RTEL1

Overview
NameRTEL1 (AFD29612.1)
Smed IDSMED30008368
Length (bp)3287
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RTEL1 (SMED30008368) t-SNE clustered cells

Violin plots show distribution of expression levels for RTEL1 (SMED30008368) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RTEL1 (SMED30008368) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RTEL1 (SMED30008368) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008368

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30008368SMESG000064419.1 SmedASXL_015793SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30008368SMESG000064419.1 dd_Smed_v4_12261_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30008368SMESG000064419.1 dd_Smed_v4_12261_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30008368SMESG000064419.1 SMED_13828_V2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RTEL1 vs. Ensembl Human
Match: RTEL1 (regulator of telomere elongation helicase 1 [Source:HGNC Symbol;Acc:HGNC:15888])

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 354/1001 (35.36%), Postives = 537/1001 (53.65%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVK------KVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEEL-KVLGEFIYSIQSTDAIID-EADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEK-CSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFG---IDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNI-----------------------TIKYPPPGLGCCESIS-NVPIEIQNQESSTKPSRIKSRTNISAQYSSKVVSFATSLKDGSQDFAKILESYANTPPIKKPESSLTSTSLMDILKRAENHVTEIEILPVKRTFNETVCEVDDPEKNTRKVK--KYKLVALKGQEKVKESNEYSFIIKRLFNEDVQGFISYKTVIEDFKKNTNVDTLFAGLNSLLCEKDQP-GLVRDFYKFIQP 2992
            MP I + GV++DFPF+PY CQ  YM KV+E L+   N ILESPTGTGKTLCLLC  LAW++H++      K+   ++ E+    +   + + N    +   I+    +PKIIY+SRTHSQL+Q IN L+ T Y   KV ++ SREQLCI+P+V   ESN  +I+ C+ +V +R C FYN  E+        + I DIEDL+  G K  VCPY+LSR +   ADI FMPYNYLLD+K RR +NI+LKG +VIFDEAHN+E++CE+SAS  LT  ++AS ++ + +VL E   + Q  +   +  AD+ S    + +L  I  LK  L  LE    +++L  + ++G+T   + +F+L          K   +D L++      G +   T T     GL+K+ + ++ VF  +  E           L + Y+V I  +            W +   +     + +VLS+WC + G +M  L    VRS+ILTSGTL P+ +  L+M I F V L N H+I+  Q+ V V  +G DG  L+S++  R      +SLG ++ N+++++P GLL+ FPSY +M K +E W + D+   M   K L VEP+ K  F+  +  +Y++ + P S  G+  L+V RGK SEGLD SD  GRGVIV GLPYP  MDPR+ LKM FLD+       G   + G+ WY+QQA RAVNQ+IGRVIRH +D+GA++L D RFA AD+R QLP W++ ++ + ++FG  IR+   FFR                           K P P     ++ S ++ +    Q SS  P+     +++  +Y  + V  A     G     +  E  A +P  ++   S ++ SL+   + AE            R   + +  V  PE+     +  + KL  +  ++++ ++N                F ++   ++D+K + +   L A L  L  E  +   L++ FY+F++P
Sbjct:    1 MPKIVLNGVTVDFPFQPYKCQQEYMTKVLECLQQKVNGILESPTGTGKTLCLLCTTLAWREHLRDGISARKIAERAQGELFP--DRALSSWGNAAAAAGDPIACYTDIPKIIYASRTHSQLTQVINELRNTSY-RPKVCVLGSREQLCIHPEVKKQESNHLQIHLCRKKVASRSCHFYNNVEEKSLEQELASPILDIEDLVKSGSKHRVCPYYLSRNLKQQADIIFMPYNYLLDAKSRRAHNIDLKGTVVIFDEAHNVEKMCEESASFDLTPHDLASGLDVIDQVLEEQTKAAQQGEPHPEFSADSPSPGLNM-ELEDIAKLKMILLRLEGAIDAVELPGD-DSGVTKPGSYIFELFAEAQITFQTKGCILDSLDQIIQHLAGRAGVFTNT----AGLQKLADIIQIVFSVDPSEGSPGSPAGLGALQS-YKVHIHPDAGHRRTAQRSDAWSTTAAR----KRGKVLSYWCFSPGHSMHELVRQGVRSLILTSGTLAPVSSFALEMQIPFPVCLENPHIIDKHQIWVGVVPRGPDGAQLSSAFDRRFSEECLSSLGKALGNIARVVPYGLLIFFPSYPVMEKSLEFWRARDLARKMEALKPLFVEPRSKGSFSETISAYYARVAAPGST-GATFLAVCRGKASEGLDFSDTNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMKGQGGAGGQFLSGQEWYRQQASRAVNQAIGRVIRHRQDYGAVFLCDHRFAFADARAQLPSWVRPHVRVYDNFGHVIRDVAQFFRVAERTMPAPAPRATAPSVRGEDAVSEAKSPGPFFSTRKAKSLDLHVPSLKQRSSGSPAAGDPESSLCVEYEQEPVP-ARQRPRGLLAALEHSEQRAGSPGEEQ-AHSCSTLSLLSEKRPAEE----------PRGGRKKIRLVSHPEEPVAGAQTDRAKLFMVAVKQELSQAN----------------FATFTQALQDYKGSDDFAALAACLGPLFAEDPKKHNLLQGFYQFVRP 958          
BLAST of RTEL1 vs. Ensembl Human
Match: RTEL1 (regulator of telomere elongation helicase 1 [Source:HGNC Symbol;Acc:HGNC:15888])

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 354/1001 (35.36%), Postives = 537/1001 (53.65%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVK------KVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEEL-KVLGEFIYSIQSTDAIID-EADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEK-CSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFG---IDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNI-----------------------TIKYPPPGLGCCESIS-NVPIEIQNQESSTKPSRIKSRTNISAQYSSKVVSFATSLKDGSQDFAKILESYANTPPIKKPESSLTSTSLMDILKRAENHVTEIEILPVKRTFNETVCEVDDPEKNTRKVK--KYKLVALKGQEKVKESNEYSFIIKRLFNEDVQGFISYKTVIEDFKKNTNVDTLFAGLNSLLCEKDQP-GLVRDFYKFIQP 2992
            MP I + GV++DFPF+PY CQ  YM KV+E L+   N ILESPTGTGKTLCLLC  LAW++H++      K+   ++ E+    +   + + N    +   I+    +PKIIY+SRTHSQL+Q IN L+ T Y   KV ++ SREQLCI+P+V   ESN  +I+ C+ +V +R C FYN  E+        + I DIEDL+  G K  VCPY+LSR +   ADI FMPYNYLLD+K RR +NI+LKG +VIFDEAHN+E++CE+SAS  LT  ++AS ++ + +VL E   + Q  +   +  AD+ S    + +L  I  LK  L  LE    +++L  + ++G+T   + +F+L          K   +D L++      G +   T T     GL+K+ + ++ VF  +  E           L + Y+V I  +            W +   +     + +VLS+WC + G +M  L    VRS+ILTSGTL P+ +  L+M I F V L N H+I+  Q+ V V  +G DG  L+S++  R      +SLG ++ N+++++P GLL+ FPSY +M K +E W + D+   M   K L VEP+ K  F+  +  +Y++ + P S  G+  L+V RGK SEGLD SD  GRGVIV GLPYP  MDPR+ LKM FLD+       G   + G+ WY+QQA RAVNQ+IGRVIRH +D+GA++L D RFA AD+R QLP W++ ++ + ++FG  IR+   FFR                           K P P     ++ S ++ +    Q SS  P+     +++  +Y  + V  A     G     +  E  A +P  ++   S ++ SL+   + AE            R   + +  V  PE+     +  + KL  +  ++++ ++N                F ++   ++D+K + +   L A L  L  E  +   L++ FY+F++P
Sbjct:    1 MPKIVLNGVTVDFPFQPYKCQQEYMTKVLECLQQKVNGILESPTGTGKTLCLLCTTLAWREHLRDGISARKIAERAQGELFP--DRALSSWGNAAAAAGDPIACYTDIPKIIYASRTHSQLTQVINELRNTSY-RPKVCVLGSREQLCIHPEVKKQESNHLQIHLCRKKVASRSCHFYNNVEEKSLEQELASPILDIEDLVKSGSKHRVCPYYLSRNLKQQADIIFMPYNYLLDAKSRRAHNIDLKGTVVIFDEAHNVEKMCEESASFDLTPHDLASGLDVIDQVLEEQTKAAQQGEPHPEFSADSPSPGLNM-ELEDIAKLKMILLRLEGAIDAVELPGD-DSGVTKPGSYIFELFAEAQITFQTKGCILDSLDQIIQHLAGRAGVFTNT----AGLQKLADIIQIVFSVDPSEGSPGSPAGLGALQS-YKVHIHPDAGHRRTAQRSDAWSTTAAR----KRGKVLSYWCFSPGHSMHELVRQGVRSLILTSGTLAPVSSFALEMQIPFPVCLENPHIIDKHQIWVGVVPRGPDGAQLSSAFDRRFSEECLSSLGKALGNIARVVPYGLLIFFPSYPVMEKSLEFWRARDLARKMEALKPLFVEPRSKGSFSETISAYYARVAAPGST-GATFLAVCRGKASEGLDFSDTNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMKGQGGAGGQFLSGQEWYRQQASRAVNQAIGRVIRHRQDYGAVFLCDHRFAFADARAQLPSWVRPHVRVYDNFGHVIRDVAQFFRVAERTMPAPAPRATAPSVRGEDAVSEAKSPGPFFSTRKAKSLDLHVPSLKQRSSGSPAAGDPESSLCVEYEQEPVP-ARQRPRGLLAALEHSEQRAGSPGEEQ-AHSCSTLSLLSEKRPAEE----------PRGGRKKIRLVSHPEEPVAGAQTDRAKLFMVAVKQELSQAN----------------FATFTQALQDYKGSDDFAALAACLGPLFAEDPKKHNLLQGFYQFVRP 958          
BLAST of RTEL1 vs. Ensembl Human
Match: RTEL1 (regulator of telomere elongation helicase 1 [Source:HGNC Symbol;Acc:HGNC:15888])

