
            +YLN+V+G+VNV+LLSK  KFAYK++YEKFKL +TT+  + +F   F +  R + D   +FLLVWYYCTLTIRE +L+ NGSRIKGWW+A H++   LSG ML WP    Y  FR+QF+ +++Y  F+QF+QYYYQ G LY++RALG+RH MD+TV+GF SWM++ LTF+LP LFF + +QLYN+ TL+++      KEW 
Sbjct:    1 LYLNLVLGNVNVTLLSKQAKFAYKDEYEKFKLYLTTLLILASFTCRFLVNYRWVTDEILNFLLVWYYCTLTIRESVLISNGSRIKGWWVAHHYVSAFLSGTMLTWPNGLMYQMFRNQFLAFTMYQNFLQFLQYYYQSGCLYRLRALGQRHNMDLTVEGFQSWMWRGLTFLLPFLFFGHLWQLYNSITLFKLAQHKECKEWQ 201          
BLAST of transmembrane protein 120A vs. Ensembl Nematostella
Match: EDO37687 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF42])

HSP 1 Score: 217.238 bits (552), Expect = 4.477e-68
Identity = 125/308 (40.58%), Postives = 184/308 (59.74%), Query Frame = 3
Query:  156 VDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKSTDNLD----KIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIHSRTTRRIEY 1067
            +D     QK C   +     ++K     L +L+  D       K+ +LQ  +   K  L+E+  +LP   G +L + +G+++VSL  K  K  YK++YE FKL +T +  ++ F   +    RI D+ FH +LVWYY TLT++E IL+ NGSRIKGWW+  H+    LSG++LIWP    Y  FR QF ++S Y+ FVQ IQY YQ G LY++RALG  + MD+T+DGF +WMF+ L F+LP L F Y +QLYNA+TL+   +     EW VL +++ F  L  GN+ T + V+R K   + T +I++
Sbjct:    1 MDEYHKSQKSCISMVNLIKRKIKDFVQSLARLERQDQTPESRKKVAELQFRITELKNKLKELEMSLPSSAGSFLRLCLGNIDVSLYQK--KLEYKDNYETFKLKMTVLCLVFAFSNLYICNYRITDSIFHGILVWYYSTLTLQEHILIANGSRIKGWWVLHHYFSILLSGLLLIWPEGTIYQMFRGQFFVFSCYLSFVQLIQYRYQSGVLYRLRALGVSYGMDVTLDGFHTWMFRGLGFVLPFLIFGYLFQLYNAYTLFVFFHHPSCLEWQVLALSITFFVLFFGNMTTLVYVMRSKY--KQTHKIKF 304          
BLAST of transmembrane protein 120A vs. Ensembl Nematostella
Match: EDO29642 (pep supercontig:ASM20922v1:NEMVEscaffold_878:43825:45756:-1 gene:NEMVEDRAFT_v1g143806 transcript:EDO29642 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.849 bits (281), Expect = 2.401e-30
Identity = 59/128 (46.09%), Postives = 84/128 (65.62%), Query Frame = 3
Query:  684 YDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIHSRTTRRIEY 1067
            Y  FR QF ++S Y+ FVQ IQY YQ G LY++RALG  + MD+T+DGF +WMF+ L F+LP L F Y +QLYNA+TL+   +     EW VL +++ F  L  GN+ T + V+R K   + T +I++
Sbjct:    6 YQMFRGQFFVFSCYLSFVQLIQYRYQSGVLYRLRALGVSYGMDVTLDGFHTWMFRGLGFVLPFLIFGYLFQLYNAYTLFVFFHHPSCSEWQVLALSITFFVLFFGNMTTLVYVMRSK--YKQTHKIKF 131          
BLAST of transmembrane protein 120A vs. Ensembl Nematostella
Match: EDO37686 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF40])

HSP 1 Score: 63.1586 bits (152), Expect = 4.936e-13
Identity = 29/63 (46.03%), Postives = 42/63 (66.67%), Query Frame = 3
Query:  414 KFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSR 602
            +  YK++YE FKL +T +  ++ F   +    RI D+ FH +LVWYY TLT++E IL+ NGSR
Sbjct:    1 RLEYKDNYETFKLKMTVLCLVFAFSNLYIFNYRITDSIFHGILVWYYSTLTLQEHILIANGSR 63          
BLAST of transmembrane protein 120A vs. Ensembl Medaka
Match: tmem120a (transmembrane protein 120A [Source:NCBI gene;Acc:101172185])

