Peptidase S1 domain-containing protein

Overview
NamePeptidase S1 domain-containing protein
Smed IDSMED30008369
Length (bp)1112
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peptidase S1 domain-containing protein (SMED30008369) t-SNE clustered cells

Violin plots show distribution of expression levels for Peptidase S1 domain-containing protein (SMED30008369) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peptidase S1 domain-containing protein (SMED30008369) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peptidase S1 domain-containing protein (SMED30008369) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008369

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30008369SMESG000077268.1 Contig1063uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008369SMESG000077268.1 Contig1063newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008369SMESG000023248.1 Contig1063uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008369SMESG000023248.1 Contig1063newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30008369SMESG000077268.1 dd_Smed_v4_5852_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008369SMESG000077268.1 dd_Smed_v4_5852_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30008369SMESG000077268.1 dd_Smed_v4_5852_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Human
Match: TPSB2 (tryptase beta 2 (gene/pseudogene) [Source:HGNC Symbol;Acc:HGNC:14120])

HSP 1 Score: 94.3597 bits (233), Expect = 1.528e-21
Identity = 85/301 (28.24%), Postives = 134/301 (44.52%), Query Frame = 2
Query:  122 STGQIDKRV--IGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWG-CTKAAGVPNTYA-KLALLKVWDNDKC-----IDAFVAP-IDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            + GQ  +RV  +GG+ AP  K+ W VS++  V +      CG S+I  +    W+LTAAHC  P  K         +L   RV L +   YY+         ++L+                        + +I +HP + + ++  DIAL++L +P+ +     V+T+ LP  P    +PP G  C V GWG       +P  +  K   + + +N  C     + A+    + +  +   CAG  +R    C GDSG  L CK +G W+ AGVVS          P I+T+V  + +WI
Sbjct:   21 APGQALQRVGIVGGQEAPRSKWPWQVSLR--VRDRYWMHFCGGSLIHPQ----WVLTAAHCVGPDVK---------DLAALRVQLREQHLYYQ---------DQLLP-----------------------VSRIIVHPQFYTAQIGADIALLELEEPVNVS--SHVHTVTLP--PASETFPP-GMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDS--CQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWI 267          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Human
Match: TPSB2 (tryptase beta 2 (gene/pseudogene) [Source:HGNC Symbol;Acc:HGNC:14120])

HSP 1 Score: 94.3597 bits (233), Expect = 1.811e-21
Identity = 85/301 (28.24%), Postives = 134/301 (44.52%), Query Frame = 2
Query:  122 STGQIDKRV--IGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWG-CTKAAGVPNTYA-KLALLKVWDNDKC-----IDAFVAP-IDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            + GQ  +RV  +GG+ AP  K+ W VS++  V +      CG S+I  +    W+LTAAHC  P  K         +L   RV L +   YY+         ++L+                        + +I +HP + + ++  DIAL++L +P+ +     V+T+ LP  P    +PP G  C V GWG       +P  +  K   + + +N  C     + A+    + +  +   CAG  +R    C GDSG  L CK +G W+ AGVVS          P I+T+V  + +WI
Sbjct:   28 APGQALQRVGIVGGQEAPRSKWPWQVSLR--VRDRYWMHFCGGSLIHPQ----WVLTAAHCVGPDVK---------DLAALRVQLREQHLYYQ---------DQLLP-----------------------VSRIIVHPQFYTAQIGADIALLELEEPVNVS--SHVHTVTLP--PASETFPP-GMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDS--CQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWI 274          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Human
Match: TMPRSS2 (transmembrane serine protease 2 [Source:HGNC Symbol;Acc:HGNC:11876])

HSP 1 Score: 96.6709 bits (239), Expect = 2.221e-21
Identity = 79/286 (27.62%), Postives = 117/286 (40.91%), Query Frame = 2
Query:  137 DKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
              R++GGE+A P  + W VS+      ++    CG SII  +    W++TAAHC           L  P  W A  G+++  F +  +G GY                               ++K+  HP+Y S    NDIALMKL  PL    L  V  + LP+ P +   P     C + GWG T+  G  +     A + + +  +C   +V    + P +  CAG+L+     C GDSG  L    +  W L G  S          P ++  V  F +WI
Sbjct:  253 QSRIVGGESALPGAWPWQVSL-----HVQNVHVCGGSIITPE----WIVTAAHCV-------EKPLNNPWHWTAFAGILRQSFMF--YGAGY------------------------------QVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDL--VKPVCLPN-PGMMLQPE--QLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITP-AMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWI 484          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Human
Match: TMPRSS2 (transmembrane serine protease 2 [Source:HGNC Symbol;Acc:HGNC:11876])

HSP 1 Score: 96.6709 bits (239), Expect = 2.251e-21
Identity = 79/286 (27.62%), Postives = 117/286 (40.91%), Query Frame = 2
Query:  137 DKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
              R++GGE+A P  + W VS+      ++    CG SII  +    W++TAAHC           L  P  W A  G+++  F +  +G GY                               ++K+  HP+Y S    NDIALMKL  PL    L  V  + LP+ P +   P     C + GWG T+  G  +     A + + +  +C   +V    + P +  CAG+L+     C GDSG  L    +  W L G  S          P ++  V  F +WI
Sbjct:  253 QSRIVGGESALPGAWPWQVSL-----HVQNVHVCGGSIITPE----WIVTAAHCV-------EKPLNNPWHWTAFAGILRQSFMF--YGAGY------------------------------QVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDL--VKPVCLPN-PGMMLQPE--QLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITP-AMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWI 484          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Human
Match: TMPRSS2 (transmembrane serine protease 2 [Source:HGNC Symbol;Acc:HGNC:11876])

HSP 1 Score: 96.6709 bits (239), Expect = 2.251e-21
Identity = 79/286 (27.62%), Postives = 117/286 (40.91%), Query Frame = 2
Query:  137 DKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
              R++GGE+A P  + W VS+      ++    CG SII  +    W++TAAHC           L  P  W A  G+++  F +  +G GY                               ++K+  HP+Y S    NDIALMKL  PL    L  V  + LP+ P +   P     C + GWG T+  G  +     A + + +  +C   +V    + P +  CAG+L+     C GDSG  L    +  W L G  S          P ++  V  F +WI
Sbjct:  253 QSRIVGGESALPGAWPWQVSL-----HVQNVHVCGGSIITPE----WIVTAAHCV-------EKPLNNPWHWTAFAGILRQSFMF--YGAGY------------------------------QVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDL--VKPVCLPN-PGMMLQPE--QLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITP-AMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWI 484          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Celegans
Match: svh-1 (HGF/MSP/plasminogen-like protein [Source:UniProtKB/TrEMBL;Acc:Q17800])

HSP 1 Score: 74.7146 bits (182), Expect = 3.090e-14
Identity = 79/293 (26.96%), Postives = 134/293 (45.73%), Query Frame = 2
Query:  143 RVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLP-IEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYA---KLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKY-DGRWMLAGVVS----AAHSKEPGQFPAIFTKVPSFKNWI 994
            RV+GG    P  + W  +++   ++   +  CGASI+    + + L+TAAHCF    ++ ++++                        G   NN+     +   +++F            ++++I  +P Y      +DIA++++  P P IE  +    I LP   +    P  G  CVV GWG   + G+   YA   + AL+ + +   C+++      ++  S FCAGYL+     C GDSG   AC+  DG ++LAGV+S     A  K+PG    I+T V  + +WI
Sbjct:  712 RVVGGFETVPGAFPWTAALR---NKATKAHHCGASIL----DKTHLITAAHCFEEDERVSSYEVVV----------------------GDWDNNQ-----TDGNEQIF------------YLQRIHFYPLYKDI-FSHDIAILEI--PYPGIEFNEYAQPICLPS-KDFVYTP--GRQCVVSGWG---SMGL--RYAERLQAALIPIINRFDCVNSSQIYSSMS-RSAFCAGYLEGGIDSCQGDSGGPFACRREDGAFVLAGVISWGDGCAQKKQPG----IYTMVAPYLSWI 942          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Celegans
Match: try-1 (TRYpsin-like protease [Source:UniProtKB/TrEMBL;Acc:Q23528])

HSP 1 Score: 71.2478 bits (173), Expect = 1.034e-13
Identity = 78/292 (26.71%), Postives = 113/292 (38.70%), Query Frame = 2
Query:  134 IDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDY-VSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCT-KAAGVPNTYAKLALLKVWDNDKC--IDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVS-AAHSKEPGQFPAIFTKVPSFKNWI 994
            +D R+IGG  + P  + W V +   +   +    CG S+I    + +++LTAAHCF    +        P  +  RVG          H  G  S ++                          +  + IHP Y +      D A+M+ I P P+        I LP +P +         CVV GWG T + + +     +   + +     C  +  ++  I L   S  CAGY   K   C GDSG  L C  DG W L GVVS       PG  P ++  V S   WI
Sbjct:   54 LDHRLIGGSESSPHSWPWTVQLLSRLGHHR----CGGSLI----DPNFVLTAAHCFAKDRR--------PTSYSVRVG---------GHRSGSGSPHR--------------------------VTAVSIHPWYNIGFPSSYDFAIMR-IHP-PVNTSTTARPICLPSLPAVEN-----RLCVVTGWGSTIEGSSLSAPTLREIHVPLLSTLFCSSLPNYIGRIHL--PSMLCAGYSYGKIDSCQGDSGGPLMCARDGHWELTGVVSWGIGCARPG-MPGVYGNVHSASTWI 284          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Celegans
Match: try-3 (TRYpsin-like protease [Source:UniProtKB/TrEMBL;Acc:Q94176])

HSP 1 Score: 51.9878 bits (123), Expect = 2.345e-7
Identity = 67/270 (24.81%), Postives = 108/270 (40.00%), Query Frame = 2
Query:  236 CGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCT---KAAGVPNTYAKLAL----LKVWDNDKCIDA--FVAPIDLNPES-EFCAG-YLKRKYGLCPGDSGSGLAC-KYDGRWMLAGVVSAAHSK-----EPGQFPAIFTKVPSFKNWI 994
            CGA++I       WL+TAAHC                       L    F Y +  +    NN+  SF                      +K+ +IH  Y +   +NDIAL+++   L    +K V  +   D   L K    G   VV+G+G T    ++G P       L    + +  +D C+    F++ + +     + CAG YL   +G  PGDSG  L   K +G ++  G+ S          + G+FP ++T++  +  WI
Sbjct:   16 CGATVIDD----FWLVTAAHCALQ--------------------LQTRSFVYVREPK----NNRERSF---------------------SVKEAYIHSGYNNQTADNDIALLRISSDLSKLGIKPVCLVH--DDSKLLKQYKNG---VVIGYGLTLGEDSSGEPKLINSQTLQSTSVPIISDDDCVKTWRFLSLLSVKITGYQICAGAYL---HGTAPGDSGGPLLIHKSNGEYVQIGITSYGADGLDGVIDQGKFPGVYTRISKYVPWI 228          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Celegans
Match: try-3 (TRYpsin-like protease [Source:UniProtKB/TrEMBL;Acc:Q94176])

HSP 1 Score: 51.9878 bits (123), Expect = 2.574e-7
Identity = 74/301 (24.58%), Postives = 120/301 (39.87%), Query Frame = 2
Query:  143 RVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCT---KAAGVPNTYAKLAL----LKVWDNDKCIDA--FVAPIDLNPES-EFCAG-YLKRKYGLCPGDSGSGLAC-KYDGRWMLAGVVSAAHSK-----EPGQFPAIFTKVPSFKNWI 994
            R+IGG +   D   W   +    D  +    CGA++I       WL+TAAHC                     + L    F Y +  +    NN+  SF                      +K+ +IH  Y +   +NDIAL+++   L    +K V  +   D   L K    G   VV+G+G T    ++G P       L    + +  +D C+    F++ + +     + CAG YL   +G  PGDSG  L   K +G ++  G+ S          + G+FP ++T++  +  WI
Sbjct:   37 RIIGGNSID-DGANWMAKLVSYGDNGQGI-LCGATVIDD----FWLVTAAHC--------------------ALQLQTRSFVYVREPK----NNRERSF---------------------SVKEAYIHSGYNNQTADNDIALLRISSDLSKLGIKPVCLVH--DDSKLLKQYKNG---VVIGYGLTLGEDSSGEPKLINSQTLQSTSVPIISDDDCVKTWRFLSLLSVKITGYQICAGAYL---HGTAPGDSGGPLLIHKSNGEYVQIGITSYGADGLDGVIDQGKFPGVYTRISKYVPWI 278          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Fly
Match: CG7432 (gene:FBgn0038727 transcript:FBtr0301213)

HSP 1 Score: 94.7449 bits (234), Expect = 8.360e-21
Identity = 87/292 (29.79%), Postives = 132/292 (45.21%), Query Frame = 2
Query:  143 RVIGGETAPPDKYRW--AVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPD---IPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHS-KEPGQFPAIFTKVPSFKNWILD 1000
            R++GG  AP  ++ W  A+ + G     +T   CG S+I TK    ++LTAAHC   S + K F   +   +  R+G +             LS +                  + VT     +K++  H  +      NDIA++ L  P  + + K V  + LP    +P   + P  G    VVGWG T   G  +T  + A L +W N+ C  ++  PI+   E+  CAGY       C GDSG  L  +YD  W+  GVVS  +   EPG +P ++T+V  + +WI D
Sbjct:  474 RIVGGVEAPNGQWPWMAAIFLHG---PKRTEFWCGGSLIGTK----YILTAAHCTRDSRQ-KPFAARQ---FTVRLGDID------------LSTD--------------AEPSDPVT---FAVKEVRTHERFSRIGFYNDIAILVLDKP--VRKSKYVIPVCLPKGIRMPPKERLP--GRRATVVGWGTTYYGGKESTSQRQAELPIWRNEDCDRSYFQPIN---ENFICAGYSDGGVDACQGDSGGPLMMRYDSHWVQLGVVSFGNKCGEPG-YPGVYTRVTEYLDWIRD 717          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Fly
Match: mas (gene:FBgn0011653 transcript:FBtr0332659)