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 354/1001 (35.36%), Postives = 537/1001 (53.65%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVK------KVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEEL-KVLGEFIYSIQSTDAIID-EADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEK-CSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFG---IDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNI-----------------------TIKYPPPGLGCCESIS-NVPIEIQNQESSTKPSRIKSRTNISAQYSSKVVSFATSLKDGSQDFAKILESYANTPPIKKPESSLTSTSLMDILKRAENHVTEIEILPVKRTFNETVCEVDDPEKNTRKVK--KYKLVALKGQEKVKESNEYSFIIKRLFNEDVQGFISYKTVIEDFKKNTNVDTLFAGLNSLLCEKDQP-GLVRDFYKFIQP 2992
            MP I + GV++DFPF+PY CQ  YM KV+E L+   N ILESPTGTGKTLCLLC  LAW++H++      K+   ++ E+    +   + + N    +   I+    +PKIIY+SRTHSQL+Q IN L+ T Y   KV ++ SREQLCI+P+V   ESN  +I+ C+ +V +R C FYN  E+        + I DIEDL+  G K  VCPY+LSR +   ADI FMPYNYLLD+K RR +NI+LKG +VIFDEAHN+E++CE+SAS  LT  ++AS ++ + +VL E   + Q  +   +  AD+ S    + +L  I  LK  L  LE    +++L  + ++G+T   + +F+L          K   +D L++      G +   T T     GL+K+ + ++ VF  +  E           L + Y+V I  +            W +   +     + +VLS+WC + G +M  L    VRS+ILTSGTL P+ +  L+M I F V L N H+I+  Q+ V V  +G DG  L+S++  R      +SLG ++ N+++++P GLL+ FPSY +M K +E W + D+   M   K L VEP+ K  F+  +  +Y++ + P S  G+  L+V RGK SEGLD SD  GRGVIV GLPYP  MDPR+ LKM FLD+       G   + G+ WY+QQA RAVNQ+IGRVIRH +D+GA++L D RFA AD+R QLP W++ ++ + ++FG  IR+   FFR                           K P P     ++ S ++ +    Q SS  P+     +++  +Y  + V  A     G     +  E  A +P  ++   S ++ SL+   + AE            R   + +  V  PE+     +  + KL  +  ++++ ++N                F ++   ++D+K + +   L A L  L  E  +   L++ FY+F++P
Sbjct:    1 MPKIVLNGVTVDFPFQPYKCQQEYMTKVLECLQQKVNGILESPTGTGKTLCLLCTTLAWREHLRDGISARKIAERAQGELFP--DRALSSWGNAAAAAGDPIACYTDIPKIIYASRTHSQLTQVINELRNTSY-RPKVCVLGSREQLCIHPEVKKQESNHLQIHLCRKKVASRSCHFYNNVEEKSLEQELASPILDIEDLVKSGSKHRVCPYYLSRNLKQQADIIFMPYNYLLDAKSRRAHNIDLKGTVVIFDEAHNVEKMCEESASFDLTPHDLASGLDVIDQVLEEQTKAAQQGEPHPEFSADSPSPGLNM-ELEDIAKLKMILLRLEGAIDAVELPGD-DSGVTKPGSYIFELFAEAQITFQTKGCILDSLDQIIQHLAGRAGVFTNT----AGLQKLADIIQIVFSVDPSEGSPGSPAGLGALQS-YKVHIHPDAGHRRTAQRSDAWSTTAAR----KRGKVLSYWCFSPGHSMHELVRQGVRSLILTSGTLAPVSSFALEMQIPFPVCLENPHIIDKHQIWVGVVPRGPDGAQLSSAFDRRFSEECLSSLGKALGNIARVVPYGLLIFFPSYPVMEKSLEFWRARDLARKMEALKPLFVEPRSKGSFSETISAYYARVAAPGST-GATFLAVCRGKASEGLDFSDTNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMKGQGGAGGQFLSGQEWYRQQASRAVNQAIGRVIRHRQDYGAVFLCDHRFAFADARAQLPSWVRPHVRVYDNFGHVIRDVAQFFRVAERTMPAPAPRATAPSVRGEDAVSEAKSPGPFFSTRKAKSLDLHVPSLKQRSSGSPAAGDPESSLCVEYEQEPVP-ARQRPRGLLAALEHSEQRAGSPGEEQ-AHSCSTLSLLSEKRPAEE----------PRGGRKKIRLVSHPEEPVAGAQTDRAKLFMVAVKQELSQAN----------------FATFTQALQDYKGSDDFAALAACLGPLFAEDPKKHNLLQGFYQFVRP 958          
BLAST of RTEL1 vs. Ensembl Human
Match: RTEL1 (regulator of telomere elongation helicase 1 [Source:HGNC Symbol;Acc:HGNC:15888])

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 355/1024 (34.67%), Postives = 538/1024 (52.54%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVK------KVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDR-----------------------KVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEEL-KVLGEFIYSIQSTDAIID-EADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEK-CSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFG---IDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNI-----------------------TIKYPPPGLGCCESIS-NVPIEIQNQESSTKPSRIKSRTNISAQYSSKVVSFATSLKDGSQDFAKILESYANTPPIKKPESSLTSTSLMDILKRAENHVTEIEILPVKRTFNETVCEVDDPEKNTRKVK--KYKLVALKGQEKVKESNEYSFIIKRLFNEDVQGFISYKTVIEDFKKNTNVDTLFAGLNSLLCEKDQP-GLVRDFYKFIQP 2992
            MP I + GV++DFPF+PY CQ  YM KV+E L+   N ILESPTGTGKTLCLLC  LAW++H++      K+   ++ E+    +   + + N    +   I+    +PKIIY+SRTHSQL+Q IN L+ T Y  R                       KV ++ SREQLCI+P+V   ESN  +I+ C+ +V +R C FYN  E+        + I DIEDL+  G K  VCPY+LSR +   ADI FMPYNYLLD+K RR +NI+LKG +VIFDEAHN+E++CE+SAS  LT  ++AS ++ + +VL E   + Q  +   +  AD+ S    + +L  I  LK  L  LE    +++L  + ++G+T   + +F+L          K   +D L++      G +   T T     GL+K+ + ++ VF  +  E           L + Y+V I  +            W +   +     + +VLS+WC + G +M  L    VRS+ILTSGTL P+ +  L+M I F V L N H+I+  Q+ V V  +G DG  L+S++  R      +SLG ++ N+++++P GLL+ FPSY +M K +E W + D+   M   K L VEP+ K  F+  +  +Y++ + P S  G+  L+V RGK SEGLD SD  GRGVIV GLPYP  MDPR+ LKM FLD+       G   + G+ WY+QQA RAVNQ+IGRVIRH +D+GA++L D RFA AD+R QLP W++ ++ + ++FG  IR+   FFR                           K P P     ++ S ++ +    Q SS  P+     +++  +Y  + V  A     G     +  E  A +P  ++   S ++ SL+   + AE            R   + +  V  PE+     +  + KL  +  ++++ ++N                F ++   ++D+K + +   L A L  L  E  +   L++ FY+F++P
Sbjct:    1 MPKIVLNGVTVDFPFQPYKCQQEYMTKVLECLQQKVNGILESPTGTGKTLCLLCTTLAWREHLRDGISARKIAERAQGELFP--DRALSSWGNAAAAAGDPIACYTDIPKIIYASRTHSQLTQVINELRNTSYRSRCRATLWVLETAPPRPTVLSPTRPKVCVLGSREQLCIHPEVKKQESNHLQIHLCRKKVASRSCHFYNNVEEKSLEQELASPILDIEDLVKSGSKHRVCPYYLSRNLKQQADIIFMPYNYLLDAKSRRAHNIDLKGTVVIFDEAHNVEKMCEESASFDLTPHDLASGLDVIDQVLEEQTKAAQQGEPHPEFSADSPSPGLNM-ELEDIAKLKMILLRLEGAIDAVELPGD-DSGVTKPGSYIFELFAEAQITFQTKGCILDSLDQIIQHLAGRAGVFTNT----AGLQKLADIIQIVFSVDPSEGSPGSPAGLGALQS-YKVHIHPDAGHRRTAQRSDAWSTTAAR----KRGKVLSYWCFSPGHSMHELVRQGVRSLILTSGTLAPVSSFALEMQIPFPVCLENPHIIDKHQIWVGVVPRGPDGAQLSSAFDRRFSEECLSSLGKALGNIARVVPYGLLIFFPSYPVMEKSLEFWRARDLARKMEALKPLFVEPRSKGSFSETISAYYARVAAPGST-GATFLAVCRGKASEGLDFSDTNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMKGQGGAGGQFLSGQEWYRQQASRAVNQAIGRVIRHRQDYGAVFLCDHRFAFADARAQLPSWVRPHVRVYDNFGHVIRDVAQFFRVAERTMPAPAPRATAPSVRGEDAVSEAKSPGPFFSTRKAKSLDLHVPSLKQRSSGSPAAGDPESSLCVEYEQEPVP-ARQRPRGLLAALEHSEQRAGSPGEEQ-AHSCSTLSLLSEKRPAEE----------PRGGRKKIRLVSHPEEPVAGAQTDRAKLFMVAVKQELSQAN----------------FATFTQALQDYKGSDDFAALAACLGPLFAEDPKKHNLLQGFYQFVRP 982          
BLAST of RTEL1 vs. Ensembl Human
Match: RTEL1-TNFRSF6B (RTEL1-TNFRSF6B readthrough (NMD candidate) [Source:HGNC Symbol;Acc:HGNC:44095])

HSP 1 Score: 518.079 bits (1333), Expect = 6.863e-169
Identity = 301/769 (39.14%), Postives = 431/769 (56.05%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVK------KVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEEL-KVLGEFIYSIQSTDAIID-EADNESRSDEIPDLTQIIHLKQNLCI----------------------------LESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEK-CSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFG---IDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPL 2293
            MP I + GV++DFPF+PY CQ  YM KV+E L+   N ILESPTGTGKTLCLLC  LAW++H++      K+   ++ E  L  +   + + N    +   I+    +PKIIY+SRTHSQL+Q IN L+ T Y   KV ++ SREQLCI+P+V   ESN  +I+ C+ +V +R C FYN  E+        + I DIEDL+  G K  VCPY+LSR +   ADI FMPYNYLLD+K RR +NI+LKG +VIFDEAHN+E++CE+SAS  LT  ++AS ++ + +VL E   + Q  +   +  AD+ S    + +L  I  LK   C                             LE    +++L  + ++G+T   + +F+L          K   +D L++      G +   T T     GL+K+ + ++ VF  +  E           L + Y+V I  +            W +   +     + +VLS+WC + G +M  L    VRS+ILTSGTL P+ +  L+M I F V L N H+I+  Q+ V V  +G DG  L+S++  R      +SLG ++ N+++++P GLL+ FPSY +M K +E W + D+   M   K L VEP+ K  F+  +  +Y++ + P S  G+  L+V RGK SEGLD SD  GRGVIV GLPYP  MDPR+ LKM FLD+       G   + G+ WY+QQA RAVNQ+IGRVIRH +D+GA++L D R        Q P+
Sbjct:    1 MPKIVLNGVTVDFPFQPYKCQQEYMTKVLECLQQKVNGILESPTGTGKTLCLLCTTLAWREHLRDGISARKIAERAQGE--LFPDRALSSWGNAAAAAGDPIACYTDIPKIIYASRTHSQLTQVINELRNTSY-RPKVCVLGSREQLCIHPEVKKQESNHLQIHLCRKKVASRSCHFYNNVEEKSLEQELASPILDIEDLVKSGSKHRVCPYYLSRNLKQQADIIFMPYNYLLDAKSRRAHNIDLKGTVVIFDEAHNVEKMCEESASFDLTPHDLASGLDVIDQVLEEQTKAAQQGEPHPEFSADSPSPGLNM-ELEDIAKLKSKCCPPRLLAAGWGLLLARRWVTPPRPTVILLRLEGAIDAVELPGD-DSGVTKPGSYIFELFAEAQITFQTKGCILDSLDQIIQHLAGRAGVFTNT----AGLQKLADIIQIVFSVDPSEGSPGSPAGLGALQS-YKVHIHPDAGHRRTAQRSDAWSTTAAR----KRGKVLSYWCFSPGHSMHELVRQGVRSLILTSGTLAPVSSFALEMQIPFPVCLENPHIIDKHQIWVGVVPRGPDGAQLSSAFDRRFSEECLSSLGKALGNIARVVPYGLLIFFPSYPVMEKSLEFWRARDLARKMEALKPLFVEPRSKGSFSETISAYYARVAAPGST-GATFLAVCRGKASEGLDFSDTNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMKGQGGAGGQFLSGQEWYRQQASRAVNQAIGRVIRHRQDYGAVFLCDHRCQRRPPGLQHPV 754          
BLAST of RTEL1 vs. Ensembl Celegans
Match: rtel-1 (Regulator of telomere elongation helicase 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q93575])