HSP 1 Score: 292.738 bits (748), Expect = 1.395e-96
Identity = 153/330 (46.36%), Postives = 224/330 (67.88%), Query Frame = 3
Query:   69 GMEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLK--------STDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQK 1034
            G  E  +E ++L K+   +++ H  Y   ++ V   Q  C+  +  Q  ++K+L   L + K        S++ ++ I ++++ +K R     E+   LP+KNG+YL++V+G+VNV+LL+K  KFAYK++YEKFKL +T + F+++F   F +  R+LDA F+FLLVWYYCTLTIRE IL+ NGSRIKGWW+  H++ T LSG+ML WP    Y  FR+QF+ Y+LY  FVQF+QYYYQ G LY++RALGERH MD+TV+GF SWM++ LTF+LP LFF +F+QLYN+ TL+++      KEW V++    ++ L MGN+ T L V+ QK
Sbjct:    7 GFSECFREWEDLEKDFHQIQDTHRLYKQKLEEVTKLQNNCSGAIARQRKKLKELTLSLEECKQNNSTATISSETVNSIAEIEDSMKDRAHAFFEMEAFLPKKNGLYLSLVLGNVNVTLLNKQAKFAYKDEYEKFKLILTVILFMFSFTCCFLLSYRVLDALFNFLLVWYYCTLTIRESILISNGSRIKGWWVFHHYVSTFLSGVMLTWPEGTLYQMFRNQFLSYNLYQSFVQFLQYYYQSGCLYRLRALGERHNMDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLYNSMTLFKMFQLPECKEWQVVMCGCSYMVLFMGNLFTTLKVVYQK 336          
BLAST of transmembrane protein 120A vs. Ensembl Medaka
Match: tmem120a (transmembrane protein 120A [Source:NCBI gene;Acc:101172185])

HSP 1 Score: 280.411 bits (716), Expect = 5.190e-92
Identity = 143/304 (47.04%), Postives = 208/304 (68.42%), Query Frame = 3
Query:   69 GMEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLK--------STDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWH 956
            G  E  +E ++L K+   +++ H  Y   ++ V   Q  C+  +  Q  ++K+L   L + K        S++ ++ I ++++ +K R     E+   LP+KNG+YL++V+G+VNV+LL+K  KFAYK++YEKFKL +T + F+++F   F +  R+LDA F+FLLVWYYCTLTIRE IL+ NGSRIKGWW+  H++ T LSG+ML WP    Y  FR+QF+ Y+LY  FVQF+QYYYQ G LY++RALGERH MD+TV+GF SWM++ LTF+LP LFF +F+QLYN+ TL+++      KEW 
Sbjct:    7 GFSECFREWEDLEKDFHQIQDTHRLYKQKLEEVTKLQNNCSGAIARQRKKLKELTLSLEECKQNNSTATISSETVNSIAEIEDSMKDRAHAFFEMEAFLPKKNGLYLSLVLGNVNVTLLNKQAKFAYKDEYEKFKLILTVILFMFSFTCCFLLSYRVLDALFNFLLVWYYCTLTIRESILISNGSRIKGWWVFHHYVSTFLSGVMLTWPEGTLYQMFRNQFLSYNLYQSFVQFLQYYYQSGCLYRLRALGERHNMDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLYNSMTLFKMFQLPECKEWQ 310          
BLAST of transmembrane protein 120A vs. Ensembl Medaka
Match: tmem120b (transmembrane protein 120B [Source:NCBI gene;Acc:101162856])

HSP 1 Score: 275.789 bits (704), Expect = 4.343e-90
Identity = 149/329 (45.29%), Postives = 220/329 (66.87%), Query Frame = 3
Query:   78 EIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKSTDN---LDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIHSRTTR 1055
            +++ E D+++ E + L+E H  Y   ++ + S Q  C+  +  Q   +K +   L K   T +   L  +  ++  +K R+    ++   LP+KNG+YL++V+G+VNV+LLS   KFAYK++YEKFKL +T +         FF+  R+ D  F+FLLVWYYCTLTIRE IL+ NGSRIKGWW++ H++ T LSG+ML WP    Y  FR QF+ +S+Y  FVQF+QYYYQ G LY++RALGER+++D+TV+GF SWM++ LTF+LP LFF +F+QL+N+ TL+++      KEW V ++AL FL L +GN LT L V+RQK+  +  +