HSP 1 Score: 88.5817 bits (218), Expect = 1.053e-18
Identity = 85/302 (28.15%), Postives = 130/302 (43.05%), Query Frame = 2
Query:   98 SLIFVVSISTGQIDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCI---DAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            SL  + S  +G+   RV+GGE     ++ W V++   +++      CGA++I T+    W+LTAAHC   +N +++ D       + RVG   +   Y   G   L                      V TT        +IH ++ S  L+NDIAL+KL       Q +  + + L  +P        G  C V G+G    AG      + A + +  + +CI   +A    I + P S FCAG  +  +  C GD G  L C+ DG + LAG+VS          P ++ K  SF  WI
Sbjct:  786 SLYGLQSNFSGRRRARVVGGEDGENGEWCWQVALINSLNQY----LCGAALIGTQ----WVLTAAHCV--TNIVRSGDAI-----YVRVGDYDLTRKYGSPGAQTL---------------------RVATT--------YIHHNHNSQTLDNDIALLKLHG-----QAELRDGVCLVCLPARGVSHAAGKRCTVTGYGYMGEAGPIPLRVREAEIPIVSDTECIRKVNAVTEKIFILPASSFCAGG-EEGHDACQGDGGGPLVCQDDGFYELAGLVSWGFGCGRQDVPGVYVKTSSFIGWI 1037          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Fly
Match: mas (gene:FBgn0011653 transcript:FBtr0073260)

HSP 1 Score: 88.5817 bits (218), Expect = 1.063e-18
Identity = 85/302 (28.15%), Postives = 130/302 (43.05%), Query Frame = 2
Query:   98 SLIFVVSISTGQIDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCI---DAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            SL  + S  +G+   RV+GGE     ++ W V++   +++      CGA++I T+    W+LTAAHC   +N +++ D       + RVG   +   Y   G   L                      V TT        +IH ++ S  L+NDIAL+KL       Q +  + + L  +P        G  C V G+G    AG      + A + +  + +CI   +A    I + P S FCAG  +  +  C GD G  L C+ DG + LAG+VS          P ++ K  SF  WI
Sbjct:  787 SLYGLQSNFSGRRRARVVGGEDGENGEWCWQVALINSLNQY----LCGAALIGTQ----WVLTAAHCV--TNIVRSGDAI-----YVRVGDYDLTRKYGSPGAQTL---------------------RVATT--------YIHHNHNSQTLDNDIALLKLHG-----QAELRDGVCLVCLPARGVSHAAGKRCTVTGYGYMGEAGPIPLRVREAEIPIVSDTECIRKVNAVTEKIFILPASSFCAGG-EEGHDACQGDGGGPLVCQDDGFYELAGLVSWGFGCGRQDVPGVYVKTSSFIGWI 1038          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Fly
Match: Sb (gene:FBgn0003319 transcript:FBtr0344008)

HSP 1 Score: 87.0409 bits (214), Expect = 2.973e-18
Identity = 78/315 (24.76%), Postives = 132/315 (41.90%), Query Frame = 2
Query:   71 AMRYIEFLSSLIFVVSIST-GQIDKRVIGGETAPPDKYRWAVSI-KGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFV--APIDLNPESEFCAGYLKRKYGLCPGDSGSGLACK-YDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILD 1000
            A+ +++ +S+      + T  + + R++GG++A   ++ W VS+ +       ++  CG ++I    N +W+ TA HC          DL   ++   R+ + + DF + +    Y+                              + K  +HP Y     E D+AL+KL  PL  E    V+ I LP+  +L     +G +  V GWG     G   +  +   + +  ND C   F+     +  P+   CAGY       C GDSG  L  K  DGR+ LAG++S          P + T++  F  WIL+
Sbjct:  518 ALGHVKTISAARSECGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALI----NENWIATAGHCV--------DDLLISQI---RIRVGEYDFSHVQEQLPYIERG---------------------------VAKKVVHPKYSFLTYEYDLALVKLEQPL--EFAPHVSPICLPETDSLL----IGMNATVTGWGRLSEGGTLPSVLQEVSVPIVSNDNCKSMFMRAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRISKFTPWILE 784          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Fly
Match: Sb (gene:FBgn0003319 transcript:FBtr0083250)

HSP 1 Score: 87.0409 bits (214), Expect = 2.973e-18
Identity = 78/315 (24.76%), Postives = 132/315 (41.90%), Query Frame = 2
Query:   71 AMRYIEFLSSLIFVVSIST-GQIDKRVIGGETAPPDKYRWAVSI-KGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFV--APIDLNPESEFCAGYLKRKYGLCPGDSGSGLACK-YDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILD 1000
            A+ +++ +S+      + T  + + R++GG++A   ++ W VS+ +       ++  CG ++I    N +W+ TA HC          DL   ++   R+ + + DF + +    Y+                              + K  +HP Y     E D+AL+KL  PL  E    V+ I LP+  +L     +G +  V GWG     G   +  +   + +  ND C   F+     +  P+   CAGY       C GDSG  L  K  DGR+ LAG++S          P + T++  F  WIL+
Sbjct:  518 ALGHVKTISAARSECGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALI----NENWIATAGHCV--------DDLLISQI---RIRVGEYDFSHVQEQLPYIERG---------------------------VAKKVVHPKYSFLTYEYDLALVKLEQPL--EFAPHVSPICLPETDSLL----IGMNATVTGWGRLSEGGTLPSVLQEVSVPIVSNDNCKSMFMRAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRISKFTPWILE 784          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Zebrafish
Match: CU062628.1 (trypsin-2-like [Source:NCBI gene;Acc:103908930])

HSP 1 Score: 98.2117 bits (243), Expect = 2.665e-23
Identity = 86/301 (28.57%), Postives = 128/301 (42.52%), Query Frame = 2
Query:  104 IFVVSISTGQIDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVS-AAHSKEPGQFPAIFTKVPSFKNWILDT 1003
            + VV+++   +DK +IGG   PP+   W + I  D         CGAS+I    N SW ++AAHC   +N +  +           +G   +D   K   R                               I  +K+F HP++     +NDI L+KL DP    Q        +  IP  T     G  C+V GWG T+  G+P+    L L  V    +C   +    D   ++  CAG+++   G+C GDSG  L C  +    L GVVS  A   EPG +PA++ +V  + +WI  T
Sbjct:    8 LLVVNVACSPVDK-IIGGYECPPNSQPWQIYITNDGQRW-----CGASLI----NESWAVSAAHCNIGANLLTVY-----------LGKHNIDVVEKTEQR-------------------------------IRTEKVFPHPEFKFPSEDNDIMLIKLKDPAVFNQY-------VQPIPLATSCSSEGEQCLVSGWGYTEV-GLPSVLQCLDL-AVQSRQECERVYK---DKFTQNMLCAGFMEGGKGVCHGDSGGPLVCNGE----LRGVVSWGAGCAEPG-YPAVYVEVCRYSDWIATT 239          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Zebrafish
Match: tmprss9 (transmembrane serine protease 9 [Source:ZFIN;Acc:ZDB-GENE-050208-573])

HSP 1 Score: 101.293 bits (251), Expect = 7.536e-23
Identity = 81/291 (27.84%), Postives = 135/291 (46.39%), Query Frame = 2
Query:  134 IDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTK--AAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKY-DGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWIL 997
            +  R++GGE     ++ W VS++     L+    CGASI+ ++    WL++AAHCF   N         P+ W A VG                  N++    ++AF               ++IK + + P Y     ++D+ +++L  PL     K  + ++   IP+ +     G +C+V GWG        VP+T  K A++K+ D+  C  + V    L  ++  CAG+L+ K   C GDSG  LAC+   GR+ LAG+VS          P ++++V   +NWI+
Sbjct:  228 MSNRIVGGENTRHGEFPWQVSLR-----LRGRHTCGASIVNSR----WLVSAAHCFEVENN--------PKDWTALVGA-----------------NQVSGAEAEAFI--------------VNIKSLVMSPKYDPMTTDSDVTVLELETPL-----KFSHYVQPVCIPSSSHVFTPGQNCIVSGWGALNQYTTEVPSTLQK-AIVKIIDSKVCNKSSVYRGALT-QNMMCAGFLQGKVDSCQGDSGGPLACEVAAGRYFLAGIVSWGVGCAQINKPGVYSRVTKLRNWIV 463          

HSP 2 Score: 90.5077 bits (223), Expect = 3.127e-19
Identity = 77/289 (26.64%), Postives = 121/289 (41.87%), Query Frame = 2
Query:  137 DKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPV--GSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYD-GRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
             +R+IGG TA   ++ W  S+     + +    CGA++I  K    WLLTAAHC                            F    +  GY  +  L S        L            I +++I  HP + S+ ++ D+AL+++  P P  +   + T+ LP     + W       +C ++GWG  +  G+     + A + V D   C  A+ A +  N     CAGY++ +   C GDSG  L C+   GRW LAGV S  H      FP ++ +  + + WI
Sbjct:  554 QERIIGGVTARRGEWPWVGSL-----QYQRIHRCGATLIHCK----WLLTAAHC----------------------------FRGDLNPAGYTVS--LGSVIWSGLGALV-----------IPVQRIIPHPAFNSSTMDLDVALVEISIPAP--KSYTIQTVCLP-----SPWHSFIKSMECYIIGWGAVREDGMITNLLQKAQVGVIDQSDCQRAYGAELTDN---MMCAGYMEGQRDTCLGDSGGPLVCRETLGRWFLAGVTSWGHGCGRIGFPGVYMRATAVREWI 782          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Zebrafish
Match: tmprss9 (transmembrane serine protease 9 [Source:ZFIN;Acc:ZDB-GENE-050208-573])

HSP 1 Score: 101.293 bits (251), Expect = 8.410e-23
Identity = 81/291 (27.84%), Postives = 135/291 (46.39%), Query Frame = 2
Query:  134 IDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTK--AAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKY-DGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWIL 997
            +  R++GGE     ++ W VS++     L+    CGASI+ ++    WL++AAHCF   N         P+ W A VG                  N++    ++AF               ++IK + + P Y     ++D+ +++L  PL     K  + ++   IP+ +     G +C+V GWG        VP+T  K A++K+ D+  C  + V    L  ++  CAG+L+ K   C GDSG  LAC+   GR+ LAG+VS          P ++++V   +NWI+
Sbjct:  240 MSNRIVGGENTRHGEFPWQVSLR-----LRGRHTCGASIVNSR----WLVSAAHCFEVENN--------PKDWTALVGA-----------------NQVSGAEAEAFI--------------VNIKSLVMSPKYDPMTTDSDVTVLELETPL-----KFSHYVQPVCIPSSSHVFTPGQNCIVSGWGALNQYTTEVPSTLQK-AIVKIIDSKVCNKSSVYRGALT-QNMMCAGFLQGKVDSCQGDSGGPLACEVAAGRYFLAGIVSWGVGCAQINKPGVYSRVTKLRNWIV 475          

HSP 2 Score: 90.1225 bits (222), Expect = 3.485e-19
Identity = 77/289 (26.64%), Postives = 121/289 (41.87%), Query Frame = 2
Query:  137 DKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPV--GSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYD-GRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
             +R+IGG TA   ++ W  S+     + +    CGA++I  K    WLLTAAHC                            F    +  GY  +  L S        L            I +++I  HP + S+ ++ D+AL+++  P P  +   + T+ LP     + W       +C ++GWG  +  G+     + A + V D   C  A+ A +  N     CAGY++ +   C GDSG  L C+   GRW LAGV S  H      FP ++ +  + + WI
Sbjct:  566 QERIIGGVTARRGEWPWVGSL-----QYQRIHRCGATLIHCK----WLLTAAHC----------------------------FRGDLNPAGYTVS--LGSVIWSGLGALV-----------IPVQRIIPHPAFNSSTMDLDVALVEISIPAP--KSYTIQTVCLP-----SPWHSFIKSMECYIIGWGAVREDGMITNLLQKAQVGVIDQSDCQRAYGAELTDN---MMCAGYMEGQRDTCLGDSGGPLVCRETLGRWFLAGVTSWGHGCGRIGFPGVYMRATAVREWI 794          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Zebrafish
Match: CR352265.1 (pep chromosome:GRCz11:24:21813127:21819010:-1 gene:ENSDARG00000062758.6 transcript:ENSDART00000091096.6 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR352265.1)

HSP 1 Score: 93.9745 bits (232), Expect = 2.048e-21
Identity = 76/288 (26.39%), Postives = 122/288 (42.36%), Query Frame = 2
Query:  143 RVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKC---IDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGR-WMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            +++GG  A    + W VS++ +    +    CGAS++ ++    WL++AAHCF  S+ IK  D      W A +G+                             ++  +  N   T    I++I +H  Y     + DIAL++L  P+   +L     ++   +P  +     G+ C V GWG     G   T  + A + + +++ C    D  V P  L      CAG ++     C GDSG  L C   GR W LAG+VS          P ++T+V  F +WI
Sbjct:   54 KIVGGTDAQAGSWPWQVSLQME----RYGHVCGASLVASR----WLVSAAHCFQDSDAIKYSDARS---WRAYMGM-----------------------------RVMNSVSNAAAT--RQIRRIVLHSQYDQFTSDYDIALLELSAPVFFNEL-----VQPVCVPAPSHVFTSGTSCFVTGWGVLTEEGELATLLQEATVNIINHNTCNKMYDDAVTPRML------CAGNIQGGVDACQGDSGGPLVCLERGRRWFLAGIVSWGEGCARQNRPGVYTRVIKFTDWI 288          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Zebrafish
Match: st14a (suppression of tumorigenicity 14a [Source:ZFIN;Acc:ZDB-GENE-030131-6496])