HSP 1 Score: 407.912 bits (1047), Expect = 4.355e-125
Identity = 262/784 (33.42%), Postives = 423/784 (53.95%), Query Frame = 2
Query:  131 VSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFE-----KAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRS-------------------DEIPDLTQIIHLKQNLCIL--ESEFHSI-DLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSF-IGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESC--------DIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDD---RLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFR 2365
            +S+ FPFEPY CQ I+M+ V++ L    +A LESPTGTGKTL LLC+ LAW    K+  T   D      +  G       +K+   + K   VP I Y+SRTHSQL Q ++ L RT+Y   K  ++ SRE  CIN KV  ++ +  + + C+  V  R C +YN+F+     K  E L  + +  DIED + +G + S+CPYF+SR+  ++A++  +PYNY++D K+RR Y ++LK +IVIFDEAHN+E +CE +AS +LTS +IA CIEELK +   +  +   +    EAD E+ +                   D +  L +I  L++ +  L   S+  S+  L   A+ G      IL + L + GF+ ++    +D+L    S+ +  + E  LT+ G  G+EKV +F+ +++     +   ++     KL       +   +  T  RN K+    +K+     ++   + ++C  A  +M+ L    VR+++L SGTL PI+    +M + F   L N H +    ++ S+ T+G  G  L  S+  R+ + Y   +  ++L + ++IP+G+L+ F SY  M + +  W++           +  M + K+++VEP+ K +   A+   Y++        G+ LL+V RGK+SEG+D  D + R VI++G+PYP + D R+ LK  +LDD   R          + WY+ +A+RAVNQ+IGRV+RH  DFG + L D R+A+A      P WL++ I  S+  G A++ T  FF+
Sbjct:   17 LSVKFPFEPYECQRIFMKNVVDVLDRKLDAALESPTGTGKTLSLLCSTLAWVQRQKE--TKPLDFATWQTSGAGG-----AEKTDEKL-KSAYVPTIFYASRTHSQLEQVVHELNRTEYKWVKTTILGSREHFCINQKVKKIKESNRQAHVCRGLVSKRACHYYNKFDACTTDKMTEFLD-KGEAMDIEDFVKLGTQNSLCPYFMSRQRSETAELILLPYNYIIDPKMRRRYKLDLKNSIVIFDEAHNLESICESNASAELTSTSIALCIEELKKVLALL--VDEEETARSEADAETGAFGSAKIDLTKKLIENLRTEDLMTVLEKIFSLEEEMDKLFGSSQLKSVPPLSGKASDG-----EILLETLAKAGFDANSVERLVDVLRDAISYLLSKNEEVALTEKG-DGMEKVADFLLSIYSTHAQDVAAAVGEETVKL-------VDRVDPKTVARNCKLYIQKDKD-----NEKLTIKYFCFQASISMRMLKMRGVRNVLLASGTLSPIQAFTYNMGLNFGAILENEHALKQVPVLTSIVTRGKRG-GLAGSFQNRKNLDYVTGVAEALLRVMEVIPQGILIFFSSYSQMDELVATWKTTKWSSNSNESFWEKMEKTKRVVVEPRAKEELA-AIRLRYTQGVS--EQHGAALLAVCRGKVSEGIDFCDAESRAVIIIGIPYPPIHDERVVLKKMYLDDLMGRKDTKSERQSSQDWYQMEAFRAVNQAIGRVLRHKDDFGTVVLMDTRYASAKPEM-FPKWLRNTISRSDTDGCALK-TSRFFK 765          
BLAST of RTEL1 vs. Ensembl Celegans
Match: rtel-1 (Regulator of telomere elongation helicase 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q93575])

HSP 1 Score: 407.912 bits (1047), Expect = 4.355e-125
Identity = 262/784 (33.42%), Postives = 423/784 (53.95%), Query Frame = 2
Query:  131 VSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFE-----KAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRS-------------------DEIPDLTQIIHLKQNLCIL--ESEFHSI-DLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSF-IGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESC--------DIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDD---RLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFR 2365
            +S+ FPFEPY CQ I+M+ V++ L    +A LESPTGTGKTL LLC+ LAW    K+  T   D      +  G       +K+   + K   VP I Y+SRTHSQL Q ++ L RT+Y   K  ++ SRE  CIN KV  ++ +  + + C+  V  R C +YN+F+     K  E L  + +  DIED + +G + S+CPYF+SR+  ++A++  +PYNY++D K+RR Y ++LK +IVIFDEAHN+E +CE +AS +LTS +IA CIEELK +   +  +   +    EAD E+ +                   D +  L +I  L++ +  L   S+  S+  L   A+ G      IL + L + GF+ ++    +D+L    S+ +  + E  LT+ G  G+EKV +F+ +++     +   ++     KL       +   +  T  RN K+    +K+     ++   + ++C  A  +M+ L    VR+++L SGTL PI+    +M + F   L N H +    ++ S+ T+G  G  L  S+  R+ + Y   +  ++L + ++IP+G+L+ F SY  M + +  W++           +  M + K+++VEP+ K +   A+   Y++        G+ LL+V RGK+SEG+D  D + R VI++G+PYP + D R+ LK  +LDD   R          + WY+ +A+RAVNQ+IGRV+RH  DFG + L D R+A+A      P WL++ I  S+  G A++ T  FF+
Sbjct:   17 LSVKFPFEPYECQRIFMKNVVDVLDRKLDAALESPTGTGKTLSLLCSTLAWVQRQKE--TKPLDFATWQTSGAGG-----AEKTDEKL-KSAYVPTIFYASRTHSQLEQVVHELNRTEYKWVKTTILGSREHFCINQKVKKIKESNRQAHVCRGLVSKRACHYYNKFDACTTDKMTEFLD-KGEAMDIEDFVKLGTQNSLCPYFMSRQRSETAELILLPYNYIIDPKMRRRYKLDLKNSIVIFDEAHNLESICESNASAELTSTSIALCIEELKKVLALL--VDEEETARSEADAETGAFGSAKIDLTKKLIENLRTEDLMTVLEKIFSLEEEMDKLFGSSQLKSVPPLSGKASDG-----EILLETLAKAGFDANSVERLVDVLRDAISYLLSKNEEVALTEKG-DGMEKVADFLLSIYSTHAQDVAAAVGEETVKL-------VDRVDPKTVARNCKLYIQKDKD-----NEKLTIKYFCFQASISMRMLKMRGVRNVLLASGTLSPIQAFTYNMGLNFGAILENEHALKQVPVLTSIVTRGKRG-GLAGSFQNRKNLDYVTGVAEALLRVMEVIPQGILIFFSSYSQMDELVATWKTTKWSSNSNESFWEKMEKTKRVVVEPRAKEELA-AIRLRYTQGVS--EQHGAALLAVCRGKVSEGIDFCDAESRAVIIIGIPYPPIHDERVVLKKMYLDDLMGRKDTKSERQSSQDWYQMEAFRAVNQAIGRVLRHKDDFGTVVLMDTRYASAKPEM-FPKWLRNTISRSDTDGCALK-TSRFFK 765          
BLAST of RTEL1 vs. Ensembl Celegans
Match: dog-1 (Deletions Of G-rich DNA [Source:UniProtKB/TrEMBL;Acc:O62217])

HSP 1 Score: 166.777 bits (421), Expect = 9.114e-42
Identity = 96/272 (35.29%), Postives = 153/272 (56.25%), Query Frame = 2
Query: 1475 VLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSY--LTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQH----KQLIVEPQDKTKFTLAMEQFYSKNSDP----LSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERF 2260
             +S WCM+   +    A  E RSI+L SGTL P++TLK ++ ++F+ ++    VIN D +  +V   G  G  +  +Y   +  + S+   LG  I  +   +P G+L   PSY    + +++ + C I NS M+     K ++ EP+  ++ T  M+QF +   DP     +  GS++ +V RGK+SEG+D +D + R VI VG+PYP+ MD ++  K  + D   K  K  + G  WY  QAYRA+NQ++GR +RH  D+GA+ + DER 
Sbjct:  661 TISLWCMSPALSFFD-AFNETRSIVLASGTLCPMDTLKTELGMEFKQQVEGDQVINKDNIFAAVLPIGPFGNRIQCTYRNTSDPESSFYCELGAIIKYVCSNVPAGILCFLPSY----RVLDQLKQCMIRNSTMRQIEMKKVVLYEPRRSSELTSVMDQFDAAIFDPSRFGANINGSLMFAVFRGKVSEGIDFADDRARVVISVGIPYPNAMDDQVNAKKLYNDQNSKE-KGILTGDEWYTTQAYRALNQALGRCLRHKNDWGAMLMIDERL 926          

HSP 2 Score: 103.605 bits (257), Expect = 4.073e-22
Identity = 82/249 (32.93%), Postives = 124/249 (49.80%), Query Frame = 2
Query:  371 VKKSQLNISKINVVPK--IIYSSRTHSQLSQCINALKRTQYCD-RKVGMIASREQLCINPKVMNL--------ESNTAKIYGC--KSRVKTRKCFFYNQFEKA----KEILSSETKIADIEDL---LTIGKKKSVCPYF-LSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQ 1054
            VKK +   +K   +P+  I Y +RTH Q++Q +    R  Y    K  ++ASREQ CINP             E N+A   GC  KS +K R       FEKA      +  + T + D+E +   L I   + +CPYF  +R +   ADI F P++YL+D  IR   ++ ++ +IVI DEAHNIE  C ++AS   T   +   I  L++        ++ D  +D+   E +   IPD  + +HLK+
Sbjct:  222 VKKPEPVETKCTCLPRVRIYYGTRTHKQIAQVVKEFSRLPYAKILKHTILASREQSCINPAARKHADISQYCKEVNSAHSIGCSFKSAMKPR-------FEKALPLRDHLERNGTVVFDMEKIVETLAISYPQ-LCPYFSTNRILTQDADIIFCPFSYLVDPLIRNSSDVQIRNSIVILDEAHNIEDTCREAASFSFTEKELDDSILSLRI------KRKAVDTELDKTGIEEKLLHIPD--REVHLKE 454          
BLAST of RTEL1 vs. Ensembl Celegans
Match: chl-1 (ATP-dependent DNA helicase chl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21489])

HSP 1 Score: 156.377 bits (394), Expect = 1.106e-38
Identity = 96/287 (33.45%), Postives = 146/287 (50.87%), Query Frame = 2
Query: 1535 VRSIILTSGTLYP----IETLKLDMDIKFEVELRNS--HVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKT-----KFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFF 2362
             R+ IL  GT+ P    +ETL     I  +   R S  HVI+  Q++     +  DG+P   +Y TR   +   SL  SI  L   IP G+++  PSY  +    ++ +   I   + + K +  E +  T     +F+ A +          ++KG+IL +V  GK+SEG++  D  GR VIV+GLPYP+     +R +M FLD ++        G   Y+     AVNQ+IGR IRH RD+ A+YLFD+R+A   +R +L  W+     +   FG+ IR T +FF
Sbjct:  554 ARATILVGGTMEPAQLLVETLSRG-SIGADSIRRFSCCHVIDDSQLLAVTVERTVDGKPFQLTYQTRGADTTLRSLATSIQALIPHIPNGVVIFVPSYDFLFNFQKKMKEFGILKRIEEKKAVFTESRQPTSDVWDRFSRAAK----------TSKGAILFAVVGGKMSEGINFCDELGRAVIVIGLPYPNKTSVELRERMKFLDTQMP-----NGGNLLYESLCMHAVNQAIGRAIRHRRDYAAVYLFDDRYAKESTRRKLSTWIGDRTQVKLGFGEIIRKTRSFF 824          