Sbjct:    5 KLQAEWDDIDNEYQQLQETHKIYRQKLEELTSLQATCSGAISKQRKSLKDVRRSLSKCAQTCDEKELQLLTHIKTQIKEREHVFFDMEAYLPKKNGLYLSLVLGNVNVTLLSNQAKFAYKDEYEKFKLYMTIILMFGAITCLFFLNYRVTDEIFNFLLVWYYCTLTIRESILMNNGSRIKGWWVSHHYVSTFLSGVMLTWPEGPMYQMFRSQFLAFSIYQSFVQFLQYYYQSGCLYRLRALGERNQLDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLHNSVTLFRLARHEGCKEWQVFMLALTFLVLFLGNFLTTLKVVRQKVQKKVEK 333          
BLAST of transmembrane protein 120A vs. Ensembl Medaka
Match: zgc:103681 (transmembrane protein 120A [Source:NCBI gene;Acc:101173961])

HSP 1 Score: 269.24 bits (687), Expect = 1.621e-87
Identity = 150/326 (46.01%), Postives = 214/326 (65.64%), Query Frame = 3
Query:   72 MEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLK-STDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIHSR 1046
            + E+  E   L +E + L++ H  Y++ +D +   Q  C+  +  Q   +K+L+    K + S +  + + ++++ LK+R+    E+   LP+KNG+YL++V+G+VNV+L +K  KFAYK++YEKFKL +T +  + +F  Y F+  R LDA  +FLLVW+YCTLTIRE IL+ NGSRIKGWW+  H+I   LSG+ML WP  + Y  FR QF+ Y LY  FVQ +Q YYQ G LY++R LGERH MD+TV+GF SWM+K LTF+LP LFF +F+QL+N  +L+++      KEW VLV  L FL L MGN  T L V+  K   R
Sbjct:    5 LAEVVNEWKRLEEEYQQLQDTHRRYLHKLDEISKLQNNCSSSIVRQRKNLKELSRRTKKKRLSQEEANTLAEIKDKLKTRQNAFDEMEAFLPKKNGLYLSLVLGNVNVTLFTKQSKFAYKDEYEKFKLYLTVILLLLSFICYGFVSYRFLDAILNFLLVWFYCTLTIRESILITNGSRIKGWWVFHHYISAFLSGVMLTWPDGNLYKMFRGQFLAYCLYQSFVQCLQCYYQSGCLYRLRTLGERHNMDLTVEGFQSWMWKGLTFLLPFLFFGHFWQLFNGLSLFRMARLPDCKEWQVLVCGLCFLILFMGNFFTTLAVVHHKSKKR 330          
BLAST of transmembrane protein 120A vs. Ensembl Medaka
Match: tmem120a (transmembrane protein 120A [Source:NCBI gene;Acc:101172185])

HSP 1 Score: 265.774 bits (678), Expect = 1.888e-86
Identity = 125/268 (46.64%), Postives = 183/268 (68.28%), Query Frame = 3
Query:   69 GMEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLK--------STDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFK 848
            G  E  +E ++L K+   +++ H  Y   ++ V   Q  C+  +  Q  ++K+L   L + K        S++ ++ I ++++ +K R     E+   LP+KNG+YL++V+G+VNV+LL+K  KFAYK++YEKFKL +T + F+++F   F +  R+LDA F+FLLVWYYCTLTIRE IL+ NGSRIKGWW+  H++ T LSG+ML WP    Y  FR+QF+ Y+LY  FVQF+QYYYQ G LY++RALGERH MD+TV+GF SWM++
Sbjct:    7 GFSECFREWEDLEKDFHQIQDTHRLYKQKLEEVTKLQNNCSGAIARQRKKLKELTLSLEECKQNNSTATISSETVNSIAEIEDSMKDRAHAFFEMEAFLPKKNGLYLSLVLGNVNVTLLNKQAKFAYKDEYEKFKLILTVILFMFSFTCCFLLSYRVLDALFNFLLVWYYCTLTIRESILISNGSRIKGWWVFHHYVSTFLSGVMLTWPEGTLYQMFRNQFLSYNLYQSFVQFLQYYYQSGCLYRLRALGERHNMDLTVEGFQSWMWR 274          
BLAST of transmembrane protein 120A vs. Planmine SMEST
Match: SMESG000052598.1 (SMESG000052598.1)

HSP 1 Score: 681.789 bits (1758), Expect = 0.000e+0
Identity = 345/345 (100.00%), Postives = 345/345 (100.00%), Query Frame = 3
Query:   72 MEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKSTDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHXXXXXXXXXXXXMGNILTALTVIRQKIHSRTTRRIEYLIHKYHTLRQKDN 1106
            MEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKSTDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHVLVVALIFLFLAMGNILTALTVIRQKIHSRTTRRIEYLIHKYHTLRQKDN
Sbjct:    1 MEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRMKQLNSDLLKLKSTDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNVVIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILDAAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWPISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITVDGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHVLVVALIFLFLAMGNILTALTVIRQKIHSRTTRRIEYLIHKYHTLRQKDN 345          
The following BLAST results are available for this feature:
BLAST of transmembrane protein 120A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TMEM120B2.162e-9845.09transmembrane protein 120B [Source:HGNC Symbol;Acc... [more]
TMEM120B2.162e-9845.09transmembrane protein 120B [Source:HGNC Symbol;Acc... [more]
TMEM120A4.445e-9047.06transmembrane protein 120A [Source:HGNC Symbol;Acc... [more]
TMEM120A2.501e-8847.44transmembrane protein 120A [Source:HGNC Symbol;Acc... [more]
TMEM120B7.105e-7244.92transmembrane protein 120B [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of transmembrane protein 120A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
M01G5.39.994e-7537.08pep chromosome:WBcel235:III:1468643:1517993:-1 gen... [more]
back to top
BLAST of transmembrane protein 120A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG327957.707e-10246.39gene:FBgn0040384 transcript:FBtr0070492[more]
CG327957.707e-10246.39gene:FBgn0040384 transcript:FBtr0070493[more]
CG327957.707e-10246.39gene:FBgn0040384 transcript:FBtr0070491[more]
CG327957.707e-10246.39gene:FBgn0040384 transcript:FBtr0309881[more]
CG327957.707e-10246.39gene:FBgn0040384 transcript:FBtr0345318[more]
back to top
BLAST of transmembrane protein 120A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmem120a4.209e-9547.38transmembrane protein 120A [Source:NCBI gene;Acc:1... [more]
tmem120b1.934e-8946.63transmembrane protein 120B [Source:NCBI gene;Acc:7... [more]
tmem120b1.934e-8946.63transmembrane protein 120B [Source:NCBI gene;Acc:7... [more]
zgc:1036815.197e-8844.44zgc:103681 [Source:ZFIN;Acc:ZDB-GENE-041010-17][more]
tmem120b8.003e-8648.21transmembrane protein 120B [Source:NCBI gene;Acc:7... [more]
back to top
BLAST of transmembrane protein 120A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
magoh6.253e-9445.92mago homolog, exon junction complex subunit [Sourc... [more]
magoh9.145e-9445.92mago homolog, exon junction complex subunit [Sourc... [more]
magoh1.195e-8849.66mago homolog, exon junction complex subunit [Sourc... [more]
pacrgl1.200e-8545.78parkin coregulated like [Source:Xenbase;Acc:XB-GEN... [more]
pacrgl1.759e-8345.82parkin coregulated like [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of transmembrane protein 120A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Tmem120b1.437e-9846.32transmembrane protein 120B [Source:MGI Symbol;Acc:... [more]