HSP 1 Score: 95.9005 bits (237), Expect = 4.472e-21
Identity = 82/285 (28.77%), Postives = 121/285 (42.46%), Query Frame = 2
Query:  143 RVIGGETAPPDKYRWAVSIKGDVDELKT-SGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            R++GG+ A   ++ W VS+      +K  +  CG SII    N  W++TAAHC     KIK    ++P  W   +GL             +   +KL      A K+L              +K++  HP Y +   +NDIALM++  P+        +TI    +P  T   P G+   + GWG T+  G   T  + A +++ ++  C       I        CAG L      C GDSG  L+     R  LAGVVS          P I++ VP F+ WI
Sbjct:  596 RIVGGQDAFEGEFPWQVSL-----HIKNIAHVCGGSII----NERWIVTAAHCVQDDVKIK---YSQPGTWEVFLGL-------------HSQKDKLT-----ATKRL--------------LKQVIPHPYYNAYTYDNDIALMEMESPVTFS-----DTIRPVCLPTATDTFPAGTSVFISGWGATREGGSGATVLQKAEVRIINSTVCNQLMGGQI---TSRMTCAGVLSGGVDACQGDSGGPLSFPSGKRMFLAGVVSWGDGCARRNKPGIYSNVPKFRAWI 828          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Xenopus
Match: TMPRSS9 (transmembrane serine protease 9 [Source:NCBI gene;Acc:100489279])

HSP 1 Score: 112.079 bits (279), Expect = 3.052e-26
Identity = 86/286 (30.07%), Postives = 132/286 (46.15%), Query Frame = 2
Query:  143 RVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDL-TKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKY-DGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            +++GG  +   ++ W VS+     E K    CGA +I  +    WLL+AAHCF         D+ + P+LW A +G     F     GR                +K+F               +I  HP Y    L+ND+AL++L  PL    L  +  I LPDI ++    P G+ C + GWG TK  G  +   + A + +  +  C   +  PI ++P    CAG+++     C GD+G  LAC+   GRW LAG+ S  +      FP ++T++ S +NWI
Sbjct:  861 KIVGGSGSVRGEWPWQVSLWLRRKEHK----CGAVLISDR----WLLSAAHCF---------DIYSDPKLWAAYLG---TPFLNGVEGR---------------VEKIF---------------RIHKHPFYNVYTLDNDVALLELPSPLTYTNL--IRPICLPDISHIF---PEGTRCFITGWGSTKEGGAMSRQLQKASVSIVGDQTCKKFY--PIQISPRM-LCAGFMQGGVDSCSGDAGGPLACREPSGRWFLAGITSWGYGCARPYFPGVYTRITSVRNWI 1088          

HSP 2 Score: 101.679 bits (252), Expect = 9.329e-23
Identity = 82/293 (27.99%), Postives = 124/293 (42.32%), Query Frame = 2
Query:  131 QIDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGV--PNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKY-DGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILD 1000
            Q   R++GG  A   ++ W VS++ + +       CGA++I  K    WL++AAHCF         D   P +W A                 Y++   L    S   K                I+ I  HP Y     + D+A+++L  PL     K    + LPD  ++    PVG  C++ GWG  K   +  P    K A + + D   C   +    ++  E   CAGYL+ K   C GDSG  L C+   G++ LAG+VS        + P ++ +V   +NWILD
Sbjct:  233 QKTNRIVGGSDATKGEFPWQVSLRENNEHF-----CGATVIGDK----WLVSAAHCF--------NDFQDPAVWVA-----------------YIATTSLSGTDSSTVKAT--------------IRNIIKHPSYDPDTADYDVAVLELDSPLKFN--KYTQPVCLPDPTHVF---PVGKKCIITGWGYLKEDNLVKPEVLQK-ATVAIMDQSLCNSLYS---NVVTERMLCAGYLEGKIDSCQGDSGGPLVCEEPSGKFFLAGIVSWGVGCAEARRPGVYVRVSKIRNWILD 468          

HSP 3 Score: 84.3445 bits (207), Expect = 5.019e-17
Identity = 85/294 (28.91%), Postives = 122/294 (41.50%), Query Frame = 2
Query:  143 RVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGV--PNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYD-GRWMLAGVVS----AAHSKEPGQFPAIFTKVPSFKNWILDT 1003
            +++GG  A   +  W  S+K           CGA+II  +    WL++AAHCF                        KVD      G   LS    I+                     I +K++  HP +    L+ D+A+++L   L     K V  + LP    L K+P  G  C++ GWG  K   V  P    K A + + D   C   +   I    E   CAG+L  K   C GDSG  LAC+   G + LAG+VS     A +K+PG    ++++V   K+WILDT
Sbjct:  530 KIVGGLDAVRGEIPWQASLKEGSRHF-----CGATIIGDR----WLVSAAHCF---------------------NQTKVDQVTAHMGSTALSGADTIAI-------------------KISLKRVIQHPHFNPLTLDFDVAVLELASSLTFN--KYVQPVCLPSA--LQKFP-AGWKCMISGWGNIKEGNVSKPEVLQK-ASVGIIDQKICSVLYNFSIT---ERMICAGFLDGKVDSCQGDSGGPLACEESPGIFFLAGIVSWGIGCAQAKKPG----VYSRVTKLKDWILDT 761          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Xenopus
Match: TMPRSS9 (transmembrane serine protease 9 [Source:NCBI gene;Acc:100489279])

HSP 1 Score: 110.923 bits (276), Expect = 5.720e-26
Identity = 86/286 (30.07%), Postives = 132/286 (46.15%), Query Frame = 2
Query:  143 RVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDL-TKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKY-DGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            +++GG  +   ++ W VS+     E K    CGA +I  +    WLL+AAHCF         D+ + P+LW A +G     F     GR                +K+F               +I  HP Y    L+ND+AL++L  PL    L  +  I LPDI ++    P G+ C + GWG TK  G  +   + A + +  +  C   +  PI ++P    CAG+++     C GD+G  LAC+   GRW LAG+ S  +      FP ++T++ S +NWI
Sbjct:  659 KIVGGSGSVRGEWPWQVSLWLRRKEHK----CGAVLISDR----WLLSAAHCF---------DIYSDPKLWAAYLG---TPFLNGVEGR---------------VEKIF---------------RIHKHPFYNVYTLDNDVALLELPSPLTYTNL--IRPICLPDISHIF---PEGTRCFITGWGSTKEGGAMSRQLQKASVSIVGDQTCKKFY--PIQISPRM-LCAGFMQGGVDSCSGDAGGPLACREPSGRWFLAGITSWGYGCARPYFPGVYTRITSVRNWI 886          

HSP 2 Score: 100.908 bits (250), Expect = 1.665e-22
Identity = 82/293 (27.99%), Postives = 124/293 (42.32%), Query Frame = 2
Query:  131 QIDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGV--PNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKY-DGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILD 1000
            Q   R++GG  A   ++ W VS++ + +       CGA++I  K    WL++AAHCF         D   P +W A                 Y++   L    S   K                I+ I  HP Y     + D+A+++L  PL     K    + LPD  ++    PVG  C++ GWG  K   +  P    K A + + D   C   +    ++  E   CAGYL+ K   C GDSG  L C+   G++ LAG+VS        + P ++ +V   +NWILD
Sbjct:   46 QKTNRIVGGSDATKGEFPWQVSLRENNEHF-----CGATVIGDK----WLVSAAHCF--------NDFQDPAVWVA-----------------YIATTSLSGTDSSTVKAT--------------IRNIIKHPSYDPDTADYDVAVLELDSPLKFN--KYTQPVCLPDPTHVF---PVGKKCIITGWGYLKEDNLVKPEVLQK-ATVAIMDQSLCNSLYS---NVVTERMLCAGYLEGKIDSCQGDSGGPLVCEEPSGKFFLAGIVSWGVGCAEARRPGVYVRVSKIRNWILD 281          

HSP 3 Score: 83.1889 bits (204), Expect = 1.023e-16
Identity = 82/290 (28.28%), Postives = 118/290 (40.69%), Query Frame = 2
Query:  143 RVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGV--PNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYD-GRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILDT 1003
            +++GG  A   +  W  S+K           CGA+II  +    WL++AAHCF                        KVD      G   LS    I+                     I +K++  HP +    L+ D+A+++L   L     K V  + LP    L K+P  G  C++ GWG  K   V  P    K A + + D   C   +   I    E   CAG+L  K   C GDSG  LAC+   G + LAG+VS        + P ++++V   K+WILDT
Sbjct:  343 KIVGGLDAVRGEIPWQASLKEGSRHF-----CGATIIGDR----WLVSAAHCF---------------------NQTKVDQVTAHMGSTALSGADTIAI-------------------KISLKRVIQHPHFNPLTLDFDVAVLELASSLTFN--KYVQPVCLPSA--LQKFP-AGWKCMISGWGNIKEGNVSKPEVLQK-ASVGIIDQKICSVLYNFSIT---ERMICAGFLDGKVDSCQGDSGGPLACEESPGIFFLAGIVSWGIGCAQAKKPGVYSRVTKLKDWILDT 574          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000014785.1 (transmembrane serine protease 11F [Source:NCBI gene;Acc:100379970])

HSP 1 Score: 102.834 bits (255), Expect = 9.908e-25
Identity = 78/296 (26.35%), Postives = 123/296 (41.55%), Query Frame = 2
Query:  107 FVVSISTGQIDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            F   I    +  R++GG  A    + W  S++     L  S  CGAS++    N +WL+ AAHCF  +    +        W   +G +                                   NV +  +  I+KI I+  Y S    NDIAL+KL  PL    +  +  + LP+  ++    P GS C + GWG     G  +   + A +K+ ++D C  + +    + P S  CAGY   +   C GDSG  L     GRW+L G+VS  +       P +++++   +NWI
Sbjct:   12 FSCGIGGPSVSNRIVGGTNAGLGSWPWQASLR-----LLGSHTCGASLL----NDTWLVAAAHCFDMNADANS--------WTVVLGTI-----------------------------------NVYSGSEFKIEKIIIYEGYTSHNHRNDIALLKLFTPLNFTSI--IRPVCLPEASDIF---PDGSSCYITGWGALTDGGSASQVLQQAEVKIINSDTCSSSQMYGGLIYP-SMICAGYATGQIDSCQGDSGGPLVTLKSGRWVLIGIVSFGYGCALPNKPGVYSRITYLRNWI 249          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000014815.1 (transmembrane serine protease 11F [Source:NCBI gene;Acc:100379970])

HSP 1 Score: 103.219 bits (256), Expect = 1.441e-24
Identity = 78/296 (26.35%), Postives = 123/296 (41.55%), Query Frame = 2
Query:  107 FVVSISTGQIDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            F   I    +  R++GG  A    + W  S++     L  S  CGAS++    N +WL+ AAHCF  +    +        W   +G +                                   NV +  +  I+KI I+  Y S    NDIAL+KL  PL    +  +  + LP+  ++    P GS C + GWG     G  +   + A +K+ ++D C  + +    + P S  CAGY   +   C GDSG  L     GRW+L G+VS  +       P +++++   +NWI
Sbjct:   48 FTCGIGGPSVSNRIVGGTNAGLGSWPWQASLR-----LLGSHTCGASLL----NDTWLVAAAHCFDMNADANS--------WTVVLGTI-----------------------------------NVYSGSEFKIEKIIIYEGYTSHNHRNDIALLKLFTPLNFTSI--IRPVCLPEASDIF---PDGSSCYITGWGALTDGGSASQVLQQAEVKIINSDTCSSSQMYGGLIYP-SMICAGYATGQIDSCQGDSGGPLVTLKSGRWVLIGIVSFGYGCALPNKPGVYSRITYLRNWI 285          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000030355.1 (transmembrane serine protease 11F [Source:NCBI gene;Acc:100379970])

HSP 1 Score: 101.679 bits (252), Expect = 1.757e-24
Identity = 76/288 (26.39%), Postives = 121/288 (42.01%), Query Frame = 2
Query:  131 QIDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
             +  R++GG  A    + W  S++     L  S  CGAS++    N +WL+ AAHCF  +    +        W   +G +                                   NV +  +  I+KI I+  Y S    NDIAL+KL  PL    +  +  + LP+  ++    P GS C + GWG     G  +   + A +K+ ++D C  + +    + P S  CAGY   +   C GDSG  L     GRW+L G+VS  +       P +++++   +NWI
Sbjct:   11 SVSNRIVGGTNAGLGSWPWQASLR-----LLGSHTCGASLL----NDTWLVAAAHCFDMNADANS--------WTVVLGTI-----------------------------------NVYSGSEFKIEKIIIYEGYTSHNHRNDIALLKLFTPLNFTSI--IRPVCLPEASDIF---PDGSSCYITGWGALTDGGSASQVLQQAEVKIINSDTCSSSQMYGGLIYP-SMICAGYATGQIDSCQGDSGGPLVTLKSGRWVLIGIVSFGYGCALPNKPGVYSRITYLRNWI 240          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Mouse
Match: Klkb1 (kallikrein B, plasma 1 [Source:MGI Symbol;Acc:MGI:102849])

HSP 1 Score: 105.916 bits (263), Expect = 2.130e-24
Identity = 81/292 (27.74%), Postives = 128/292 (43.84%), Query Frame = 2
Query:  125 TGQIDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILD 1000
            T +I+ R++GG  A   ++ W VS++  V  +  +  CG SII  +    W+LTAAHCF          +  P++W    G++ +    K+                               T    IK++ IH +Y  +    DIAL+KL  PL   + +    I LP   +      + ++C V GWG TK  G      + A + +  N++C   +   + +N +   CAGY +     C GDSG  L CK+ GRW L G+ S          P ++TKV  + +WIL+
Sbjct:  384 TTKINARIVGGTNASLGEWPWQVSLQ--VKLVSQTHLCGGSIIGRQ----WVLTAAHCF--------DGIPYPDVWRIYGGILSLSEITKE-------------------------------TPSSRIKELIIHQEYKVSEGNYDIALIKLQTPLNYTEFQ--KPICLPSKADTNT---IYTNCWVTGWGYTKEQGETQNILQKATIPLVPNEECQKKYRDYV-INKQM-ICAGYKEGGTDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKDQPGVYTKVSEYMDWILE 623          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Mouse
Match: Tmprss3 (transmembrane protease, serine 3 [Source:MGI Symbol;Acc:MGI:2155445])