HSP 2 Score: 81.2629 bits (199), Expect = 2.906e-15
Identity = 74/254 (29.13%), Postives = 114/254 (44.88%), Query Frame = 2
Query:  416 KIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESN--------TAKIYGCKSRVKTRK---------------CFFYN--QFEKA-KEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCED--SASVQLTSINIA-SCIEE------LKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILE 1072
            KI Y+SRTHSQL Q    L +T++  R V   ASR  LC+N +V  L+ N          +  G   + K +K               C FYN  Q E     +LS+  K+    ++   GK  + CPYF +R+      +  +PY  LL    R+ + I LK N+++ DEAHN+        SA +   S+ +A   I E      LK+L   +  ++  +++  +      S    D+  +  L +NL ILE
Sbjct:  185 KIFYASRTHSQLEQLAEELAKTRFQPRIV-TCASRGTLCVNEEVKKLKLNHLINEKCMELRKNGMSEKEKVQKLEKGTTKKTKTCATSCEFYNSTQIEDVVNGVLSN--KLKSTLEVSKQGKLSNGCPYFATRKSVPQCQLVLLPYQVLLHDGTRKAWGIELKDNVIVLDEAHNVLNTISSLYSAEISTKSLTLALRLIREYNAHYKLKLLAHNLLYMKQLESLTSKMLIFLNSQSKEDVMTMAQLARNLNILE 435          

HSP 3 Score: 55.0694 bits (131), Expect = 3.396e-7
Identity = 21/47 (44.68%), Postives = 32/47 (68.09%), Query Frame = 2
Query:  143 FPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAW 283
            FPF+PY  Q+  M ++ + ++  K  I ESPTGTGK+L +LC+ + W
Sbjct:    6 FPFQPYDIQLNLMREIRQCIEQRKIGIFESPTGTGKSLSVLCSTMTW 52          
BLAST of RTEL1 vs. Ensembl Celegans
Match: chl-1 (ATP-dependent DNA helicase chl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21489])

HSP 1 Score: 156.377 bits (394), Expect = 1.106e-38
Identity = 96/287 (33.45%), Postives = 146/287 (50.87%), Query Frame = 2
Query: 1535 VRSIILTSGTLYP----IETLKLDMDIKFEVELRNS--HVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKT-----KFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFF 2362
             R+ IL  GT+ P    +ETL     I  +   R S  HVI+  Q++     +  DG+P   +Y TR   +   SL  SI  L   IP G+++  PSY  +    ++ +   I   + + K +  E +  T     +F+ A +          ++KG+IL +V  GK+SEG++  D  GR VIV+GLPYP+     +R +M FLD ++        G   Y+     AVNQ+IGR IRH RD+ A+YLFD+R+A   +R +L  W+     +   FG+ IR T +FF
Sbjct:  554 ARATILVGGTMEPAQLLVETLSRG-SIGADSIRRFSCCHVIDDSQLLAVTVERTVDGKPFQLTYQTRGADTTLRSLATSIQALIPHIPNGVVIFVPSYDFLFNFQKKMKEFGILKRIEEKKAVFTESRQPTSDVWDRFSRAAK----------TSKGAILFAVVGGKMSEGINFCDELGRAVIVIGLPYPNKTSVELRERMKFLDTQMP-----NGGNLLYESLCMHAVNQAIGRAIRHRRDYAAVYLFDDRYAKESTRRKLSTWIGDRTQVKLGFGEIIRKTRSFF 824          

HSP 2 Score: 81.2629 bits (199), Expect = 2.906e-15
Identity = 74/254 (29.13%), Postives = 114/254 (44.88%), Query Frame = 2
Query:  416 KIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESN--------TAKIYGCKSRVKTRK---------------CFFYN--QFEKA-KEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCED--SASVQLTSINIA-SCIEE------LKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILE 1072
            KI Y+SRTHSQL Q    L +T++  R V   ASR  LC+N +V  L+ N          +  G   + K +K               C FYN  Q E     +LS+  K+    ++   GK  + CPYF +R+      +  +PY  LL    R+ + I LK N+++ DEAHN+        SA +   S+ +A   I E      LK+L   +  ++  +++  +      S    D+  +  L +NL ILE
Sbjct:  185 KIFYASRTHSQLEQLAEELAKTRFQPRIV-TCASRGTLCVNEEVKKLKLNHLINEKCMELRKNGMSEKEKVQKLEKGTTKKTKTCATSCEFYNSTQIEDVVNGVLSN--KLKSTLEVSKQGKLSNGCPYFATRKSVPQCQLVLLPYQVLLHDGTRKAWGIELKDNVIVLDEAHNVLNTISSLYSAEISTKSLTLALRLIREYNAHYKLKLLAHNLLYMKQLESLTSKMLIFLNSQSKEDVMTMAQLARNLNILE 435          

HSP 3 Score: 55.0694 bits (131), Expect = 3.396e-7
Identity = 21/47 (44.68%), Postives = 32/47 (68.09%), Query Frame = 2
Query:  143 FPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAW 283
            FPF+PY  Q+  M ++ + ++  K  I ESPTGTGK+L +LC+ + W
Sbjct:    6 FPFQPYDIQLNLMREIRQCIEQRKIGIFESPTGTGKSLSVLCSTMTW 52          
BLAST of RTEL1 vs. Ensembl Fly
Match: CG4078 (gene:FBgn0029798 transcript:FBtr0070807)

HSP 1 Score: 509.22 bits (1310), Expect = 2.764e-163
Identity = 283/772 (36.66%), Postives = 434/772 (56.22%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAW-----QDHVKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEI--LSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFI-----QENEIATSNRNNKINW-GSNKNQAVNGDKN--RVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNH---FGDAIRNTCNFFRN 2368
            MP   I G+ + FPFEPY  Q  YMEKVI  L+DG N +LESPTGTGKTL LLC++LAW      +H K++    + +             +++ K+    +   V PK+IY+SRTHSQL+Q +  LKRT Y + +  ++ SR+QLCI+P+VM  + N+ K   CK RV ++ C F  + E  K+   L   T I DIEDL+ +G++  +CPYF SRE+   ADITFMPYNYLLD K R+   I L   IVI DEAHNIE++CE+SASVQ+ S ++A  IE++  + +   S +S D   DE  + +  D       ++ L++ +  +        + +NA  G T   +++++LL +  F + N    + LL+K   ++ ++S+    + G            T+  D +   F + +++  K+ A ++V +     ++          +  W G     A  G     ++++FWC   G  M+ L   +VRS+ILTSGTL P++ L  ++ I     L N H+++  Q+ V +   G D + L S+Y  R+   Y +SLG +ILN+++I+P GLLV FPSY M+ KC++ W++  ++  +   K + +EP+ K +FT  ME+FY    D   +KG++ ++V RGK+SEGLD +D  GR VI+ GLP+P + DP++ LK  +L+         + G+ WY   A RAVNQ+IGRVIRH  D+GAI L D RF  A    QL  W++ ++        FG  +R    FF+N
Sbjct:    1 MPESLIAGIPVHFPFEPYPVQRAYMEKVIHCLRDGTNGVLESPTGTGKTLSLLCSSLAWIRTRQSEHQKQMVKMEKADFSGLGGGAPGGDLSELAKTMGRANNWGV-PKVIYASRTHSQLTQAMRELKRTAYANMRSVVLGSRDQLCIHPEVMREQGNSNKTNMCKLRVHSKTCSFQMRVESRKDHPDLRGPT-IMDIEDLVKVGQRLKICPYFASRELVPQADITFMPYNYLLDPKARKANKIELGNTIVILDEAHNIEKICEESASVQIKSSDVAMAIEDVTHIMQVFASGESQDMAGDEPKDFTLDDLTLLKEMLLELEKAIDAI--------VVDNAVDGTTFPASMMYELLGKANFTYGNVATIVSLLDKLVQYLLVASQQMSIRKG---------GTFTLLSDLLTIVFANKEDVMSKVYASFKVHVLVEESKQGHGKQQGAKQQGGWLGKGTIAAATGLSKVAKIINFWCFNPGFGMEQLLNTQVRSVILTSGTLAPLKPLIAELAIPVAQHLENPHIVDQSQVYVKIIGTGPDRQQLISNYANRDNPKYISSLGQTILNVARIVPDGLLVFFPSYPMLNKCVDAWQASGLWADISCKKPIFLEPRSKDQFTSTMEEFYQAIRD---SKGAVFMAVCRGKVSEGLDFADRNGRAVIITGLPFPPLKDPKVILKRRYLEANRTRENQLLSGQEWYNLDATRAVNQAIGRVIRHRNDYGAILLCDSRFKDASQVQQLSKWIRGHLGDRPQCSPFGPIVRELRQFFKN 750          
BLAST of RTEL1 vs. Ensembl Fly
Match: CG4078 (gene:FBgn0029798 transcript:FBtr0332398)

HSP 1 Score: 509.22 bits (1310), Expect = 2.764e-163
Identity = 283/772 (36.66%), Postives = 434/772 (56.22%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAW-----QDHVKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEI--LSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFI-----QENEIATSNRNNKINW-GSNKNQAVNGDKN--RVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNH---FGDAIRNTCNFFRN 2368
            MP   I G+ + FPFEPY  Q  YMEKVI  L+DG N +LESPTGTGKTL LLC++LAW      +H K++    + +             +++ K+    +   V PK+IY+SRTHSQL+Q +  LKRT Y + +  ++ SR+QLCI+P+VM  + N+ K   CK RV ++ C F  + E  K+   L   T I DIEDL+ +G++  +CPYF SRE+   ADITFMPYNYLLD K R+   I L   IVI DEAHNIE++CE+SASVQ+ S ++A  IE++  + +   S +S D   DE  + +  D       ++ L++ +  +        + +NA  G T   +++++LL +  F + N    + LL+K   ++ ++S+    + G            T+  D +   F + +++  K+ A ++V +     ++          +  W G     A  G     ++++FWC   G  M+ L   +VRS+ILTSGTL P++ L  ++ I     L N H+++  Q+ V +   G D + L S+Y  R+   Y +SLG +ILN+++I+P GLLV FPSY M+ KC++ W++  ++  +   K + +EP+ K +FT  ME+FY    D   +KG++ ++V RGK+SEGLD +D  GR VI+ GLP+P + DP++ LK  +L+         + G+ WY   A RAVNQ+IGRVIRH  D+GAI L D RF  A    QL  W++ ++        FG  +R    FF+N
Sbjct:    1 MPESLIAGIPVHFPFEPYPVQRAYMEKVIHCLRDGTNGVLESPTGTGKTLSLLCSSLAWIRTRQSEHQKQMVKMEKADFSGLGGGAPGGDLSELAKTMGRANNWGV-PKVIYASRTHSQLTQAMRELKRTAYANMRSVVLGSRDQLCIHPEVMREQGNSNKTNMCKLRVHSKTCSFQMRVESRKDHPDLRGPT-IMDIEDLVKVGQRLKICPYFASRELVPQADITFMPYNYLLDPKARKANKIELGNTIVILDEAHNIEKICEESASVQIKSSDVAMAIEDVTHIMQVFASGESQDMAGDEPKDFTLDDLTLLKEMLLELEKAIDAI--------VVDNAVDGTTFPASMMYELLGKANFTYGNVATIVSLLDKLVQYLLVASQQMSIRKG---------GTFTLLSDLLTIVFANKEDVMSKVYASFKVHVLVEESKQGHGKQQGAKQQGGWLGKGTIAAATGLSKVAKIINFWCFNPGFGMEQLLNTQVRSVILTSGTLAPLKPLIAELAIPVAQHLENPHIVDQSQVYVKIIGTGPDRQQLISNYANRDNPKYISSLGQTILNVARIVPDGLLVFFPSYPMLNKCVDAWQASGLWADISCKKPIFLEPRSKDQFTSTMEEFYQAIRD---SKGAVFMAVCRGKVSEGLDFADRNGRAVIITGLPFPPLKDPKVILKRRYLEANRTRENQLLSGQEWYNLDATRAVNQAIGRVIRHRNDYGAILLCDSRFKDASQVQQLSKWIRGHLGDRPQCSPFGPIVRELRQFFKN 750          
BLAST of RTEL1 vs. Ensembl Fly
Match: Xpd (gene:FBgn0261850 transcript:FBtr0071576)