Tmem120a8.516e-9347.19transmembrane protein 120A [Source:MGI Symbol;Acc:... [more]
Tmem120b1.179e-8744.27transmembrane protein 120B [Source:MGI Symbol;Acc:... [more]
Tmem120b2.250e-1753.45transmembrane protein 120B [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of transmembrane protein 120A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9U1M2|TM120_DROME7.726e-10146.39Transmembrane protein 120 homolog OS=Drosophila me... [more]
sp|A6QPF8|T120B_BOVIN1.643e-9945.32Transmembrane protein 120B OS=Bos taurus OX=9913 G... [more]
sp|Q3TA38|T120B_MOUSE1.005e-9746.32Transmembrane protein 120B OS=Mus musculus OX=1009... [more]
sp|A0PK00|T120B_HUMAN1.038e-9745.09Transmembrane protein 120B OS=Homo sapiens OX=9606... [more]
sp|A3KNK1|T120A_DANRE3.177e-9447.38Transmembrane protein 120A OS=Danio rerio OX=7955 ... [more]
back to top
BLAST of transmembrane protein 120A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GKC31.438e-11853.10Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8I4X31.438e-11853.10Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1S3JTB26.186e-11854.91transmembrane protein 120A OS=Lingula unguis OX=75... [more]
A0A075A4I91.637e-11149.27Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A4S2LEF12.529e-11148.97Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of transmembrane protein 120A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tmem120a4.062e-9547.08transmembrane protein 120A [Source:NCBI gene;Acc:1... [more]
zgc:1036816.185e-9247.00transmembrane protein 120A-like [Source:NCBI gene;... [more]
tmem120a1.286e-9146.82transmembrane protein 120A [Source:NCBI gene;Acc:1... [more]
tmem120b1.635e-8746.13transmembrane protein 120B [Source:NCBI gene;Acc:7... [more]
back to top
BLAST of transmembrane protein 120A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zgc:1036812.538e-7055.22zgc:103681 [Source:ZFIN;Acc:ZDB-GENE-041010-17][more]
back to top
BLAST of transmembrane protein 120A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of transmembrane protein 120A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO376874.477e-6840.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO296422.401e-3046.09pep supercontig:ASM20922v1:NEMVEscaffold_878:43825... [more]
EDO376864.936e-1346.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of transmembrane protein 120A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmem120a1.395e-9646.36transmembrane protein 120A [Source:NCBI gene;Acc:1... [more]
tmem120a5.190e-9247.04transmembrane protein 120A [Source:NCBI gene;Acc:1... [more]
tmem120b4.343e-9045.29transmembrane protein 120B [Source:NCBI gene;Acc:1... [more]
zgc:1036811.621e-8746.01transmembrane protein 120A [Source:NCBI gene;Acc:1... [more]