HSP 1 Score: 100.523 bits (249), Expect = 6.415e-23
Identity = 83/284 (29.23%), Postives = 120/284 (42.25%), Query Frame = 2
Query:  143 RVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            R++GG  +   ++ W VS+     + +    CG SII       W++TAAHC         +DL  P+ W  +VGL+             L ++ + S                       ++KI  H  Y   RL NDIALMKL +PL  ++     TI+   +PN  +  P G  C   GWG T+  G  +     A + +  N  C    V    ++P S  CAGYLK     C GDSG  L C+    W L G  S          P ++T++ SF +WI
Sbjct:  214 RIVGGNMSSLTQWPWQVSL-----QFQGYHLCGGSIITPL----WIVTAAHC--------VYDLYHPKSWTVQVGLVS------------LMDSPVPSHL---------------------VEKIIYHSKYKPKRLGNDIALMKLSEPLTFDE-----TIQPICLPNSEENFPDGKLCWTSGWGATEDGGDASPVLNHAAVPLISNKICNHRDVYGGIISP-SMLCAGYLKGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDWI 441          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Mouse
Match: Tmprss3 (transmembrane protease, serine 3 [Source:MGI Symbol;Acc:MGI:2155445])

HSP 1 Score: 100.523 bits (249), Expect = 6.444e-23
Identity = 83/284 (29.23%), Postives = 120/284 (42.25%), Query Frame = 2
Query:  143 RVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            R++GG  +   ++ W VS+     + +    CG SII       W++TAAHC         +DL  P+ W  +VGL+             L ++ + S                       ++KI  H  Y   RL NDIALMKL +PL  ++     TI+   +PN  +  P G  C   GWG T+  G  +     A + +  N  C    V    ++P S  CAGYLK     C GDSG  L C+    W L G  S          P ++T++ SF +WI
Sbjct:  216 RIVGGNMSSLTQWPWQVSL-----QFQGYHLCGGSIITPL----WIVTAAHC--------VYDLYHPKSWTVQVGLVS------------LMDSPVPSHL---------------------VEKIIYHSKYKPKRLGNDIALMKLSEPLTFDE-----TIQPICLPNSEENFPDGKLCWTSGWGATEDGGDASPVLNHAAVPLISNKICNHRDVYGGIISP-SMLCAGYLKGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDWI 443          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Mouse
Match: Tmprss3 (transmembrane protease, serine 3 [Source:MGI Symbol;Acc:MGI:2155445])

HSP 1 Score: 100.523 bits (249), Expect = 6.444e-23
Identity = 83/284 (29.23%), Postives = 120/284 (42.25%), Query Frame = 2
Query:  143 RVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            R++GG  +   ++ W VS+     + +    CG SII       W++TAAHC         +DL  P+ W  +VGL+             L ++ + S                       ++KI  H  Y   RL NDIALMKL +PL  ++     TI+   +PN  +  P G  C   GWG T+  G  +     A + +  N  C    V    ++P S  CAGYLK     C GDSG  L C+    W L G  S          P ++T++ SF +WI
Sbjct:  216 RIVGGNMSSLTQWPWQVSL-----QFQGYHLCGGSIITPL----WIVTAAHC--------VYDLYHPKSWTVQVGLVS------------LMDSPVPSHL---------------------VEKIIYHSKYKPKRLGNDIALMKLSEPLTFDE-----TIQPICLPNSEENFPDGKLCWTSGWGATEDGGDASPVLNHAAVPLISNKICNHRDVYGGIISP-SMLCAGYLKGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDWI 443          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Mouse
Match: Tmprss3 (transmembrane protease, serine 3 [Source:MGI Symbol;Acc:MGI:2155445])

HSP 1 Score: 100.523 bits (249), Expect = 7.486e-23
Identity = 83/284 (29.23%), Postives = 120/284 (42.25%), Query Frame = 2
Query:  143 RVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            R++GG  +   ++ W VS+     + +    CG SII       W++TAAHC         +DL  P+ W  +VGL+             L ++ + S                       ++KI  H  Y   RL NDIALMKL +PL  ++     TI+   +PN  +  P G  C   GWG T+  G  +     A + +  N  C    V    ++P S  CAGYLK     C GDSG  L C+    W L G  S          P ++T++ SF +WI
Sbjct:  238 RIVGGNMSSLTQWPWQVSL-----QFQGYHLCGGSIITPL----WIVTAAHC--------VYDLYHPKSWTVQVGLVS------------LMDSPVPSHL---------------------VEKIIYHSKYKPKRLGNDIALMKLSEPLTFDE-----TIQPICLPNSEENFPDGKLCWTSGWGATEDGGDASPVLNHAAVPLISNKICNHRDVYGGIISP-SMLCAGYLKGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDWI 465          
BLAST of Peptidase S1 domain-containing protein vs. UniProt/SwissProt
Match: sp|P26262|KLKB1_MOUSE (Plasma kallikrein OS=Mus musculus OX=10090 GN=Klkb1 PE=1 SV=2)

HSP 1 Score: 105.916 bits (263), Expect = 1.490e-23
Identity = 81/292 (27.74%), Postives = 128/292 (43.84%), Query Frame = 2
Query:  125 TGQIDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILD 1000
            T +I+ R++GG  A   ++ W VS++  V  +  +  CG SII  +    W+LTAAHCF          +  P++W    G++ +    K+                               T    IK++ IH +Y  +    DIAL+KL  PL   + +    I LP   +      + ++C V GWG TK  G      + A + +  N++C   +   + +N +   CAGY +     C GDSG  L CK+ GRW L G+ S          P ++TKV  + +WIL+
Sbjct:  384 TTKINARIVGGTNASLGEWPWQVSLQ--VKLVSQTHLCGGSIIGRQ----WVLTAAHCF--------DGIPYPDVWRIYGGILSLSEITKE-------------------------------TPSSRIKELIIHQEYKVSEGNYDIALIKLQTPLNYTEFQ--KPICLPSKADTNT---IYTNCWVTGWGYTKEQGETQNILQKATIPLVPNEECQKKYRDYV-INKQM-ICAGYKEGGTDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKDQPGVYTKVSEYMDWILE 623          
BLAST of Peptidase S1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q2KJ63|KLKB1_BOVIN (Plasma kallikrein OS=Bos taurus OX=9913 GN=KLKB1 PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 2.543e-22
Identity = 82/288 (28.47%), Postives = 127/288 (44.10%), Query Frame = 2
Query:  143 RVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAG-VPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEF-CAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILD 1000
            R++GG  A   ++ W VS++  V +   S  CG SII  +    W+LTAAHCF                                       +  L+S   + +  +   S+    T    IK+I +HP+Y  +   +DIAL+KL  PL    L+    I LP   +     PV +DC + GWG T+  G + NT  K A + +  N++C  ++    D     +  CAGY +     C GDSG  L C+++  W L G+ S        + P ++TKV  + +WIL+
Sbjct:  391 RIVGGTNASWGEWPWQVSLQ--VKQRAQSHLCGGSIIGRQ----WVLTAAHCF---------------------------------------DGLLLSNIWRIYGGILNLSEITTETSFSQIKEIIVHPNYKISEGSHDIALIKLEAPLNFTDLQ--KAICLPSKDDT---KPVYTDCWITGWGFTEEKGKIQNTLQK-ANIPLISNEECQKSYR---DYKITKQMICAGYKEGGKDACKGDSGGPLVCQHEETWHLVGITSWGEGCARREQPGVYTKVAEYVDWILE 624          
BLAST of Peptidase S1 domain-containing protein vs. UniProt/SwissProt
Match: sp|P14272|KLKB1_RAT (Plasma kallikrein OS=Rattus norvegicus OX=10116 GN=Klkb1 PE=1 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 3.218e-22
Identity = 79/292 (27.05%), Postives = 127/292 (43.49%), Query Frame = 2
Query:  125 TGQIDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILD 1000
            T +I+ R++GG  +   ++ W VS++  V  +  +  CG SII  +    W+LTAAHCF          +  P++W    G++ +           ++N    S                       IK++ IH  Y  +    DIAL+KL  PL   + +    I LP   +      + ++C V GWG TK  G      + A + +  N++C   +   +    +   CAGY +     C GDSG  L CK+ GRW L G+ S        + P ++TKV  + +WIL+
Sbjct:  384 TTKINARIVGGTNSSLGEWPWQVSLQ--VKLVSQNHMCGGSIIGRQ----WILTAAHCF--------DGIPYPDVWRIYGGILNLS---------EITNKTPFS----------------------SIKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQ--KPICLPSKADTNT---IYTNCWVTGWGYTKERGETQNILQKATIPLVPNEECQKKYRDYVIT--KQMICAGYKEGGIDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILE 623          
BLAST of Peptidase S1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8K1T0|TMPS3_MOUSE (Transmembrane protease serine 3 OS=Mus musculus OX=10090 GN=Tmprss3 PE=1 SV=2)

HSP 1 Score: 100.523 bits (249), Expect = 4.507e-22
Identity = 83/284 (29.23%), Postives = 120/284 (42.25%), Query Frame = 2
Query:  143 RVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            R++GG  +   ++ W VS+     + +    CG SII       W++TAAHC         +DL  P+ W  +VGL+             L ++ + S                       ++KI  H  Y   RL NDIALMKL +PL  ++     TI+   +PN  +  P G  C   GWG T+  G  +     A + +  N  C    V    ++P S  CAGYLK     C GDSG  L C+    W L G  S          P ++T++ SF +WI
Sbjct:  216 RIVGGNMSSLTQWPWQVSL-----QFQGYHLCGGSIITPL----WIVTAAHC--------VYDLYHPKSWTVQVGLVS------------LMDSPVPSHL---------------------VEKIIYHSKYKPKRLGNDIALMKLSEPLTFDE-----TIQPICLPNSEENFPDGKLCWTSGWGATEDGGDASPVLNHAAVPLISNKICNHRDVYGGIISP-SMLCAGYLKGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDWI 443          
BLAST of Peptidase S1 domain-containing protein vs. UniProt/SwissProt
Match: sp|P69525|TMPS9_MOUSE (Transmembrane protease serine 9 OS=Mus musculus OX=10090 GN=Tmprss9 PE=3 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 7.012e-21
Identity = 79/289 (27.34%), Postives = 126/289 (43.60%), Query Frame = 2
Query:  143 RVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGV--PNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKY-DGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILD 1000
            R++GG  A P ++ W VS++ + +       CGA+II  +    WL++AAHCF         +   P  W A+ G +                             L G+  + V T  + I K   HP Y +   + D+A+++L  PLP  +      ++   +P  T   P G  C++ GWG  K   +  P    K A +++ D   C   +   +    +   CAGYL  K   C GDSG  L C+   GR+ LAG+VS        + P ++T+V   ++WIL+
Sbjct:  204 RIVGGVEAAPGEFPWQVSLRENHEHF-----CGATIIGAR----WLVSAAHCFN--------EFQDPAQWAAQAGSVH----------------------------LSGSEASAVRTRVLRIAK---HPAYDADTADFDVAVLELARPLPFGRY-----VQPACLPAATHVFPPGKKCLISGWGYLKEDFLVKPEVLQK-ATVELLDQSLCSSLYGHSLT---DRMVCAGYLDGKVDSCQGDSGGPLVCEEPSGRFFLAGIVSWGIGCAEARRPGVYTRVTRLRDWILE 435          

HSP 2 Score: 89.3521 bits (220), Expect = 6.599e-18
Identity = 77/286 (26.92%), Postives = 120/286 (41.96%), Query Frame = 2
Query:  143 RVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDL-TKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKY-DGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            R++GG  A   ++ W VS+     E +    CGA ++  +    WLL+AAHCF         D+   P  W A +G                       F S    +L              + +I+ HP Y    L+ D+AL++L  P+   +L  V  I LP        PP G+ CV+ GWG  +  G      + A ++V     C   +  P+ ++     CAG+ +     C GD+G  LAC+   G+W+L GV S  +      FP ++T+V +   WI
Sbjct:  833 RIVGGSAASLGEWPWQVSLWLRRREHR----CGAVLVAER----WLLSAAHCF---------DIYGDPMQWAAFLG---------------------TPFLSSTEGQLE------------RVARIYRHPFYNIYTLDYDVALLELAGPVRRSRL--VRPICLPGPAR----PPDGARCVITGWGSLREGGSMARQLQKAAVRVLSEQTCRRFY--PVQIS-SRMLCAGFPQGGVDSCSGDAGGPLACREPSGQWVLTGVTSWGYGCGRPHFPGVYTRVAAVLGWI 1059          