HSP 1 Score: 212.616 bits (540), Expect = 4.686e-57
Identity = 189/766 (24.67%), Postives = 339/766 (44.26%), Query Frame = 2
Query:  116 INICGVSIDFPFEP-YACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQ-YCDRK-------VGMI-ASREQLCINPKVMNLESNTA---KIYG-CKSRVKTRK--------CFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINL-KGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDL------GN--NANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVIS 2320
            +++ G+ + FP+E  Y  Q  YM ++  SL    + +LE P+GTGKT  LL   +A+                                    +     V K+IY SRT  ++ + I  L+    Y +R         G++ +SR+ +CI+P+V       A   K YG   S ++ R         C ++  F    +  +    +  I+DL   G+ ++ CPYFL+R     A I    Y+YLLD KI ++ +  + + + V+FDEAHNI+ VC DS SV++    +      L  L + +  I+  D       NE     +  L      +    IL +     D+      GN  NA+  L+     +  +  R   +H  +      L+  SS I +  +P          E++   ++T+   ++  E+ ++  L    +     + +   I     ++K    SN           +L F C+ +   M  +     +++++TSGTL P++     +D    V    +  +    ++  + +KG D   ++S + TRE  +   + G  ++ ++K +P G++  F SY  +   +  W    I ++++++K L +E QD  + + A+   Y K  D    +G++LL+VARGK+SEG+D   H GR V++ G+PY       ++ ++ +L D     +F I    +    A R   Q +GR +R   D+G +   D+RF+  D R +LP W+Q ++V S
Sbjct:    3 LSVDGLLVYFPYEYIYPEQYAYMLELKRSLDAKGHCLLEMPSGTGKTATLLSLIVAYM-----------------------------------VEHPETVRKLIYCSRTVPEIEKVIAELQNLMVYYERHCPNPPPFTGLVLSSRKNMCIHPEVSKEREGKAVDGKCYGLTASYIRERHEMDTETPICQYFEGFSLEGKESTLPVGVYSIDDLKEYGRSRNWCPYFLARYAIAHAHIVVYSYHYLLDPKIAQVVSKEMSRESCVVFDEAHNIDNVCIDSMSVKINRRTVERSTNALNHLTKLVQDIREEDT---NRLNEEYQRMVQGLKDASVQRDTDMILANPVLPNDVLTEVVPGNIRNADHFLSFLRRFIEYIKTRLRVHHVVQESPAGFLKDISSKICIERKPLRF-----CAERLSSLLRTLEISDL-TEYGAL-TLITHFATLVSTYTKGFTIIIEPFDDKTPTVSNP----------ILHFSCLDSSIAMAPVFS-RFQTVVITSGTLSPMDMYPKILDFDPVVMSSFTMTLARPCLLPMIVSKGNDQVTISSKFETREDTAVIRNYGQLLVEVAKTVPDGIVCFFTSYLYLESVVASWYDQGIVDTLLRYKLLFIETQDNAETSYALMN-YVKACD--CGRGAVLLAVARGKVSEGVDFDHHYGRAVLMFGIPYVYTQSRILKARLDYLRD-----QFQIRENDFLTFDAMRHAAQCVGRALRGKTDYGIMIFADKRFSRHDKRSRLPKWIQEHLVDS 704          
BLAST of RTEL1 vs. Ensembl Fly
Match: CG11403 (gene:FBgn0026876 transcript:FBtr0070245)

HSP 1 Score: 148.673 bits (374), Expect = 3.854e-36
Identity = 91/290 (31.38%), Postives = 145/290 (50.00%), Query Frame = 2
Query: 1529 CEVRSIILTSGTLYPIETLKLDMDIKFE---VELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQF---YSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNH----FGDAIRNTCNFFRN 2368
             E R+I++  GT+ P + LK  +        VE   +HV+  D ++  V + G  G PL+  +  R        L   + NL +++P G++   PSY  + K  +  E      ++   K +  E       + + EQ    Y+      ++ G++LLSV  GK+SEGL+ +D  GR V+VVGLPY + + P +R +M  LD++L        G  +Y+    +AVNQ IGR +RH +D+  +YL D+RFA    R +LP W+  +IV +N     FG     T  FF+ 
Sbjct:  581 AEARAIVIAGGTMQPTKELKEQLFTGCHDRLVERFYNHVVANDAILPFVISNGPSGAPLSFKFAHRGSAEMLRELSMILRNLCQVVPGGVVCFLPSYEYLDKVYKYLEQSGTLETISGRKSVFRE------VSGSAEQLLDNYALAIKRPASYGALLLSVVGGKLSEGLNFADDLGRAVLVVGLPYSNSLSPELRQRMQHLDEKLGPGA----GNEYYENLCVKAVNQCIGRAVRHIKDYACVYLLDKRFADPKIRGKLPKWISRHIVEANAANGGFGAVQGRTARFFKG 860          

HSP 2 Score: 65.0846 bits (157), Expect = 3.298e-10
Identity = 58/173 (33.53%), Postives = 82/173 (47.40%), Query Frame = 2
Query:  416 KIIYSSRTHSQLSQCINALKRTQYCD--RKVGMIASREQLCINPKVMNLESNTAKIYGC--------------KSRVKTR---KCFFYNQFEKAKEILSSETKIA-----DIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNI 862
            +I + SRTHSQL+Q +  L++T +    R + +  SR+QLC NP V  L+        C              KSR+      +C F     KA  ++ S   +A     DIE+L   G     C Y+ SR   + A +  +PY  LL    R    I+LKG+IVI DEAHN+
Sbjct:  189 QIFFCSRTHSQLAQIVAELRKTPHGQSVRSISL-GSRQQLCGNPAVRKLKHVGLMNERCLDMATKKARPNPSKKSRLTAEANSRCPF-----KAASLVESLRDLALTEPLDIEELANEGTACGGCSYYASRSAVEHAQLILLPYQLLLQKSARNQLGISLKGSIVIVDEAHNL 355          

HSP 3 Score: 56.6102 bits (135), Expect = 1.198e-7
Identity = 23/47 (48.94%), Postives = 31/47 (65.96%), Query Frame = 2
Query:  143 FPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAW 283
            FP+ PY  Q   M+++ + L+ G+  I ESPTGTGK+L L C AL W
Sbjct:   20 FPYSPYEIQEQLMQELFQVLERGQVGIFESPTGTGKSLTLTCGALTW 66          
BLAST of RTEL1 vs. Ensembl Zebrafish
Match: rtel1 (regulator of telomere elongation helicase 1 [Source:NCBI gene;Acc:503732])

HSP 1 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 370/1024 (36.13%), Postives = 551/1024 (53.81%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVK------KVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKA---KEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEEL-KVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGE---EFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDD----RLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNITIKYP-PPGLGCCESISN-VPIEIQNQESS--TK---PSRI--KSRTNISAQYSSKVVSFATSLKDGSQDFAKILESYANTPPIKKPESSLTSTSLMDILKRAE-----------NHVTEIEILPVKRTFNETVCEVDDPEKNTRKVKKYKLVALKGQEKVKESNEYSFIIKRLFNEDVQGFISYKTVIEDFKKNTNVDTLFAGL-NSLLCEKDQPGLVRDFYKFIQPEFQARFAELCESVLGLDCMEGKEN 3064
            MP+I + G+++DFPF PY CQ  YM KVIE L+   N +LESPTGTGKTLCLLC+ LAW+DH K      K+T       L       +  W          +    +PKIIY+SRTHSQL+Q +N LK T Y   K+ ++ SREQLCIN +VM  ESN  K++ C+++V +R C FYN  ++    KEI++S   I D+EDL+  GKK+ VCPY+LSR +   AD+ FMPYNYLLD K RR +NI LKG +VIFDEAHN+E++CE+S S  LT  ++ S IE + ++L E    I   D+  D       S    D+T I  +KQ L  LE+  +  ++  N N G+T   + +F+L      N   K   ++ +E+ + ++       L      GL+KV + ++ VF  E  E   +  + ++L++     ++V I  +      +     W S+  +     +  VLS+WC + G +M+ L   EVR IILTSGTL P+ +   +M I F V L N HVI  DQ+ VS+  KG DG  L++++  R      +S+GN+++NLS+++P GLLV FPSY +M K +E W +    + +   K + VEP+ K  FT  ++ +Y K  DP S+ GS   +V RGK SEGLD +D  GRGV++ GLP+P  MDPR+ LKM +LD+    ++   K+ + G+ WY+QQA RAVNQ+IGRVIRH  D+GAI+L D RF +AD+R QLP W++  + I + FG  +R+   FFR      P P   G  E   N     + N  SS  TK   PS I  K++T  +   S K     +    G +  A++   Y      K+   SL   +L D   + E           +H++ + +   KR  +E+           RK+K  +          K    +   ++R  +   + F      ++ +K   N++ L A +   L+ + +   L+R  Y+FI+P  +  + E C  + G  C   +E+
Sbjct:    1 MPVIKLKGINVDFPFTPYPCQEDYMSKVIECLQKKVNGVLESPTGTGKTLCLLCSTLAWRDHFKDTISARKITERMGGAELFADRPMSS--WGTAATDGDTPTYYTDIPKIIYASRTHSQLTQVVNELKNTSY-RPKICVLGSREQLCINQEVMRHESNHIKVHMCRAKVSSRSCIFYNNVDEKSTDKEIVNS---ILDVEDLVKTGKKQRVCPYYLSRSLKQHADVIFMPYNYLLDPKSRRAHNIELKGAVVIFDEAHNVEKMCEESTSFDLTPHDLISAIEAVDRLLREQASDISKADSAEDFNVESLNSGLKMDITTIAKVKQILMDLETAINDFEMPAN-NQGITKPGSFIFELFEMANVNSKTKTETVEAMEQITGYLAGRPGVFLN---TSGLQKVADIIQLVFVAEPAEGSKKSQTGNSLKE-----FKVHIHPDNSNFKKKQITDVWASSSTKK----QGNVLSYWCFSPGFSMQELLRQEVRCIILTSGTLSPLSSFTCEMQIPFPVSLENPHVIQRDQIFVSIIEKGPDGVQLSTAFDRRFVPENMSSMGNTLVNLSRVVPHGLLVFFPSYPVMDKTLEFWRAKGHADRIENVKPMFVEPRGKGTFTEVIDGYYGKVDDPNSSGGS-FFAVCRGKASEGLDFADTYGRGVVITGLPFPPRMDPRVVLKMQYLDEMCRNKISGVKY-LTGQEWYRQQASRAVNQAIGRVIRHREDYGAIFLCDHRFKSADARNQLPSWVRPYVKIYDGFGTMVRDVAQFFRTAQKTRPVPVKKGKAEGHENQADTRLLNTGSSCLTKSVWPSDIYQKAKTLDAHVPSLKRRKLDSEEHSGREGAARLCIQYEMEMTSKRKPVSLLD-ALDDTTDKEEREDTMVGEERASHLSTLSLQHDKRLDDES-------RGGKRKIKVVQERETVTSHTAKTGKAFMMELRRCLSH--ENFKLIMEALQSYKTADNLNNLLATVAEPLIQDHNTHSLLRGLYQFIRPHHKKEYDERCLELTGEGCGYKQEH 993          
BLAST of RTEL1 vs. Ensembl Zebrafish
Match: brip1 (BRCA1 interacting protein C-terminal helicase 1 [Source:ZFIN;Acc:ZDB-GENE-081107-11])