tmem120a1.888e-8646.64transmembrane protein 120A [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of transmembrane protein 120A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000052598.10.000e+0100.00SMESG000052598.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008371 ID=SMED30008371|Name=transmembrane protein 120A|organism=Schmidtea mediterranea sexual|type=transcript|length=1173bp
TATAACTGATCATTATTTTGAAATTTCTAATTTTTTATTGACTTAATATT
TGTGTTACTAAACATTAAGGTATGGAAGAGATTGAAAAGGAAGTAGACGA
GCTTAATAAGGAATTGAAAAACCTTAAAGAAATTCATAATGATTACATGA
ATAATGTTGATGTAGTTAAAAGCAAGCAGAAAAAATGTGCCGAAGGCCTA
AGACATCAAACTTATCGCATGAAGCAACTAAATAGTGATTTATTAAAATT
AAAATCTACAGATAATCTTGATAAAATTGAAAAATTACAGGAAGATTTAA
AGTCTCGTAAAATTTATTTGCGAGAAATTGGAGAAACATTACCTAGAAAG
AATGGCGTTTACTTAAATGTTGTTATTGGTCATGTTAACGTTTCTTTGCT
TAGTAAAGATGACAAGTTTGCATATAAAGAAGATTATGAGAAATTCAAAT
TGTCTGTTACAACCGTCTCATTCATTTATAACTTTTTTTTGTATTTTTTC
ATACGAAATCGAATTCTTGATGCAGCATTCCATTTTCTCTTAGTCTGGTA
TTATTGTACTTTAACTATTCGAGAACAGATACTTGTTATAAACGGTTCAA
GGATCAAAGGTTGGTGGCTTGCAAGTCACTTTATATATACTACACTCTCT
GGAATAATGCTTATATGGCCAATTAGTGATTCGTATGACAGATTCCGAGA
TCAATTTATGCTTTACAGTTTATATATGGGATTCGTTCAATTCATCCAAT
ATTATTACCAAAAGGGATCGCTGTACAAAATGAGGGCATTGGGTGAACGG
CACAAAATGGATATCACAGTTGATGGTTTCATGTCTTGGATGTTTAAGCA
CTTGACCTTTATTCTCCCACTTCTATTTTTTGTTTATTTCTACCAGTTGT
ATAATGCTTGGACACTTTATCAAATTAACTATGACACTAGATCCAAAGAA
TGGCATGTTCTAGTTGTGGCGTTAATCTTCCTTTTTCTGGCAATGGGGAA
TATCTTAACGGCTTTAACTGTAATTAGACAGAAAATTCATAGCAGAACGA
CAAGACGAATAGAATATCTCATTCATAAGTATCATACATTGAGACAGAAA
GATAATTGACATGTTCGTATTATTTTGTAAAATGATTTAAAATATTCACT
AACTTTAGCTTACTGAATAAATG
back to top

protein sequence of SMED30008371-orf-1

>SMED30008371-orf-1 ID=SMED30008371-orf-1|Name=SMED30008371-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=346bp
MEEIEKEVDELNKELKNLKEIHNDYMNNVDVVKSKQKKCAEGLRHQTYRM
KQLNSDLLKLKSTDNLDKIEKLQEDLKSRKIYLREIGETLPRKNGVYLNV
VIGHVNVSLLSKDDKFAYKEDYEKFKLSVTTVSFIYNFFLYFFIRNRILD
AAFHFLLVWYYCTLTIREQILVINGSRIKGWWLASHFIYTTLSGIMLIWP
ISDSYDRFRDQFMLYSLYMGFVQFIQYYYQKGSLYKMRALGERHKMDITV
DGFMSWMFKHLTFILPLLFFVYFYQLYNAWTLYQINYDTRSKEWHVLVVA
LIFLFLAMGNILTALTVIRQKIHSRTTRRIEYLIHKYHTLRQKDN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR012926TMPIT
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005634nucleus
GO:0005637nuclear inner membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
GO:0045444fat cell differentiation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1..28
NoneNo IPR availableTMHMMTMhelixcoord: 252..274
NoneNo IPR availableTMHMMTMhelixcoord: 180..202
NoneNo IPR availableTMHMMTMhelixcoord: 125..144
NoneNo IPR availableTMHMMTMhelixcoord: 148..167
NoneNo IPR availableTMHMMTMhelixcoord: 212..229
NoneNo IPR availableTMHMMTMhelixcoord: 296..318
IPR012926TMPIT-likePFAMPF07851TMPITcoord: 6..323
e-value: 5.7E-127
score: 423.4
IPR012926TMPIT-likePANTHERPTHR21433TRANSMEMBRANE PROTEIN INDUCED BY TUMOR NECROSIS FACTOR ALPHAcoord: 2..324