HSP 3 Score: 78.1814 bits (191), Expect = 2.672e-14
Identity = 79/292 (27.05%), Postives = 129/292 (44.18%), Query Frame = 2
Query:  143 RVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKA--AGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYD-GRWMLAGVVS----AAHSKEPGQFPAIFTKVPSFKNWIL 997
            R++GG +A   +  W  S+K           CGA+++  +    WLL+AAHCF         + TK E   A +G +                             L G   + V  G   ++++ +HP Y    L+ D+AL++L  PL     K +  + LP    + K+P VG  C++ GWG  +   A  P+   K A + + +   C   +   +    +   CAG+L+ +   C GDSG  LAC+   G + LAG+VS     A +K+PG    ++ ++   K+WIL
Sbjct:  505 RIVGGISAVSGEVPWQASLKEGPRHF-----CGATVVGDR----WLLSAAHCF---------NHTKVEQVQAHLGTVS----------------------------LLGVGGSPVKLG---LRRVALHPRYNPGILDFDVALLELAQPLVFN--KYIQPVCLPL--AIHKFP-VGRKCMISGWGNMQEGNATKPDILQK-ASVGIIEQKMCGALYNFSLT---DRMLCAGFLEGRVDSCQGDSGGPLACEETPGVFYLAGIVSWGIGCAQAKKPG----VYARITRLKDWIL 734          
BLAST of Peptidase S1 domain-containing protein vs. TrEMBL
Match: A0A5K3F8T1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 1.131e-59
Identity = 114/298 (38.26%), Postives = 166/298 (55.70%), Query Frame = 2
Query:  140 KRVIGGETAPPDKYRWAVSIKG----DVDELKTSGA---CGASIIKTKGNISWLLTAAHCFFPSNKI-KTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLT--KWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILDT 1003
            +R+I GE A  ++Y + VSI+     D+  L   G    CG +++  +    W+LTAAHC +  +K  +   L  P+ WH R+   K+            + ++L  FF +AF  LFG  K        HI+K  +HP YV   LENDIAL+KL + + + ++  ++ I+LPD P L    WP  G +C  +GWGC  A   P  Y K   + + D  KC   + API+L    EFC+G+  R  G+CPGDSG  L C ++G  +LAGVVSA H+K+P  FPA+FT+V  F++WIL+T
Sbjct:   21 RRIINGELAKKNRYPFIVSIQAKLSNDLHSLLFGGIEHFCGGALVAPR----WILTAAHCMYAYSKDGELIPLLTPKSWHVRMSTDKLKPS---------TIDRLKGFFHRAFNTLFGYIK---PQTFYHIEKFVLHPHYVEGYLENDIALLKLKEHVQVHRMNTLDVIKLPD-PKLVGEMWPKTGQECTAIGWGCACAHCPPEMYMKTIKMPIIDPRKCKAMYKAPINLTVAKEFCSGFFNRNSGICPGDSGGPLVCDFNGNQLLAGVVSATHAKKPESFPAVFTRVTYFRDWILET 301          
BLAST of Peptidase S1 domain-containing protein vs. TrEMBL
Match: A0A0R3U3S5 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS1250 PE=3 SV=2)

HSP 1 Score: 204.527 bits (519), Expect = 3.596e-59
Identity = 114/298 (38.26%), Postives = 166/298 (55.70%), Query Frame = 2
Query:  140 KRVIGGETAPPDKYRWAVSIKG----DVDELKTSGA---CGASIIKTKGNISWLLTAAHCFFPSNKI-KTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLT--KWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILDT 1003
            +R+I GE A  ++Y + VSI+     D+  L   G    CG +++  +    W+LTAAHC +  +K  +   L  P+ WH R+   K+            + ++L  FF +AF  LFG  K        HI+K  +HP YV   LENDIAL+KL + + + ++  ++ I+LPD P L    WP  G +C  +GWGC  A   P  Y K   + + D  KC   + API+L    EFC+G+  R  G+CPGDSG  L C ++G  +LAGVVSA H+K+P  FPA+FT+V  F++WIL+T
Sbjct:   63 RRIINGELAKKNRYPFIVSIQAKLSNDLHSLLFGGIEHFCGGALVAPR----WILTAAHCMYAYSKDGELIPLLTPKSWHVRMSTDKLK---------PSTIDRLKGFFHRAFNTLFGYIK---PQTFYHIEKFVLHPHYVEGYLENDIALLKLKEHVQVHRMNTLDVIKLPD-PKLVGEMWPKTGQECTAIGWGCACAHCPPEMYMKTIKMPIIDPRKCKAMYKAPINLTVAKEFCSGFFNRNSGICPGDSGGPLVCDFNGNQLLAGVVSATHAKKPESFPAVFTRVTYFRDWILET 343          
BLAST of Peptidase S1 domain-containing protein vs. TrEMBL
Match: A0A0X3PBF6 (Transmembrane protease serine 9 OS=Schistocephalus solidus OX=70667 GN=TMPS9 PE=3 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 2.015e-57
Identity = 117/316 (37.03%), Postives = 161/316 (50.95%), Query Frame = 2
Query:  125 TGQIDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFY------YKKHGRGYLSNNKL-----ISFFSKAFKKLFGNSKNVVT----------TGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNL--TKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILDT 1003
            T  + KRVIGGE A   ++ +AVS+KGD    + S  CGA+II ++    WLLTAAHC F  + +    +  PE W  + G   +D        Y    + ++  N +     +  F K  K         V              I I +I +HP Y+   LE DIAL+KL D +P+ Q   +    LP  P L     P   ++C++VGWGC   +  P+ YA  A L V++N KC + +     LN E EFCAG+ K+  G+CPGDSGSGL C     W L GV SA H+KEP  FP +FT+V  F++WI  T
Sbjct:   42 TESLQKRVIGGEPARETQFPYAVSLKGDFPYTRRSTYCGATIIDSQ----WLLTAAHC-FGGDTLNGDTMRNPEYWTVQAGSTTIDLRHNTVLGYASRTKDHVIANAMEEIPPVDRFLKVLKTFLKQVSAFVAKPHFTFRQFQARRIKIDRIILHPKYIDDELEYDIALVKLTDSIPLGQYPMILKAILPS-PGLDTNTQPAPETECILVGWGCLAKSSGPSPYAMYAKLTVFENSKCSEIYSHAAGLNDEHEFCAGFHKQNIGICPGDSGSGLMCPAGDHWELMGVASATHAKEPENFPGLFTRVAVFRDWIRRT 351          
BLAST of Peptidase S1 domain-containing protein vs. TrEMBL
Match: A0A4S2MLJ2 (Peptidase S1 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000382 PE=3 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 1.541e-56
Identity = 117/318 (36.79%), Postives = 169/318 (53.14%), Query Frame = 2
Query:   92 LSSLIFVVSISTGQIDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAF-KKLFGNSKNVV---TTGD----------IHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILDT 1003
            L  L+ V + S+ ++DKR+I G  A    + WAVSIKG      +   CGA+II  +    WLLTAAHCF+   + ++  +  P  WHA+ G  K+    +   R  +  +  I      F + LF N K ++   T  D          IH +KI +HP Y+   LE DIAL+KL  PLPI+  K +   +LP       WPPVG+ C  VGWGC +  G P+   ++  L+V  +D C + +     LN   EFCAGY K   G+C GDSG GL   ++ + ++ GV SA H+K+P  +P +FT+V +F +WI  T
Sbjct:    7 LFVLLGVAAGSSIRVDKRIINGYDAKGGDHPWAVSIKGIHPRTLSITYCGATIIADQ----WLLTAAHCFWTDARRRSMLI--PGYWHAQAGHTKIVLGEEHTDREIIVGSSGIDEVGSNFLQNLFENLKKLILFKTPSDQAITDDKLWHIHFEKIILHPKYLPDDLEYDIALVKLRAPLPIDG-KTLTAAKLPAGLTTGDWPPVGTQCTFVGWGCQRYQGEPSADLQVVALRVVSHDACTEMYNNGAGLNEHHEFCAGYYKSNVGICAGDSGGGLIQVFERQVVVVGVASATHAKQPQSYPGLFTRVSAFTDWIEKT 317          
BLAST of Peptidase S1 domain-containing protein vs. TrEMBL
Match: A0A074Z675 (Peptidase S1 domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_15173 PE=3 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 4.399e-56
Identity = 116/316 (36.71%), Postives = 167/316 (52.85%), Query Frame = 2
Query:  101 LIFVVSISTGQIDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYL---------SNNKLISFFSKAFKKL--FGNSKNVVTTGD----IHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILDT 1003
            L+ V + S+ ++DKR+I G  A    + WAVSIKG      +   CGA+II  +    WLLTAAHCF+   + K+  +  P  WHA+ G  K+    +   R  +          +N L + F ++ KKL  F  S +     D    +H +KI +HP Y    LE DIAL+KL   LPI+  K +   +LP       WPPVG+ C  VGWGC K  G P    ++  L+V  +D C + +     LN   EFCAGY +   G+C GDSG GL   Y+ + ++ GV SA H+++P  +P +FT+V +F +WI  T
Sbjct:   10 LLEVAAGSSIRVDKRIINGYDAKTGDHPWAVSIKGIHPTTLSITYCGATIIAEQ----WLLTAAHCFWTDARRKS--MLNPGYWHAQAGHTKIVLGEEHTKREIIVGASDTDETGSNFLQNLF-ESLKKLILFKTSTDEAVADDKLWHVHFQKIILHPKYAPNDLEYDIALVKLRAALPIDG-KKLAAAKLPAGLTTGDWPPVGTQCTFVGWGCQKYQGEPTANLQVVALRVVSHDACTEMYNHGAGLNEHHEFCAGYYQSNVGICAGDSGGGLIQMYERQVVVVGVASATHARQPQSYPGLFTRVSAFTDWIEKT 317          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Cavefish
Match: tmprss9 (transmembrane serine protease 9 [Source:ZFIN;Acc:ZDB-GENE-050208-573])

HSP 1 Score: 108.997 bits (271), Expect = 1.322e-25
Identity = 85/291 (29.21%), Postives = 135/291 (46.39%), Query Frame = 2
Query:  134 IDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGC-TKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACK-YDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILD 1000
            +  RV+GG+ A   ++ W VS+K     L+    CGASII ++    W+++AAHCF   N         P+ W A VG                               L   ++N  TT  I+IK + + PDY     ++D+ +++L  PL          I+   IP+ +     G +C+V GWG  ++ + VP T  K A++KV D+D C  + V    +   +  CAG+L+ +   C GDSG  L C+   GR+ LAG+VS          P ++++V   +NWI+ 
Sbjct:  223 MGSRVVGGQNARHGEFPWQVSLK-----LRGRHTCGASIISSR----WIVSAAHCFENKN---------PKDWRALVG-----------------------------SSLVSGAENGATT--INIKSLIVSPDYNPMTTDSDVTVLELEKPLTFSAY-----IQPVCIPSFSHTFIPGQNCIVSGWGALSQDSEVPPTLQK-AVVKVIDSDVCNSSVVYRGAIT-NNMMCAGFLQGRVDSCQGDSGGPLVCEGAPGRFFLAGIVSWGVGCAQVNKPGVYSRVTKLRNWIMS 457          

HSP 2 Score: 103.219 bits (256), Expect = 1.479e-23
Identity = 75/286 (26.22%), Postives = 127/286 (44.41%), Query Frame = 2
Query:  140 KRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKY-DGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            +R++GG TA   ++ W  S+     + + S  CGA++I  K    W+LTAAHCF P+          P  W   +G +                                  ++ V+   I +++  IHP++ S+ ++ D+AL++L  P P        TI+   +P+ +      S+C ++GWG  +   +  T  + A + + D   C+ ++   +  N     CAG ++     C GDSG  LAC+   GRW LAGV S  H      FP ++ +V + + WI
Sbjct:  468 QRIVGGVTARRGEWPWVASL-----QFQRSHRCGATLIHCK----WILTAAHCFEPN----------PSGWTVSLGSVL---------------------------------RSGVSALVIPVQRFIIHPNFTSSTMDFDVALVELSIPAPSSY-----TIQTLCLPSPSHSFFNSSECYIMGWGAIREDKL-TTLLQKAKVSIIDQSDCLPSYSGRLTAN---MVCAGSMEGGKDTCLGDSGGPLACRQPHGRWFLAGVTSWGHGCGRSSFPGVYMRVTAVREWI 692          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Cavefish
Match: tmprss5 (transmembrane serine protease 5 [Source:ZFIN;Acc:ZDB-GENE-131121-184])

HSP 1 Score: 97.8265 bits (242), Expect = 6.182e-23
Identity = 86/317 (27.13%), Postives = 133/317 (41.96%), Query Frame = 2
Query:   62 KKSAMRYIEFLSSLIFVVSISTGQIDK--RVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKA--AGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILD 1000
            +++++ YIE    +IF+     G   K  R++GG  A P ++ W VS+            CG SII ++    W++TAAHC +   ++ +        W    G++  +              KL  +   A                  ++KI  + +Y     +NDIALMKL  PL        +TI    +P      P G+ C + GWG T+     +P+T  K A + +    KC  + +   ++      CAGY + K   C GDSG  L C+ D  W L GVVS          P ++TKV  F  WI +
Sbjct:    4 RQNSLSYIE---CVIFLSCAECGTRAKLPRIVGGVEATPGRWPWQVSLY-----YSNRHTCGGSIITSQ----WIVTAAHCVYRLPQVSS--------WVVYAGIVTRN------------TAKLAQYTGYA------------------VEKIIYNKNYNHRSHDNDIALMKLRTPLNFS-----DTIRPACLPQYDHDLPGGTQCWISGWGYTQPDDVHIPDTL-KEAPVPLISTKKCNSSCMYNGEITSRM-LCAGYTEGKVDACQGDSGGPLVCQDDNVWRLVGVVSWGTGCAEPNHPGVYTKVAEFLGWIYE 263          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Cavefish
Match: st14a (suppression of tumorigenicity 14a [Source:ZFIN;Acc:ZDB-GENE-030131-6496])

HSP 1 Score: 98.9821 bits (245), Expect = 3.307e-22
Identity = 80/285 (28.07%), Postives = 119/285 (41.75%), Query Frame = 2
Query:  143 RVIGGETAPPDKYRWAVSIKGDVDELKTS-GACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            RV+GG+ A   ++ W VS+      +K S   CGASII       WL+TAAHC     K++   L++P  W A +GL                                 + K +      ++K++  HP+Y     +NDIALM+L  P+        +TI    +P+ +   P G+   + GWG T+  G      + A +++ ++  C       I        CAG L      C GDSG  L+     R  LAGVVS          P I++ VP F+ WI
Sbjct:  561 RVVGGQDAVVGEWPWQVSL-----HIKNSIHVCGASIISEH----WLVTAAHCVQDDAKVR---LSQPGSWEAYLGLH--------------------------------DQKQLEVAQKRYLKRVIPHPNYNEYTFDNDIALMELEQPVTF-----TDTIRPICLPSASYDFPAGTTVWITGWGATREGGSGAKVLQKAQVRIINSTVCDSLMDGQI---TSRMTCAGVLSGGVDACQGDSGGPLSSSNGERMFLAGVVSWGDGCARRNKPGIYSTVPKFRAWI 793          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Cavefish
Match: st14b (suppressor of tumorigenicity 14 protein homolog [Source:NCBI gene;Acc:103035661])