HSP 1 Score: 289.271 bits (739), Expect = 6.557e-81
Identity = 202/688 (29.36%), Postives = 334/688 (48.55%), Query Frame = 2
Query:  410 VPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKT---RKCFFYNQFEKAK-----EILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLT---QIIHLKQNLC--ILESEFHSI--------DLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFM---KTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWG----SNKNQAVNGDKNRV--LSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQ--DKTKFTLAMEQFY----SKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRF--QLPLWLQSNIVISNHFGDAIRNTCNF 2359
            +PKI + +RTH Q++Q    LKRT Y    + +++SR+  C++P+V+   +   +   CK  ++    R C +Y+   K +     + +    +  DIE+L+ +G K   C Y+ +RE+   A I F PYNYLLD  IR    INLK  IV+ DEAHNIE    +SAS  L    +    +E+             D ++    N  R    P L     + +  Q  C  + E E+ S          LG     G+T +   L Q           ++  ++  E+      +SS    T+  +K L  V EF+      F D+                  YRV +Q++ + T+ ++     G     ++ +  N  K  V  LSFWC+        L+   VRSI+LTSGTL P+ +   ++ IKF ++L  +HVIN  Q+ V     G  G  L +++   E  ++ + +G  +L +   + RG+L   PSY M+ K  +RW +  +++ + + K +I EP+   K  F   ++ +Y       +      G++L++V RGK+SEGLD +D   R V+ +G+P+P++ D ++ LKM + D   K       GR WY+ QAYRA+NQ++GR IRH  D+GA+ L D+RF T  +++   L  W++  +   + F  A+++  +F
Sbjct:  270 IPKIFFGTRTHKQITQIARELKRTLYSTVPMTILSSRDHTCVHPEVVPHANRNER---CKEFLEAKNGRSCRYYHNVHKMRDQSTLQWVHGLHQAWDIEELVRLGGKLRSCAYYAARELMQEACIVFCPYNYLLDPLIRESMEINLKEQIVVLDEAHNIEDCARESASFTLNQAQLLLARDEI-------------DGMV--THNIRRDQHRPLLAFCCSLTNWVQESCGGLEEREYESSCKVWTGVEVLGIFRGLGITADTFPLLQKNLAAVLEKEERVGLVNGREETVQVPTISSN---TQSMLKSLFMVLEFLFRQNCRFADD------------------YRVALQQSYMWTTQQDLPDAQGFFARPHRRRQSNRTKTLVHTLSFWCLNPAVAFSDLSST-VRSIVLTSGTLSPMGSFSSELGIKFSIQLEANHVINKSQVWVGTIGAGPQGRKLCATFQHAETFAFQDEVGALLLKVCHTVSRGVLCFLPSYKMLDKLRDRWTNTGLWDKLEECKTVITEPRGGGKGDFDELLQTYYEAIRGTAAKGEKRDGALLVAVCRGKVSEGLDFTDDNARAVVTIGIPFPNIKDLQVELKMKYNDKHAKSRGLLPGGR-WYEIQAYRALNQALGRCIRHRNDWGALILVDDRFRTNPNKYITGLSKWVRQLVRHHDTFTGAMQSLKSF 916          

HSP 2 Score: 68.5514 bits (166), Expect = 4.867e-11
Identity = 29/55 (52.73%), Postives = 40/55 (72.73%), Query Frame = 2
Query:  122 ICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQ 286
            I GV I+FP + Y  Q+  M  +I  L +G++ +LESPTG+GK+L LLC+ALAWQ
Sbjct:   10 IGGVKINFPCKAYPSQLAMMNSIIRGLNNGQHCLLESPTGSGKSLALLCSALAWQ 64          
BLAST of RTEL1 vs. Ensembl Zebrafish
Match: brip1 (BRCA1 interacting protein C-terminal helicase 1 [Source:ZFIN;Acc:ZDB-GENE-081107-11])

HSP 1 Score: 289.656 bits (740), Expect = 7.028e-81
Identity = 202/688 (29.36%), Postives = 334/688 (48.55%), Query Frame = 2
Query:  410 VPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKT---RKCFFYNQFEKAK-----EILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLT---QIIHLKQNLC--ILESEFHSI--------DLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFM---KTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWG----SNKNQAVNGDKNRV--LSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQ--DKTKFTLAMEQFY----SKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRF--QLPLWLQSNIVISNHFGDAIRNTCNF 2359
            +PKI + +RTH Q++Q    LKRT Y    + +++SR+  C++P+V+   +   +   CK  ++    R C +Y+   K +     + +    +  DIE+L+ +G K   C Y+ +RE+   A I F PYNYLLD  IR    INLK  IV+ DEAHNIE    +SAS  L    +    +E+             D ++    N  R    P L     + +  Q  C  + E E+ S          LG     G+T +   L Q           ++  ++  E+      +SS    T+  +K L  V EF+      F D+                  YRV +Q++ + T+ ++     G     ++ +  N  K  V  LSFWC+        L+   VRSI+LTSGTL P+ +   ++ IKF ++L  +HVIN  Q+ V     G  G  L +++   E  ++ + +G  +L +   + RG+L   PSY M+ K  +RW +  +++ + + K +I EP+   K  F   ++ +Y       +      G++L++V RGK+SEGLD +D   R V+ +G+P+P++ D ++ LKM + D   K       GR WY+ QAYRA+NQ++GR IRH  D+GA+ L D+RF T  +++   L  W++  +   + F  A+++  +F
Sbjct:  270 IPKIFFGTRTHKQITQIARELKRTLYSTVPMTILSSRDHTCVHPEVVPHANRNER---CKEFLEAKNGRSCRYYHNVHKMRDQSTLQWVHGLHQAWDIEELVRLGGKLRSCAYYAARELMQEACIVFCPYNYLLDPLIRESMEINLKEQIVVLDEAHNIEDCARESASFTLNQAQLLLARDEI-------------DGMV--THNIRRDQHRPLLAFCCSLTNWVQESCGGLEEREYESSCKVWTGVEVLGIFRGLGITADTFPLLQKNLAAVLEKEERVGLVNGREETVQVPTISSN---TQSMLKSLFMVLEFLFRQNCRFADD------------------YRVALQQSYMWTTQQDLPDAQGFFARPHRRRQSNRTKTLVHTLSFWCLNPAVAFSDLSST-VRSIVLTSGTLSPMGSFSSELGIKFSIQLEANHVINKSQVWVGTIGAGPQGRKLCATFQHAETFAFQDEVGALLLKVCHTVSRGVLCFLPSYKMLDKLRDRWTNTGLWDKLEECKTVITEPRGGGKGDFDELLQTYYEAIRGTAAKGEKRDGALLVAVCRGKVSEGLDFTDDNARAVVTIGIPFPNIKDLQVELKMKYNDKHAKSRGLLPGGR-WYEIQAYRALNQALGRCIRHRNDWGALILVDDRFRTNPNKYITGLSKWVRQLVRHHDTFTGAMQSLKSF 916          

HSP 2 Score: 68.1662 bits (165), Expect = 4.988e-11
Identity = 29/55 (52.73%), Postives = 40/55 (72.73%), Query Frame = 2
Query:  122 ICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQ 286
            I GV I+FP + Y  Q+  M  +I  L +G++ +LESPTG+GK+L LLC+ALAWQ
Sbjct:   10 IGGVKINFPCKAYPSQLAMMNSIIRGLNNGQHCLLESPTGSGKSLALLCSALAWQ 64          
BLAST of RTEL1 vs. Ensembl Zebrafish
Match: brip1 (BRCA1 interacting protein C-terminal helicase 1 [Source:ZFIN;Acc:ZDB-GENE-081107-11])

HSP 1 Score: 289.271 bits (739), Expect = 7.433e-81
Identity = 202/688 (29.36%), Postives = 334/688 (48.55%), Query Frame = 2
Query:  410 VPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKT---RKCFFYNQFEKAK-----EILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLT---QIIHLKQNLC--ILESEFHSI--------DLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFM---KTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWG----SNKNQAVNGDKNRV--LSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQ--DKTKFTLAMEQFY----SKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRF--QLPLWLQSNIVISNHFGDAIRNTCNF 2359
            +PKI + +RTH Q++Q    LKRT Y    + +++SR+  C++P+V+   +   +   CK  ++    R C +Y+   K +     + +    +  DIE+L+ +G K   C Y+ +RE+   A I F PYNYLLD  IR    INLK  IV+ DEAHNIE    +SAS  L    +    +E+             D ++    N  R    P L     + +  Q  C  + E E+ S          LG     G+T +   L Q           ++  ++  E+      +SS    T+  +K L  V EF+      F D+                  YRV +Q++ + T+ ++     G     ++ +  N  K  V  LSFWC+        L+   VRSI+LTSGTL P+ +   ++ IKF ++L  +HVIN  Q+ V     G  G  L +++   E  ++ + +G  +L +   + RG+L   PSY M+ K  +RW +  +++ + + K +I EP+   K  F   ++ +Y       +      G++L++V RGK+SEGLD +D   R V+ +G+P+P++ D ++ LKM + D   K       GR WY+ QAYRA+NQ++GR IRH  D+GA+ L D+RF T  +++   L  W++  +   + F  A+++  +F
Sbjct:  270 IPKIFFGTRTHKQITQIARELKRTLYSTVPMTILSSRDHTCVHPEVVPHANRNER---CKEFLEAKNGRSCRYYHNVHKMRDQSTLQWVHGLHQAWDIEELVRLGGKLRSCAYYAARELMQEACIVFCPYNYLLDPLIRESMEINLKEQIVVLDEAHNIEDCARESASFTLNQAQLLLARDEI-------------DGMV--THNIRRDQHRPLLAFCCSLTNWVQESCGGLEEREYESSCKVWTGVEVLGIFRGLGITADTFPLLQKNLAAVLEKEERVGLVNGREETVQVPTISSN---TQSMLKSLFMVLEFLFRQNCRFADD------------------YRVALQQSYMWTTQQDLPDAQGFFARPHRRRQSNRTKTLVHTLSFWCLNPAVAFSDLSST-VRSIVLTSGTLSPMGSFSSELGIKFSIQLEANHVINKSQVWVGTIGAGPQGRKLCATFQHAETFAFQDEVGALLLKVCHTVSRGVLCFLPSYKMLDKLRDRWTNTGLWDKLEECKTVITEPRGGGKGDFDELLQTYYEAIRGTAAKGEKRDGALLVAVCRGKVSEGLDFTDDNARAVVTIGIPFPNIKDLQVELKMKYNDKHAKSRGLLPGGR-WYEIQAYRALNQALGRCIRHRNDWGALILVDDRFRTNPNKYITGLSKWVRQLVRHHDTFTGAMQSLKSF 916          

HSP 2 Score: 68.5514 bits (166), Expect = 4.833e-11
Identity = 29/55 (52.73%), Postives = 40/55 (72.73%), Query Frame = 2
Query:  122 ICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQ 286
            I GV I+FP + Y  Q+  M  +I  L +G++ +LESPTG+GK+L LLC+ALAWQ
Sbjct:   10 IGGVKINFPCKAYPSQLAMMNSIIRGLNNGQHCLLESPTGSGKSLALLCSALAWQ 64          
BLAST of RTEL1 vs. Ensembl Zebrafish
Match: brip1 (BRCA1 interacting protein C-terminal helicase 1 [Source:ZFIN;Acc:ZDB-GENE-081107-11])

HSP 1 Score: 289.271 bits (739), Expect = 8.586e-81
Identity = 202/688 (29.36%), Postives = 334/688 (48.55%), Query Frame = 2
Query:  410 VPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKT---RKCFFYNQFEKAK-----EILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLT---QIIHLKQNLC--ILESEFHSI--------DLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFM---KTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWG----SNKNQAVNGDKNRV--LSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQ--DKTKFTLAMEQFY----SKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRF--QLPLWLQSNIVISNHFGDAIRNTCNF 2359
            +PKI + +RTH Q++Q    LKRT Y    + +++SR+  C++P+V+   +   +   CK  ++    R C +Y+   K +     + +    +  DIE+L+ +G K   C Y+ +RE+   A I F PYNYLLD  IR    INLK  IV+ DEAHNIE    +SAS  L    +    +E+             D ++    N  R    P L     + +  Q  C  + E E+ S          LG     G+T +   L Q           ++  ++  E+      +SS    T+  +K L  V EF+      F D+                  YRV +Q++ + T+ ++     G     ++ +  N  K  V  LSFWC+        L+   VRSI+LTSGTL P+ +   ++ IKF ++L  +HVIN  Q+ V     G  G  L +++   E  ++ + +G  +L +   + RG+L   PSY M+ K  +RW +  +++ + + K +I EP+   K  F   ++ +Y       +      G++L++V RGK+SEGLD +D   R V+ +G+P+P++ D ++ LKM + D   K       GR WY+ QAYRA+NQ++GR IRH  D+GA+ L D+RF T  +++   L  W++  +   + F  A+++  +F
Sbjct:  270 IPKIFFGTRTHKQITQIARELKRTLYSTVPMTILSSRDHTCVHPEVVPHANRNER---CKEFLEAKNGRSCRYYHNVHKMRDQSTLQWVHGLHQAWDIEELVRLGGKLRSCAYYAARELMQEACIVFCPYNYLLDPLIRESMEINLKEQIVVLDEAHNIEDCARESASFTLNQAQLLLARDEI-------------DGMV--THNIRRDQHRPLLAFCCSLTNWVQESCGGLEEREYESSCKVWTGVEVLGIFRGLGITADTFPLLQKNLAAVLEKEERVGLVNGREETVQVPTISSN---TQSMLKSLFMVLEFLFRQNCRFADD------------------YRVALQQSYMWTTQQDLPDAQGFFARPHRRRQSNRTKTLVHTLSFWCLNPAVAFSDLSST-VRSIVLTSGTLSPMGSFSSELGIKFSIQLEANHVINKSQVWVGTIGAGPQGRKLCATFQHAETFAFQDEVGALLLKVCHTVSRGVLCFLPSYKMLDKLRDRWTNTGLWDKLEECKTVITEPRGGGKGDFDELLQTYYEAIRGTAAKGEKRDGALLVAVCRGKVSEGLDFTDDNARAVVTIGIPFPNIKDLQVELKMKYNDKHAKSRGLLPGGR-WYEIQAYRALNQALGRCIRHRNDWGALILVDDRFRTNPNKYITGLSKWVRQLVRHHDTFTGAMQSLKSF 916          

HSP 2 Score: 68.5514 bits (166), Expect = 4.848e-11
Identity = 29/55 (52.73%), Postives = 40/55 (72.73%), Query Frame = 2
Query:  122 ICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQ 286
            I GV I+FP + Y  Q+  M  +I  L +G++ +LESPTG+GK+L LLC+ALAWQ
Sbjct:   10 IGGVKINFPCKAYPSQLAMMNSIIRGLNNGQHCLLESPTGSGKSLALLCSALAWQ 64          
BLAST of RTEL1 vs. Ensembl Xenopus
Match: phlpp2 (PH domain and leucine rich repeat protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-964802])

HSP 1 Score: 301.212 bits (770), Expect = 5.351e-86
Identity = 205/684 (29.97%), Postives = 338/684 (49.42%), Query Frame = 2
Query:  410 VPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTR---KCFFYNQFEKAKE-----ILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDE----ADNESRSDEIPDLTQIIHLKQNLCILESEFH-SIDLGNNA-------NAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSE---PTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQE-----NEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQ--DKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQ-LPLWLQSNIVISNHFGDAIRNTCNFFRN 2368
            VPKI + +RTH Q++Q    L+RT Y   ++ +++SRE  C++P   ++ SN  +   CK  ++ +    C FY+  +K  E           K  DIE+L+ +GK+   CPYF +RE+   ADI F PYNYLLDS+IR   +I L+G +VI DEAHNIE    +SAS         SC +E     + +Y+    D++++     +D+E        LT  I    +  ++E E+  S  + N         + G+T   N  F LL       +N    ++  EK +   G  +    PTL+        + Q  +K +F        D +     + +  YR+ +Q+     N     + N       N+           L+FWC+        L+    R+I+LTSGTL P+ +   ++ +KF ++L  +HVI+  Q+ V     G  G  L +++   E   + + +G  +L++ + +  G+L   PSY M+ K  +RW    ++ ++ + K +I EPQ  DKT F   ++ +Y          G++L++V RGK+SEGLD SD+  R V+ VG+P+P++ D ++ LK  + D   K     + G  WY+ QAYRA+NQ++GR IRH  D+GA+ L D+RF +       L  W++  +   + F  A+ +   F +N
Sbjct:  240 VPKIFFGTRTHKQIAQITRELRRTAYSSVRMTILSSREHTCVHP---DIHSNRNE--KCKELLEAKDGHSCRFYHGVQKMNEQNLLKYRHGVDKAWDIEELVGLGKRLRACPYFAARELMQEADIVFCPYNYLLDSQIRESMDIFLEGQVVILDEAHNIEDCARESASF--------SCSDE-----QLMYARDEIDSMVNHGIRVSDHEPLRAVCYSLTNWIRECSDQ-LVEREYEASCKVWNGKEILAIFHDMGIT---NATFPLLK------ANLAAVVEKEEKITMLHGQENVIKIPTLSP-------QTQMVLKGLFL-----VLDYLFRQNNRFAEDYRIALQQSYTWANRQDIPDENGFFARPRNRRAVRQKIMVYTLNFWCLNPAVAFSDLSS-NARTIVLTSGTLSPMGSFSSELGVKFSIQLEANHVIHKSQVWVGTVGAGPKGRKLCATFQHTETFDFQDEIGALLLSVCQTVSHGVLCFLPSYKMLEKLKDRWMHTGLWENLERIKTVIKEPQGGDKTDFDKMLQMYYDAIRYKGEKDGALLIAVCRGKVSEGLDFSDNNARAVVTVGIPFPNIKDLQVELKRKYNDQHAKSRGL-LPGSQWYEIQAYRALNQALGRCIRHKNDWGALILVDDRFRSNPKYITGLSKWVRQLVQHHSTFNGALESLNEFSKN 881          

HSP 2 Score: 62.003 bits (149), Expect = 5.514e-9
Identity = 29/64 (45.31%), Postives = 40/64 (62.50%), Query Frame = 2
Query:   95 LSLAMPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQ 286
            +S A+    I GV I FP   Y  Q+  M  ++  L   ++ +LESPTG+GK+L LLC+ALAWQ
Sbjct:    1 MSSALSEYTIGGVKILFPCRAYPSQLAMMNSIMRGLNCKQHCLLESPTGSGKSLALLCSALAWQ 64          
BLAST of RTEL1 vs. Ensembl Xenopus
Match: phlpp2 (PH domain and leucine rich repeat protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-964802])

HSP 1 Score: 298.13 bits (762), Expect = 3.267e-85
Identity = 205/686 (29.88%), Postives = 339/686 (49.42%), Query Frame = 2
Query:  410 VPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTR---KCFFYNQFEKAKE-----ILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDE----ADNESRSDEIPDLTQIIHLKQNLCILESEFH-SIDLGNNA-------NAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSE---PTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQE-----NEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQ--DKTKFTLAMEQFYS--KNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQ-LPLWLQSNIVISNHFGDAIRNTCNFFRN 2368
            VPKI + +RTH Q++Q    L+RT Y   ++ +++SRE  C++P   ++ SN  +   CK  ++ +    C FY+  +K  E           K  DIE+L+ +GK+   CPYF +RE+   ADI F PYNYLLDS+IR   +I L+G +VI DEAHNIE    +SAS         SC +E     + +Y+    D++++     +D+E        LT  I    +  ++E E+  S  + N         + G+T   N  F LL       +N    ++  EK +   G  +    PTL+        + Q  +K +F        D +     + +  YR+ +Q+     N     + N       N+           L+FWC+        L+    R+I+LTSGTL P+ +   ++ +KF ++L  +HVI+  Q+ V     G  G  L +++   E   + + +G  +L++ + +  G+L   PSY M+ K  +RW    ++ ++ + K +I EPQ  DKT F   ++ +Y   +        G++L++V RGK+SEGLD SD+  R V+ VG+P+P++ D ++ LK  + D   K     + G  WY+ QAYRA+NQ++GR IRH  D+GA+ L D+RF +       L  W++  +   + F  A+ +   F +N
Sbjct:  188 VPKIFFGTRTHKQIAQITRELRRTAYSSVRMTILSSREHTCVHP---DIHSNRNE--KCKELLEAKDGHSCRFYHGVQKMNEQNLLKYRHGVDKAWDIEELVGLGKRLRACPYFAARELMQEADIVFCPYNYLLDSQIRESMDIFLEGQVVILDEAHNIEDCARESASF--------SCSDE-----QLMYARDEIDSMVNHGIRVSDHEPLRAVCYSLTNWIRECSDQ-LVEREYEASCKVWNGKEILAIFHDMGIT---NATFPLLK------ANLAAVVEKEEKITMLHGQENVIKIPTLSP-------QTQMVLKGLFL-----VLDYLFRQNNRFAEDYRIALQQSYTWANRQDIPDENGFFARPRNRRAVRQKIMVYTLNFWCLNPAVAFSDLSS-NARTIVLTSGTLSPMGSFSSELGVKFSIQLEANHVIHKSQVWVGTVGAGPKGRKLCATFQHTETFDFQDEIGALLLSVCQTVSHGVLCFLPSYKMLEKLKDRWMHTGLWENLERIKTVIKEPQGGDKTDFDKMLQMYYDAIRYKGEKGKYGALLIAVCRGKVSEGLDFSDNNARAVVTVGIPFPNIKDLQVELKRKYNDQHAKSRGL-LPGSQWYEIQAYRALNQALGRCIRHKNDWGALILVDDRFRSNPKYITGLSKWVRQLVQHHSTFNGALESLNEFSKN 831          

HSP 2 Score: 63.5438 bits (153), Expect = 1.748e-9
Identity = 30/73 (41.10%), Postives = 44/73 (60.27%), Query Frame = 2
Query:   95 LSLAMPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVKKVTTN 313
            +S A+    I GV I FP   Y  Q+  M  ++  L   ++ +LESPTG+GK+L LLC+ALAWQ  +   ++N
Sbjct:    1 MSSALSEYTIGGVKILFPCRAYPSQLAMMNSIMRGLNCKQHCLLESPTGSGKSLALLCSALAWQQSLYGASSN 73          
BLAST of RTEL1 vs. Ensembl Xenopus
Match: phlpp2 (PH domain and leucine rich repeat protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-964802])