HSP 1 Score: 98.5969 bits (244), Expect = 4.952e-22
Identity = 81/289 (28.03%), Postives = 128/289 (44.29%), Query Frame = 2
Query:  143 RVIGGETAPPDKYRWAVSIKGDVDELKTSG-ACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLAC--KYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILD 1000
            R++GGE +   ++ W VS+      +K  G  CGAS+I       WL+TAAHC   + ++K    ++P+LW A +GL+                                 S++   T    IK+I  HP+Y     +NDIALM+L  P+ + Q      I    +P  +   P G D  + GWG T+  G   T  + A +++ ++  C    +   ++ P    CAG L      C GDSG  ++      GR  LAGVVS          P ++T+V  +++WI +
Sbjct:  617 RIVGGEASSEGEWPWQVSL-----HVKGEGHVCGASVISDL----WLITAAHCVQDTERLK---YSQPDLWEAYLGLLS-------------------------------QSESSADTVQKSIKQIISHPEYDPRTYDNDIALMELNSPVTLNQ-----NIWPICLPAASHEFPAGLDVWITGWGQTREDGYLATVLQKAEVRIINDTICNQ--LMNNEITPRM-ICAGVLSGGVDACQGDSGGPMSSVDPDSGRLFLAGVVSWGDGCGRKNKPGVYTRVTKYRSWIRE 854          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Cavefish
Match: st14a (suppression of tumorigenicity 14a [Source:ZFIN;Acc:ZDB-GENE-030131-6496])

HSP 1 Score: 98.5969 bits (244), Expect = 5.016e-22
Identity = 80/285 (28.07%), Postives = 119/285 (41.75%), Query Frame = 2
Query:  143 RVIGGETAPPDKYRWAVSIKGDVDELKTS-GACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            RV+GG+ A   ++ W VS+      +K S   CGASII       WL+TAAHC     K++   L++P  W A +GL                                 + K +      ++K++  HP+Y     +NDIALM+L  P+        +TI    +P+ +   P G+   + GWG T+  G      + A +++ ++  C       I        CAG L      C GDSG  L+     R  LAGVVS          P I++ VP F+ WI
Sbjct:  593 RVVGGQDAVVGEWPWQVSL-----HIKNSIHVCGASIISEH----WLVTAAHCVQDDAKVR---LSQPGSWEAYLGLH--------------------------------DQKQLEVAQKRYLKRVIPHPNYNEYTFDNDIALMELEQPVTF-----TDTIRPICLPSASYDFPAGTTVWITGWGATREGGSGAKVLQKAQVRIINSTVCDSLMDGQI---TSRMTCAGVLSGGVDACQGDSGGPLSSSNGERMFLAGVVSWGDGCARRNKPGIYSTVPKFRAWI 825          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006128.1 (pep scaffold:Pmarinus_7.0:GL484169:9759:12797:-1 gene:ENSPMAG00000005545.1 transcript:ENSPMAT00000006128.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.3445 bits (207), Expect = 4.670e-19
Identity = 75/286 (26.22%), Postives = 118/286 (41.26%), Query Frame = 2
Query:  143 RVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKL-ALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACK-YDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            R++GG  A   K+ W  S++        S  CGAS+I  +    WL+ AAHCF  S+ +          W   +G+  +          Y S N +I                      +++ +I  H  +  + ++ DIAL++L DP+       V+ I LP  P+ + +P  G  C + GWG T  A     Y  L A ++++ ++ C    +   +       C G+       C GDSG  LAC+  D  W L+GV S          P ++TK   F  WI
Sbjct:   15 RIVGGTPATSGKWPWQASLRN-----YGSHVCGASLISER----WLVAAAHCFMYSSNVYE--------WQVYLGITYI----------YDSANAVI----------------------VNVAEIITHERFNISTIDYDIALVRLSDPVSFNHR--VSPICLP--PSTSHFPQPGKTCFISGWGRTSLAESGIHYDLLEAPMQIFSHEACSSNLMNG-NFITTRMICIGHPAGAISSCQGDSGGPLACQGTDKAWYLSGVTSWGFGCALPMKPVVYTKTSKFLPWI 246          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Sea Lamprey
Match: tmprss3a (transmembrane serine protease 3a [Source:ZFIN;Acc:ZDB-GENE-070912-70])

HSP 1 Score: 86.2705 bits (212), Expect = 5.681e-19
Identity = 72/289 (24.91%), Postives = 117/289 (40.48%), Query Frame = 2
Query:  140 KRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTK-AAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILDT 1003
             R++GG+ A    + W VS+     +      CG +++      +W+L+AAHCF             P++W+                        L S  + +  K+  NS+ V  T +          DY       DIAL+KL  PL +      NTI    +PN      VG +C + GWG TK +AG  +T  +  ++ +   + C  A      +      CAG+++     C GDSG  L C+    W + G  S         FP ++++V ++ +WI  T
Sbjct:  121 SRIVGGQDAQLGSWPWQVSL-----QFNGQHTCGGTLLTP----TWVLSAAHCF--------QGYLGPDMWNV---------------------TDLTSNLAGSISKIITNSQYVDNTNN----------DY-------DIALVKLSKPLSMS-----NTIGPACLPNYQTDFQVGMNCWITGWGATKVSAGPASTTLQEVMVPILSTETCNAANSYNGQITSR-MVCAGFMQGGQDACQGDSGGPLVCQTGTTWFVVGATSFGEGCALTNFPGVYSRVTAYLDWIHGT 348          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002258.1 (pep scaffold:Pmarinus_7.0:GL487751:502724:507790:1 gene:ENSPMAG00000002029.1 transcript:ENSPMAT00000002258.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.4185 bits (202), Expect = 2.909e-18
Identity = 80/289 (27.68%), Postives = 123/289 (42.56%), Query Frame = 2
Query:  140 KRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTK-AAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILDT 1003
             RVI GE A P  + W VS++ + D       CG SII       W++TAAHC F           KP      VG         +H +                      S NV     ++++K   HP Y +  + NDI L+KL +P         +T+    +P  T     G+   V GWG T+  A   ++  +  +L +   + C   + + I ++P    CAG     +  C GDSG  L  + DG W+LAG+ S  +S+     P ++T+V +F +WI +T
Sbjct:   32 SRVINGEEAVPGSWPWQVSLQYE-DGFH---FCGGSIIDPY----WVITAAHCDF-----------KPANHRIIVG---------EHDK----------------------SSNVENIQILYVEKAITHPLYDANTINNDILLLKLKEPAFFG-----DTVSPICLPRATDTFSPGTHAAVTGWGVTRWNANYGSSTLQQTVLPLISTEDCKKWWGSYI-MDPM--ICAG--ANGHSTCMGDSGGPLTVQKDGMWVLAGLTSWGNSRCDTSVPVVYTRVTTFVDWIAET 260          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002946.1 (pep scaffold:Pmarinus_7.0:GL477988:107792:112981:-1 gene:ENSPMAG00000002665.1 transcript:ENSPMAT00000002946.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.7962 bits (190), Expect = 1.385e-16
Identity = 81/290 (27.93%), Postives = 118/290 (40.69%), Query Frame = 2
Query:  140 KRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKA--AGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILDT 1003
             R++ GE A P  + W VS++ +         CG S+I       W++TAAHC     KI+  +         RV L        +H R                     +S+ V T   + I K+  HP +      ND+AL+KL  P P +   GV+ + L    +     P G +CV  GWG T    +  P    + AL  V     C   F A ++   +   CAG        C  DSG  L CK +G W L G+VS   S      P ++T+V + ++WI  T
Sbjct:   34 SRIVKGEEAMPGSWPWQVSLQNNTG----FHFCGGSLIDPY----WIVTAAHC-----KIRPSE--------HRVIL-------GEHDRS-------------------SSSEKVQT---MTIAKVINHPQWDDVSFNNDVALIKL--PQPAQMTDGVSAVCLSSTSDNV---PAGLNCVTSGWGITNNFDSDTPPRLQQTALAIV-ATPTCQQLF-ASMNKITDVMICAGGAGASSCRC--DSGGPLVCKKNGAWNLVGIVSWGSSVCSTSMPVVYTRVTAIRSWIDQT 264          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005493.1 (pep scaffold:Pmarinus_7.0:GL476632:243920:250733:-1 gene:ENSPMAG00000004970.1 transcript:ENSPMAT00000005493.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.0258 bits (188), Expect = 2.133e-16
Identity = 77/291 (26.46%), Postives = 119/291 (40.89%), Query Frame = 2
Query:  140 KRVIGGETAPPDKYRWAVSIKGDVDELKTS-GACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKA--AGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILDT 1003
             R++ GE A P  + W VS++      KT    CG S+I       W++TAAHC    ++ +                        +H R                     +S+ V T   + I K   HP + +  + ND+AL+KL  P   +   GV+ + L    +   +PP G +CV  GWG T    +  P    + AL  V          +A ++   +   CAG        C  DSG  L C+ DG W L G+VS  +S    + PA++T+V + ++WI  T
Sbjct:   25 SRIVNGEEAMPGSWPWQVSLQS-----KTGFHFCGGSLIDPY----WVVTAAHCGISPSEHRVI--------------------LGEHDRS-------------------SSSEKVQT---MTIAKAINHPQWDNMSINNDVALIKLSQPA--QMTDGVSAVCLSSTSD--NFPP-GLNCVTSGWGITNNFDSDTPPRLQQTALAIV--ATPTCQQLLANMNKITDVMICAGGAGATS--CRRDSGGPLVCEKDGAWNLVGIVSWGNSSCSTRIPAVYTRVTAIRSWIDQT 255          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Nematostella
Match: EDO30908 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZF8])

HSP 1 Score: 97.4413 bits (241), Expect = 1.325e-23
Identity = 79/291 (27.15%), Postives = 126/291 (43.30%), Query Frame = 2
Query:  134 IDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKC--IDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILD 1000
               RV+ G+ A    + W +S++ +   +     CG S+I  +    W+LTAAHC          D   P  +   VG  ++               K  S   + F+                + K+F H D+  + L+ND+AL+KL +P  I+    VNT+ LP+  +  +   VG+ C + GWG     G P+   + A+L V  +  C   ++++ P++   +S  CAG +      C GDSG    C   GRW+L G VS            +F +V SF +WI D
Sbjct:    7 FQSRVVNGDNAAQHSWPWQISLRVNGRHI-----CGGSLITPE----WVLTAAHC--------VEDFPHPSGYTVVVGAHRI---------------KERSAIQQEFR----------------LTKLFKHKDFSMSHLKNDVALLKLDNP--IQPSDKVNTVCLPERNSRAQ---VGAQCFITGWGRLVGGGQPSEILQQAMLPVASHSACDRKNSYLVPVE--EKSMICAGGMGMGG--CQGDSGGPFVCNEGGRWVLRGAVSWGQPMCGTDHYTVFARVSSFIDWIND 240          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Nematostella
Match: EDO33459 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS64])

HSP 1 Score: 93.5893 bits (231), Expect = 3.701e-22
Identity = 77/284 (27.11%), Postives = 116/284 (40.85%), Query Frame = 2
Query:  143 RVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            RVI G  A    + W +S++    +      CG S+I ++    W+LTAAHC           +  P  +   VG  ++D   +   +                               I I KI+ H  Y S+ L +D+AL+KL   + +   K VNT+ LP   +  +  P GS C + GWG   A G      + A L V  +  C       + ++  +  CAG   +  G C GDSG    C+  G+W+L G VS  H         +F +V SF +WI
Sbjct:    2 RVINGVDATAHAWPWQISLRMMSKKGDDYHFCGGSLIDSE----WVLTAAHCVA--------GIRNPRRYSVYVGAHELDGTTQVEEK-------------------------------ISISKIYSHEKYSSSLLTSDVALIKLSKAVSLS--KHVNTVCLPSGLSSDE-APAGSKCFITGWGRMVAGGSGANTLQQADLLVASHSDCQARMGYMLSVDKATMICAG--SQGKGGCQGDSGGPFVCEEGGKWVLRGAVSWGHVNCLTDHYTVFARVNSFISWI 237          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Nematostella
Match: EDO44208 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW61])

HSP 1 Score: 92.4337 bits (228), Expect = 6.939e-22
Identity = 77/289 (26.64%), Postives = 118/289 (40.83%), Query Frame = 2
Query:  143 RVIGGETAPPDKYRWAVSIKGDVDELKTSG--ACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKA--AGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKR-KYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            R+I G+ A P  + W +S++G       SG   CG S+I  +    W++TAAHC                             +  K+  GY       +    A KK    S        + + +I  HP Y   R+ NDIAL++L  P+  +    V T+ L D     + P  G  C + GWG         P+   + A+L +  ++ C   +    D++  +  CAG  +    G C GDSG  L C+ +G W L G VS      P     +F +V S+ +WI
Sbjct:    2 RIINGQNAQPHSWPWQISLRG------RSGFHTCGGSLISDR----WVVTAAHCI----------------------------HRNKNPGGY-------TVVVGAHKKRGSTS----VQQSLRLSQIIEHPKYNDRRIVNDIALIELATPVQFDSAGKVGTVCLTD-----QRPAPGKRCYITGWGAINGDTQQSPDILQQ-AMLPIASHENCRRKYG---DVSSTAHLCAGEARSDAAGGCNGDSGGPLVCEDNGSWFLHGAVSYGLRNCPTTHYTVFARVASYTDWI 232          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Nematostella
Match: EDO34771 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNF5])

HSP 1 Score: 92.4337 bits (228), Expect = 1.493e-21
Identity = 73/285 (25.61%), Postives = 120/285 (42.11%), Query Frame = 2
Query:  143 RVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKR-KYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            RVI G+ A P  + W +S++          +CG ++I  +    W++TA+HC    N   ++ +         VG          H R                     N K  V    I +  +  HP+Y   +++NDIAL++L  P+  ++   V T  L +     + P  G  C + GWG T   G      + A+L +  ++ C + +     ++  +  CAG  +    G C GDSG  L C+ +GRW L G VS      P  +  +F +V S+ +WI
Sbjct:   16 RVINGQNAQPHSWPWQISLR----PYGRYHSCGGTLISDR----WVVTASHCVH-KNPRPSYTVV--------VG---------AHER---------------------NGKTAVQE-SIPVSHVIEHPEYDDRKIKNDIALLELSRPVKFDREGKVGTACLTN-----QQPTPGKRCYITGWGSTIGTGNSPRILQQAMLPIASHNDCKNKYYG---VSSTAHLCAGEARSGASGGCNGDSGGPLVCEDNGRWYLHGAVSYGKLHCPTTYYTVFARVASYTDWI 244          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Nematostella
Match: EDO34807 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNB8])

HSP 1 Score: 90.8929 bits (224), Expect = 2.760e-21
Identity = 75/285 (26.32%), Postives = 118/285 (41.40%), Query Frame = 2
Query:  143 RVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHS-KEPGQFPAIFTKVPSFKNWI 994
            RVIGG+ A P  + W +++K   + +     CG S++ +    +W++TAAHC   S+    + +   E                 H R                      + N VT   +++KK+  HP Y + RL NDIAL++L  P  +     VN + LP  P+  K  P GS C + GWG  K  G  +   + A++      +C             S  CAG        C GDSG  L C+  G++ + G  S  H    PG++  ++  V +   W+
Sbjct:    2 RVIGGKDAIPGAWPWQIALKSRGNFI-----CGGSLVSS----TWVVTAAHCVARSSNPAQYQIIVGE-----------------HNR----------------------NVNEVTEETLNVKKVIAHPQYNNPRLSNDIALIELASPAKLSSR--VNPVCLP--PHGYKL-PAGSRCFITGWGKIKHPGSSHPILQQAMIPSLSEAQCKQKAQ---QSGCNSMLCAGLYNGGIDACQGDSGGPLVCETGGQFYIHGATSWGHGCAAPGKY-GVYAHVKNLIGWV 229          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000006501.2 (pep primary_assembly:ASM223467v1:4:8259952:8266705:-1 gene:ENSORLG00000005158.2 transcript:ENSORLT00000006501.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.6709 bits (239), Expect = 5.513e-23
Identity = 71/254 (27.95%), Postives = 110/254 (43.31%), Query Frame = 2
Query:  236 CGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACK-YDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            CGA++I  K    WLLTAAHCF             P  W   +G +       + G G L                            I I+++ IHP++  TR+++D+AL++L  P P+       TI+   +P+        ++C + GWG  K  G      + A +K+ +   C  ++    D   ++  CAG ++     C GDSG  L C+   GRW +AGV S  H      FP ++T+V S + WI
Sbjct:   27 CGATLIHNK----WLLTAAHCF-----------KSPTDWAVSLGSVL------RSGAGALV---------------------------IPIQRVIIHPEFNGTRMDHDVALLELAVPAPMSY-----TIQTACLPSPVHSFLQNAECYIAGWGSMKEGGSLANLLQKAEVKIIEQADCQLSYG---DALTQNMMCAGLMEGGRDTCLGDSGGPLTCRDLSGRWFIAGVTSWGHGCGRVGFPGVYTRVTSVRKWI 224          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Medaka
Match: zmp:0000001114 (suppressor of tumorigenicity 14 protein homolog [Source:NCBI gene;Acc:101155223])

HSP 1 Score: 100.138 bits (248), Expect = 1.787e-22
Identity = 85/286 (29.72%), Postives = 127/286 (44.41%), Query Frame = 2
Query:  143 RVIGGETAPPDKYRWAVSIKGDVDELKTSG-ACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLAC-KYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            R++GG+ A   ++ W VS+       KT G  CGASII  K    WLL+A+HCF  + + +      P  W    GL                 N+L   F+ A ++               +K+I  H  Y     + DIALM+L++PL  E  K V  I LP   ++  +PP G  C V GWG  +  G+     + A +K+ ++  C       +        C+GYL      C GDSG  L+C +  G+W  AG+VS          P ++T+V S ++WI
Sbjct:  594 RIVGGQDAELGEWPWQVSL-----HFKTQGHVCGASIISNK----WLLSASHCFKYNAEYE-----DPANWITYSGLQ----------------NQLT--FNTAQRR--------------RVKRIITHTGYNDITYDYDIALMELMEPL--EFSKTVQPICLPASTHI--FPP-GMSCWVTGWGTVREQGLLAKTLQKASVKMINDTVCQKYLSNSLTTRM---LCSGYLSGGIDACQGDSGGPLSCFEESGKWFQAGIVSWGEGCARQNKPGVYTRVTSLRDWI 825          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000041614.1 (pep primary_assembly:ASM223467v1:8:2529637:2537084:1 gene:ENSORLG00000026241.1 transcript:ENSORLT00000041614.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.2857 bits (238), Expect = 2.566e-22
Identity = 84/304 (27.63%), Postives = 129/304 (42.43%), Query Frame = 2
Query:   86 EFLSSLIFVVSISTGQIDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAA-GVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            +F S L+F        ++ R++GG+ AP   + W VS++G          CG S+I    N  W+LTAAHCF PS       +         +GL                            + L G++ N V+     I  + +HP++ S    NDIAL++L  P+        N I    +P+       G +  V GWG  + +   P T  ++ +  V  N +C  ++ A   L  ++  CAG L      C GDSG  L  K + RW+ AG+VS         FP I+T+V  ++ WI
Sbjct:    8 QFCSVLLFFPVCGRANLNNRIVGGQDAPAGFWPWQVSLQGSRH------FCGGSLI----NNQWVLTAAHCF-PSRSASGVTVV--------LGL----------------------------QSLQGSNPNRVSR---TITTLIVHPNFNSATQNNDIALLQLSSPVTF-----TNYITPVCLPSTGSTFYSGVNTWVTGWGTIRISLPAPQTLQEVQIPIV-GNRRCKCSYGA--SLITDNMMCAGLLAGGKDSCQGDSGGPLVIKQNIRWIQAGIVSFGKGCALPNFPGIYTRVSQYQTWI 253          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000040914.1 (pep primary_assembly:ASM223467v1:8:2529365:2537213:1 gene:ENSORLG00000026241.1 transcript:ENSORLT00000040914.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.1301 bits (235), Expect = 5.065e-22
Identity = 85/308 (27.60%), Postives = 131/308 (42.53%), Query Frame = 2
Query:   74 MRYIEFLSSLIFVVSISTGQIDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAA-GVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            M  +    SL+F        ++ R++GG+ AP   + W VS++G      +   CG S+I    N  W+LTAAHCF PS          P +    +GL                            + L G++ N V+     I  + +HP++ S    NDIAL++L  P+        N I    +P+       G +  V GWG  + +   P T  ++ +  V  N +C  ++ A   L  ++  CAG L      C GDSG  L  K + RW+ AG+VS         FP I+T+V  ++ WI
Sbjct:    8 MLPVTLEKSLLFFPVCGRANLNNRIVGGQDAPAGFWPWQVSLQG------SRHFCGGSLI----NNQWVLTAAHCF-PSG---------PTVQMLVLGL----------------------------QSLQGSNPNRVSR---TITTLIVHPNFNSATQNNDIALLQLSSPVTF-----TNYITPVCLPSTGSTFYSGVNTWVTGWGTIRISLPAPQTLQEVQIPIV-GNRRCKCSYGA--SLITDNMMCAGLLAGGKDSCQGDSGGPLVIKQNIRWIQAGIVSFGKGCALPNFPGIYTRVSQYQTWI 256          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000027341.1 (pep primary_assembly:ASM223467v1:8:2526526:2537084:1 gene:ENSORLG00000026241.1 transcript:ENSORLT00000027341.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.1301 bits (235), Expect = 1.019e-21
Identity = 87/325 (26.77%), Postives = 135/325 (41.54%), Query Frame = 2
Query:   41 MKYS*ILKKSAMRYIEFLSSLIFVVS----ISTGQIDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAA---GVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWI 994
            M+++ +  K  +   EF S+ I  +S         ++ R++GG+ AP   + W VS++G          CG S+I    N  W+LTAAHCF PS    T  L                                        + L G++ N V+     I  + +HP++ S    NDIAL++L  P+        N I    +P+       G +  V GWG  ++      P T  ++ +  V  N +C  ++ A   L  ++  CAG L      C GDSG  L  K + RW+ AG+VS         FP I+T+V  ++ WI
Sbjct:    1 MQWASVFTKQPVVVGEFYSNTITSLSKNIFCGRANLNNRIVGGQDAPAGFWPWQVSLQGSRH------FCGGSLI----NNQWVLTAAHCF-PSASGVTVVL--------------------------------------GLQSLQGSNPNRVSR---TITTLIVHPNFNSATQNNDIALLQLSSPVTF-----TNYITPVCLPSTGSTFYSGVNTWVTGWGTIRSGVSLPAPQTLQEVQIPIV-GNRRCKCSYGA--SLITDNMMCAGLLAGGKDSCQGDSGGPLVIKQNIRWIQAGIVSFGKGCALPNFPGIYTRVSQYQTWI 265          
BLAST of Peptidase S1 domain-containing protein vs. Planmine SMEST
Match: SMESG000077268.1 (SMESG000077268.1)

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 310/310 (100.00%), Postives = 310/310 (100.00%), Query Frame = 2
Query:   74 MRYIEFLSSLIFVVSISTGQIDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILDT 1003
            MRYIEFLSSLIFVVSISTGQIDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILDT
Sbjct:    1 MRYIEFLSSLIFVVSISTGQIDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILDT 310          
BLAST of Peptidase S1 domain-containing protein vs. Planmine SMEST
Match: SMESG000040907.1 (SMESG000040907.1)

HSP 1 Score: 372.859 bits (956), Expect = 1.001e-128
Identity = 177/313 (56.55%), Postives = 226/313 (72.20%), Query Frame = 2
Query:   86 EFLSSLIFVVSISTGQIDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVST---------RLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWIL 997
            +FL + IF V+ +   ++KR+IGGE APPDKYRWAVSIKG+VD+LK SGACGASI++T G + WL+TAAHCF+PS+ +  ++LTK + WHARVGL KVDF Y+KHG       K+ S F+KA++KLFG  K  VTT D+HI KI IHP Y            R++NDIALMKL +PLPI QL GV+TI LP+    T WP +GSDC+VVGWGCTK    PN  AKLA+LK+W N +C ++  + + +NP S+FCAGYLK+KYGLC GDSGSGL C Y G   +AGVVS  H  +PG +PA+F++V +FK WI 
Sbjct:    7 QFLIAFIFCVTCTHSSMEKRIIGGEEAPPDKYRWAVSIKGNVDKLKMSGACGASILQTPGQVLWLVTAAHCFYPSDGVTVYNLTKGKYWHARVGLTKVDFLYQKHGMKDKFKEKVKSLFNKAYRKLFGKDKFKVTTDDLHISKIIIHPGYQPAVKSNDDGMFRMDNDIALMKLKEPLPIHQLSGVSTIGLPNWSVNTSWPAIGSDCIVVGWGCTKVKNAPNPIAKLAILKIWSNSECENSVPSKLYINPASDFCAGYLKKKYGLCHGDSGSGLICDYQGTPTIAGVVSRGHGSDPGGYPAVFSRVSAFKEWIF 319          
BLAST of Peptidase S1 domain-containing protein vs. Planmine SMEST
Match: SMESG000040907.1 (SMESG000040907.1)

HSP 1 Score: 360.918 bits (925), Expect = 2.048e-124
Identity = 172/297 (57.91%), Postives = 217/297 (73.06%), Query Frame = 2
Query:  134 IDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVST---------RLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWIL 997
            ++KR+IGGE APPDKYRWAVSIKG+VD+LK SGACGASI++T G + WL+TAAHCF+PS+ +  ++LTK + WHARVGL KVDF Y+KHG       K+ S F+KA++KLFG  K  VTT D+HI KI IHP Y            R++NDIALMKL +PLPI QL GV+TI LP+    T WP +GSDC+VVGWGCTK    PN  AKLA+LK+W N +C ++  + + +NP S+FCAGYLK+KYGLC GDSGSGL C Y G   +AGVVS  H  +PG +PA+F++V +FK WI 
Sbjct:    1 MEKRIIGGEEAPPDKYRWAVSIKGNVDKLKMSGACGASILQTPGQVLWLVTAAHCFYPSDGVTVYNLTKGKYWHARVGLTKVDFLYQKHGMKDKFKEKVKSLFNKAYRKLFGKDKFKVTTDDLHISKIIIHPGYQPAVKSNDDGMFRMDNDIALMKLKEPLPIHQLSGVSTIGLPNWSVNTSWPAIGSDCIVVGWGCTKVKNAPNPIAKLAILKIWSNSECENSVPSKLYINPASDFCAGYLKKKYGLCHGDSGSGLICDYQGTPTIAGVVSRGHGSDPGGYPAVFSRVSAFKEWIF 297          
BLAST of Peptidase S1 domain-containing protein vs. Planmine SMEST
Match: SMESG000077235.1 (SMESG000077235.1)

HSP 1 Score: 234.958 bits (598), Expect = 6.740e-75
Identity = 130/321 (40.50%), Postives = 178/321 (55.45%), Query Frame = 2
Query:   74 MRYIEFLSSLIFVV--SISTGQIDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFIHPDYVSTR---------LENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILDT 1003
            MRYIEFLS L+ VV   + T Q  KR+IGG+    D+++W VSIKGD+  ++ +    ASIIK++  I WL+TAAHCFFPSN +   D++ P LWH  V L K D  Y+KHG              KA +KL    KN + T D H+KKI +HPDY   +         L+NDIAL+KL DPLP      +  ++LP+    + WP     CVV GW C K +   N  +K   LK+  N+KC         +N +++ C     ++ G C  D GSGL C  +G+  LAGV+S  +S  P  FP + T+V S+ NWI D+
Sbjct:    1 MRYIEFLSILLSVVWLEMVTTQRQKRIIGGDIPRDDEHKWKVSIKGDISVVRKAAVYSASIIKSEKGIYWLVTAAHCFFPSNGVTFIDMSNPALWH--VALTKFDSIYEKHG-----------LKDKAMEKLKSILKNKLITNDFHVKKIIVHPDYKPVKQTNSNAPIPLDNDIALIKLTDPLPENHPSLIYALDLPE---SSVWPETDKSCVVAGWDCRKISNNDNYNSKAVNLKILSNEKCEKLTSKSFLMNTKTDLCVAQSTKENGFCLEDIGSGLVCDRNGKSTLAGVLSRGYSDLPIPFPPVLTRVSSYVNWIKDS 305          
BLAST of Peptidase S1 domain-containing protein vs. Planmine SMEST
Match: SMESG000012752.1 (SMESG000012752.1)

HSP 1 Score: 229.565 bits (584), Expect = 8.069e-73
Identity = 124/322 (38.51%), Postives = 174/322 (54.04%), Query Frame = 2
Query:   80 YIEFLSSLIFVVSISTGQIDKRVIGGETAPPDKYRWAVSIKGDVDELKTSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLMKVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTG-------------DIHIKKIFIHPDYVSTRLENDIALMKLIDPLPIEQLKG-VNTIELPDIPNLTKWPPVGSDCVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCAGYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKVPSFKNWILDT 1003
            +I   +  + + S S   I KR++ G+ AP DKY W++S+KGD+   +    CGAS+I  +    WLLTAAHCF  + +    + T P LWHAR G  K++  Y K+   Y           KA+K  +  + +   T              D+H+ KI +HP+Y    +E DIALMKL  P+  + L   +  I LP   +   WP +G  C+++GWGC    G  +  A++A LK+  N  C   +    DLN E EFCAG  K  +GLC GDSGSGLACK   +W LAGV SA H++ PG +P IFT+V  F +WIL+ 
Sbjct:    5 FILLCNLFVLIYSRSFNVISKRIVNGKDAPEDKYLWSISLKGDIPTDEAVYGCGASLIDKQ----WLLTAAHCFLAAQEKSLLNSTDPILWHARAGARKLETEYVKYEHKY----------EKAYKGWYEETSDFDGTDGKWDKRRVPESYLDLHVSKIILHPNYKPDEIEWDIALMKLQSPIEEKYLNEFLEVIPLPSEADSKPWPKIGQMCILIGWGCKTNGGSISERAQIANLKIQSNKFCEKVYNQGADLNDEHEFCAGKYKSGHGLCEGDSGSGLACKKGNKWTLAGVASATHAELPGNYPGIFTRVSYFISWILEN 312          
The following BLAST results are available for this feature:
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TPSB21.528e-2128.24tryptase beta 2 (gene/pseudogene) [Source:HGNC Sym... [more]
TPSB21.811e-2128.24tryptase beta 2 (gene/pseudogene) [Source:HGNC Sym... [more]
TMPRSS22.221e-2127.62transmembrane serine protease 2 [Source:HGNC Symbo... [more]
TMPRSS22.251e-2127.62transmembrane serine protease 2 [Source:HGNC Symbo... [more]
TMPRSS22.251e-2127.62transmembrane serine protease 2 [Source:HGNC Symbo... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
svh-13.090e-1426.96HGF/MSP/plasminogen-like protein [Source:UniProtK... [more]
try-11.034e-1326.71TRYpsin-like protease [Source:UniProtKB/TrEMBL;Ac... [more]
try-32.345e-724.81TRYpsin-like protease [Source:UniProtKB/TrEMBL;Ac... [more]
try-32.574e-724.58TRYpsin-like protease [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG74328.360e-2129.79gene:FBgn0038727 transcript:FBtr0301213[more]
mas1.053e-1828.15gene:FBgn0011653 transcript:FBtr0332659[more]
mas1.063e-1828.15gene:FBgn0011653 transcript:FBtr0073260[more]
Sb2.973e-1824.76gene:FBgn0003319 transcript:FBtr0344008[more]
Sb2.973e-1824.76gene:FBgn0003319 transcript:FBtr0083250[more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CU062628.12.665e-2328.57trypsin-2-like [Source:NCBI gene;Acc:103908930][more]
tmprss97.536e-2327.84transmembrane serine protease 9 [Source:ZFIN;Acc:Z... [more]
tmprss98.410e-2327.84transmembrane serine protease 9 [Source:ZFIN;Acc:Z... [more]
CR352265.12.048e-2126.39pep chromosome:GRCz11:24:21813127:21819010:-1 gene... [more]
st14a4.472e-2128.77suppression of tumorigenicity 14a [Source:ZFIN;Acc... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TMPRSS93.052e-2630.07transmembrane serine protease 9 [Source:NCBI gene;... [more]
TMPRSS95.720e-2630.07transmembrane serine protease 9 [Source:NCBI gene;... [more]
ENSXETT00000014785.19.908e-2526.35transmembrane serine protease 11F [Source:NCBI gen... [more]
ENSXETT00000014815.11.441e-2426.35transmembrane serine protease 11F [Source:NCBI gen... [more]
ENSXETT00000030355.11.757e-2426.39transmembrane serine protease 11F [Source:NCBI gen... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Klkb12.130e-2427.74kallikrein B, plasma 1 [Source:MGI Symbol;Acc:MGI:... [more]
Tmprss36.415e-2329.23transmembrane protease, serine 3 [Source:MGI Symbo... [more]
Tmprss36.444e-2329.23transmembrane protease, serine 3 [Source:MGI Symbo... [more]
Tmprss36.444e-2329.23transmembrane protease, serine 3 [Source:MGI Symbo... [more]
Tmprss37.486e-2329.23transmembrane protease, serine 3 [Source:MGI Symbo... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P26262|KLKB1_MOUSE1.490e-2327.74Plasma kallikrein OS=Mus musculus OX=10090 GN=Klkb... [more]
sp|Q2KJ63|KLKB1_BOVIN2.543e-2228.47Plasma kallikrein OS=Bos taurus OX=9913 GN=KLKB1 P... [more]
sp|P14272|KLKB1_RAT3.218e-2227.05Plasma kallikrein OS=Rattus norvegicus OX=10116 GN... [more]
sp|Q8K1T0|TMPS3_MOUSE4.507e-2229.23Transmembrane protease serine 3 OS=Mus musculus OX... [more]
sp|P69525|TMPS9_MOUSE7.012e-2127.34Transmembrane protease serine 9 OS=Mus musculus OX... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3F8T11.131e-5938.26Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3U3S53.596e-5938.26Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0X3PBF62.015e-5737.03Transmembrane protease serine 9 OS=Schistocephalus... [more]
A0A4S2MLJ21.541e-5636.79Peptidase S1 domain-containing protein OS=Opisthor... [more]
A0A074Z6754.399e-5636.71Peptidase S1 domain-containing protein OS=Opisthor... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmprss91.322e-2529.21transmembrane serine protease 9 [Source:ZFIN;Acc:Z... [more]
tmprss56.182e-2327.13transmembrane serine protease 5 [Source:ZFIN;Acc:Z... [more]
st14a3.307e-2228.07suppression of tumorigenicity 14a [Source:ZFIN;Acc... [more]
st14b4.952e-2228.03suppressor of tumorigenicity 14 protein homolog [S... [more]
st14a5.016e-2228.07suppression of tumorigenicity 14a [Source:ZFIN;Acc... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006128.14.670e-1926.22pep scaffold:Pmarinus_7.0:GL484169:9759:12797:-1 g... [more]
tmprss3a5.681e-1924.91transmembrane serine protease 3a [Source:ZFIN;Acc:... [more]
ENSPMAT00000002258.12.909e-1827.68pep scaffold:Pmarinus_7.0:GL487751:502724:507790:1... [more]
ENSPMAT00000002946.11.385e-1627.93pep scaffold:Pmarinus_7.0:GL477988:107792:112981:-... [more]
ENSPMAT00000005493.12.133e-1626.46pep scaffold:Pmarinus_7.0:GL476632:243920:250733:-... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO309081.325e-2327.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334593.701e-2227.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO442086.939e-2226.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347711.493e-2125.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348072.760e-2126.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000006501.25.513e-2327.95pep primary_assembly:ASM223467v1:4:8259952:8266705... [more]
zmp:00000011141.787e-2229.72suppressor of tumorigenicity 14 protein homolog [S... [more]
ENSORLT00000041614.12.566e-2227.63pep primary_assembly:ASM223467v1:8:2529637:2537084... [more]
ENSORLT00000040914.15.065e-2227.60pep primary_assembly:ASM223467v1:8:2529365:2537213... [more]
ENSORLT00000027341.11.019e-2126.77pep primary_assembly:ASM223467v1:8:2526526:2537084... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077268.10.000e+0100.00SMESG000077268.1[more]
SMESG000040907.11.001e-12856.55SMESG000040907.1[more]
SMESG000040907.12.048e-12457.91SMESG000040907.1[more]
SMESG000077235.16.740e-7540.50SMESG000077235.1[more]
SMESG000012752.18.069e-7338.51SMESG000012752.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008369 ID=SMED30008369|Name=Peptidase S1 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1112bp
AGCAATTAACCAAATACAGATTTTATCGTTATAAATATAAATGAAATATT
CGTAGATATTGAAGAAATCAGCGATGCGTTATATTGAATTTCTTTCAAGT
TTGATATTTGTGGTATCTATATCCACGGGCCAAATTGATAAAAGAGTAAT
AGGGGGAGAAACTGCACCACCTGACAAATATAGATGGGCAGTGTCAATTA
AAGGGGATGTTGATGAATTAAAAACAAGTGGGGCTTGTGGCGCTTCAATT
ATTAAAACAAAGGGTAACATCAGTTGGTTATTAACTGCTGCTCATTGTTT
TTTCCCATCGAACAAGATAAAGACTTTCGATTTGACAAAGCCTGAACTTT
GGCATGCTAGAGTTGGACTAATGAAAGTTGATTTTTACTACAAAAAACAT
GGACGAGGATATCTGTCAAACAATAAATTGATATCATTTTTTAGTAAAGC
ATTCAAAAAATTGTTCGGAAATTCAAAAAATGTTGTCACGACAGGTGATA
TTCACATTAAGAAAATCTTCATACATCCTGATTATGTTTCGACCCGACTG
GAAAATGATATCGCGTTGATGAAATTGATAGATCCGTTACCAATTGAACA
ACTAAAGGGAGTAAATACAATAGAATTACCTGACATACCAAACCTTACGA
AATGGCCACCAGTTGGTAGCGATTGTGTAGTTGTTGGTTGGGGATGTACT
AAAGCTGCAGGAGTGCCAAATACATATGCCAAATTAGCGCTGTTGAAAGT
ATGGGATAATGATAAATGCATAGATGCGTTTGTCGCGCCAATTGATTTGA
ATCCTGAAAGTGAATTTTGCGCCGGCTATTTGAAAAGGAAATATGGTCTC
TGTCCTGGTGACAGTGGAAGTGGACTGGCTTGCAAATATGATGGTAGATG
GATGCTTGCAGGGGTTGTGTCAGCGGCCCATAGCAAAGAGCCTGGGCAAT
TCCCCGCAATTTTCACCAAGGTGCCTTCATTCAAAAATTGGATATTGGAT
ACAATTAATAAAAACTAGATTCGGTTCTTTTTATTTAAATGAAAGAATTT
TTGAAACTTTATTTGCTTTAATTTCATAGATTAATTTATCAGTAATAAAT
ATTACGTTGCGT
back to top

protein sequence of SMED30008369-orf-1

>SMED30008369-orf-1 ID=SMED30008369-orf-1|Name=SMED30008369-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=315bp
MRYIEFLSSLIFVVSISTGQIDKRVIGGETAPPDKYRWAVSIKGDVDELK
TSGACGASIIKTKGNISWLLTAAHCFFPSNKIKTFDLTKPELWHARVGLM
KVDFYYKKHGRGYLSNNKLISFFSKAFKKLFGNSKNVVTTGDIHIKKIFI
HPDYVSTRLENDIALMKLIDPLPIEQLKGVNTIELPDIPNLTKWPPVGSD
CVVVGWGCTKAAGVPNTYAKLALLKVWDNDKCIDAFVAPIDLNPESEFCA
GYLKRKYGLCPGDSGSGLACKYDGRWMLAGVVSAAHSKEPGQFPAIFTKV
PSFKNWILDTINKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR001314Peptidase_S1A
IPR001254Trypsin_dom
IPR018114TRYPSIN_HIS
IPR009003Peptidase_S1_PA
Vocabulary: molecular function
TermDefinition
GO:0004252serine-type endopeptidase activity
GO:0008233peptidase activity
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001314Peptidase S1A, chymotrypsin familyPRINTSPR00722CHYMOTRYPSINcoord: 158..172
score: 38.56
coord: 60..75
score: 40.56
coord: 257..269
score: 44.02
IPR001254Serine proteases, trypsin domainSMARTSM00020trypsin_2coord: 24..307
e-value: 2.4E-37
score: 140.1
IPR001254Serine proteases, trypsin domainPFAMPF00089Trypsincoord: 127..307
e-value: 1.9E-29
score: 103.1
IPR001254Serine proteases, trypsin domainPROSITEPS50240TRYPSIN_DOMcoord: 25..312
score: 24.753
IPR001254Serine proteases, trypsin domainCDDcd00190Tryp_SPccoord: 25..307
e-value: 1.51728E-49
score: 162.831
NoneNo IPR availableGENE3DG3DSA:2.40.10.10coord: 17..313
e-value: 1.3E-49
score: 170.7
NoneNo IPR availablePANTHERPTHR24256TRANSMEMBRANE PROTEASE, SERINEcoord: 23..312
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.484
IPR018114Serine proteases, trypsin family, histidine active sitePROSITEPS00134TRYPSIN_HIScoord: 70..75
IPR009003Peptidase S1, PA clanSUPERFAMILYSSF50494Trypsin-like serine proteasescoord: 13..313