HSP 1 Score: 300.442 bits (768), Expect = 1.986e-84
Identity = 205/689 (29.75%), Postives = 343/689 (49.78%), Query Frame = 2
Query:  410 VPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTR---KCFFYNQFEKAKE-----ILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDE----ADNESRSDEIPDLTQIIHLKQNLCILESEFH-SIDLGNNA-------NAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSE---PTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNR----------VLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQ--DKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQ-LPLWLQSNIVISNHFGDAIRNTCNFFRN 2368
            VPKI + +RTH Q++Q    L+RT Y   ++ +++SRE  C++P +     ++ +   CK  ++ +    C FY+  +K  E           K  DIE+L+ +GK+   CPYF +RE+   ADI F PYNYLLDS+IR   +I L+G +VI DEAHNIE    +SAS         SC +E     + +Y+    D++++     +D+E        LT  I    +  ++E E+  S  + N         + G+T   N  F LL       +N    ++  EK +   G  +    PTL+        + Q  +K +F        D +     + +  YR+ +Q++    +NR +      ++N      +NR           L+FWC+        L+    R+I+LTSGTL P+ +   ++ +KF ++L  +HVI+  Q+ V     G  G  L +++   E   + + +G  +L++ + +  G+L   PSY M+ K  +RW    ++ ++ + K +I EPQ  DKT F   ++ +Y          G++L++V RGK+SEGLD SD+  R V+ VG+P+P++ D ++ LK  + D   K     + G  WY+ QAYRA+NQ++GR IRH  D+GA+ L D+RF +       L  W++  +   + F  A+ +   F +N
Sbjct:  250 VPKIFFGTRTHKQIAQITRELRRTAYSSVRMTILSSREHTCVHPDI-----HSNRNEKCKELLEAKDGHSCRFYHGVQKMNEQNLLKYRHGVDKAWDIEELVGLGKRLRACPYFAARELMQEADIVFCPYNYLLDSQIRESMDIFLEGQVVILDEAHNIEDCARESASF--------SCSDE-----QLMYARDEIDSMVNHGIRVSDHEPLRAVCYSLTNWIRECSDQ-LVEREYEASCKVWNGKEILAIFHDMGIT---NATFPLLK------ANLAAVVEKEEKITMLHGQENVIKIPTLSP-------QTQMVLKGLFL-----VLDYLFRQNNRFAEDYRIALQQS-YTWANRQDI----PDENGFFARPRNRRAVRQKIMVYTLNFWCLNPAVAFSDLSS-NARTIVLTSGTLSPMGSFSSELGVKFSIQLEANHVIHKSQVWVGTVGAGPKGRKLCATFQHTETFDFQDEIGALLLSVCQTVSHGVLCFLPSYKMLEKLKDRWMHTGLWENLERIKTVIKEPQGGDKTDFDKMLQMYYDAIRYKGEKDGALLIAVCRGKVSEGLDFSDNNARAVVTVGIPFPNIKDLQVELKRKYNDQHAKSRGL-LPGSQWYEIQAYRALNQALGRCIRHKNDWGALILVDDRFRSNPKYITGLSKWVRQLVQHHSTFNGALESLNEFSKN 891          

HSP 2 Score: 63.1586 bits (152), Expect = 2.629e-9
Identity = 29/64 (45.31%), Postives = 40/64 (62.50%), Query Frame = 2
Query:   95 LSLAMPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQ 286
            +S A+    I GV I FP   Y  Q+  M  ++  L   ++ +LESPTG+GK+L LLC+ALAWQ
Sbjct:    1 MSSALSEYTIGGVKILFPCRAYPSQLAMMNSIMRGLNCKQHCLLESPTGSGKSLALLCSALAWQ 64          
BLAST of RTEL1 vs. Ensembl Xenopus
Match: ephx3 (epoxide hydrolase 3 [Source:Xenbase;Acc:XB-GENE-5900414])

HSP 1 Score: 245.743 bits (626), Expect = 3.345e-68
Identity = 200/765 (26.14%), Postives = 354/765 (46.27%), Query Frame = 2
Query:  116 INICGVSIDFPFEP-YACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKR-TQYCDRKVG--------MIASREQLCINPKVMNLESNTAKIYGCKSR----VKTRK--------CFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINL-KGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVL------SFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISN 2323
            +NI G+ + FP+E  Y  Q  YM ++  +L    + +LE P+GTGKT+ LL   +A+Q                             +   L ++K+      IY SRT  ++ + +  L++  +Y   + G         ++SR  LC+NP+V  L         C S     V+++K        C F+ +F+           I +++DL T+G++K  CPY+L+R      ++    Y+YLLD KI  L +  L K ++V+FDEAHNI+ VC DS SV +T   +  C   ++ L   I  I+       E D +   +E   L +   L++     E++ +       +N  L  E  IL + +  C     N LHF+  L +   +I      +  + G    E    F++ ++ +++  E   +    ++L +  R      EIA     + +   +N    V+     +        F+C+ +   +K +     +S+I+TSGTL P++     +D +       +  +    +   V  +G D   ++S + TRE ++   + GN +L +S ++P G++  F SY  M   +  W    I  ++ ++K + +E QD  + ++A+E++     +    +G+ILLSVARGK+SEG+D   H GR VI+ G+PY       ++ ++ FL D     +F +    +    A R   Q +GR IR   D+G +   D+R+A +D R +LPLW+Q ++  +N
Sbjct:    3 LNIDGLLVYFPYEYIYPEQYSYMLELKRTLDAKGHGVLEMPSGTGKTVSLLSLIVAYQ-----------------------------RAYPLEVTKL------IYCSRTVPEIEKVVEELRKLIEYTQAQTGGTLNFMALALSSRRNLCVNPEVSALRFGKEIDGRCHSLTASFVRSQKQRDPTVQTCRFFEEFDAIGRETPLPPGIYNLDDLRTLGRQKGWCPYYLARHALGQCNVVVYSYHYLLDPKIADLVSRELSKKSVVVFDEAHNIDNVCIDSMSVTITRRTLERCQTNIETLNTAIEKIK-------ETDEKKLKEEYAQLVE--GLREASVARETDVYL------SNPVLPDE--ILQEAVPGC---IRNALHFLGFLRRLVGYI-----KSRLRAGHVTQEGPAAFLRDLY-EKVCIERKPMRFCAERLRSLTRTL----EIADITDLSPLTLITNFATLVSTYTKGIFLTVGFCVFFCLDSSLAIKPVFQ-RFQSVIITSGTLSPLDIYPKILDFRPVTMATFTMTLARVCLCPMVVGRGNDQVAMSSKFETREDLAVMRNYGNLLLEMSAVVPDGIVGFFTSYLYMENIVASWYEQGILENIQRNKLIFIETQDGAETSVALEKYQEACEN---GRGAILLSVARGKVSEGIDFVHHYGRAVIMFGVPYVYTQSRILKARLQFLRD-----QFHLRENDFLTFDAMRHAAQCVGRAIRGKTDYGIMLFADKRYARSDKRGKLPLWIQEHLTDAN 693          
BLAST of RTEL1 vs. Ensembl Xenopus
Match: ephx3 (epoxide hydrolase 3 [Source:Xenbase;Acc:XB-GENE-5900414])

HSP 1 Score: 245.743 bits (626), Expect = 3.976e-68
Identity = 202/773 (26.13%), Postives = 355/773 (45.92%), Query Frame = 2
Query:  116 INICGVSIDFPFEP-YACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKR-TQYCDRKVG--------MIASREQLCINPKVMNLESNTAKIYGCKSR----VKTRK--------CFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINL-KGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNG---------DK-----NRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISN 2323
            +NI G+ + FP+E  Y  Q  YM ++  +L    + +LE P+GTGKT+ LL   +A+Q                             +   L ++K+      IY SRT  ++ + +  L++  +Y   + G         ++SR  LC+NP+V  L         C S     V+++K        C F+ +F+           I +++DL T+G++K  CPY+L+R      ++    Y+YLLD KI  L +  L K ++V+FDEAHNI+ VC DS SV +T   +  C   ++ L   I  I+       E D +   +E   L +   L++     E++ +       +N  L  E  IL + +  C     N LHF+  L +   +I      +  + G    E    F++ ++ +++  E   +    ++L +  R     +    S      N+ +  +    G         D+     N VL F C+ +   +K +     +S+I+TSGTL P++     +D +       +  +    +   V  +G D   ++S + TRE ++   + GN +L +S ++P G++  F SY  M   +  W    I  ++ ++K + +E QD  + ++A+E++     +    +G+ILLSVARGK+SEG+D   H GR VI+ G+PY       ++ ++ FL D     +F +    +    A R   Q +GR IR   D+G +   D+R+A +D R +LPLW+Q ++  +N
Sbjct:    3 LNIDGLLVYFPYEYIYPEQYSYMLELKRTLDAKGHGVLEMPSGTGKTVSLLSLIVAYQ-----------------------------RAYPLEVTKL------IYCSRTVPEIEKVVEELRKLIEYTQAQTGGTLNFMALALSSRRNLCVNPEVSALRFGKEIDGRCHSLTASFVRSQKQRDPTVQTCRFFEEFDAIGRETPLPPGIYNLDDLRTLGRQKGWCPYYLARHALGQCNVVVYSYHYLLDPKIADLVSRELSKKSVVVFDEAHNIDNVCIDSMSVTITRRTLERCQTNIETLNTAIEKIK-------ETDEKKLKEEYAQLVE--GLREASVARETDVYL------SNPVLPDE--ILQEAVPGC---IRNALHFLGFLRRLVGYI-----KSRLRAGHVTQEGPAAFLRDLY-EKVCIERKPMRFCAERLRSLTRTLEIADITDLSPLTLITNFATLVSTYTKGFMIIIEPFEDRTPSISNPVLHFSCLDSSLAIKPVFQ-RFQSVIITSGTLSPLDIYPKILDFRPVTMATFTMTLARVCLCPMVVGRGNDQVAMSSKFETREDLAVMRNYGNLLLEMSAVVPDGIVGFFTSYLYMENIVASWYEQGILENIQRNKLIFIETQDGAETSVALEKYQEACEN---GRGAILLSVARGKVSEGIDFVHHYGRAVIMFGVPYVYTQSRILKARLQFLRD-----QFHLRENDFLTFDAMRHAAQCVGRAIRGKTDYGIMLFADKRYARSDKRGKLPLWIQEHLTDAN 705          
BLAST of RTEL1 vs. Ensembl Mouse
Match: Rtel1 (regulator of telomere elongation helicase 1 [Source:MGI Symbol;Acc:MGI:2139369])

HSP 1 Score: 556.214 bits (1432), Expect = 1.993e-179
Identity = 314/775 (40.52%), Postives = 445/775 (57.42%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVK------KVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEEL-KVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVF-FDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRC-----WYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNITIKYPPP 2392
            MP + + GV++DFPF+PY CQ  YM KV+E L+   N ILESPTGTGKTLCLLC+ LAWQ H++      K+    + E+      +             +I     +PKIIY+SRTHSQL+Q I  L+ T Y   KV ++ SREQLCI+P+V   ESN  +I  C+ +V +R C FYN  E         T I DIEDL+  G K+ +CPY+LSR M   ADI FMPYNYLLD+K R+ ++I+LKG +VIFDEAHN+E++CE+SAS  LT  ++AS +E + +VL E     Q  +   +   + S S    +L  I  LK  L  LE    ++ L  + + G+T   + +F+L          K     +LE     I   +  T       GL+K+ + ++ VF  D       S+  L   +S  Y+V I               W +  ++     + +VLS+WC +  ++M+ L    VR++ILTSGTL P+ +  L+M I F V L N H+I+ +Q+ V +  +G DG  L+S+Y  R      +SLG ++ N+++++P GLLV FPSY +M K +E W+   +   +   K L VEP++K  F+  ++ +Y + + P SN G+  L+V RGK SEGLD SD  GRGVIV GLPYP  MDPR+ LKM FLD+     + G+ G+C     WY+QQA RAVNQ+IGRVIRH  D+GAI+L D RFA AD+R QLP W++  + + ++FG  IR+   FFR      P P
Sbjct:    1 MPRVVLNGVTVDFPFQPYPCQQEYMTKVLECLQKKVNGILESPTGTGKTLCLLCSTLAWQQHLRDAVSSLKIAERVQGELFASRTLSSWGSAAAASGD--SIECYTDIPKIIYASRTHSQLTQVIRELRNTAY-RPKVCVLGSREQLCIHPEVKKQESNHMQISLCRKKVASRSCHFYNNVEAKFLEQDLATPILDIEDLVKNGSKQKMCPYYLSRNMKQQADIIFMPYNYLLDAKSRKAHSIDLKGTVVIFDEAHNVEKICEESASFDLTPRDVASGLEIINQVLEEQARVTQQGELQQEFIVDTSSSGLNMELEDIAKLKMILLRLEEAIDAVQLPGD-DRGVTKPGSYIFELFAEAQITFQTK---GCILESLDQIIQHLAGRTGVFTNTAGLQKLMDIIQIVFSVDPPEGSPGSLVGL--GISHSYKVHIHPETSHRRAAKRSDAWSTTASR----KQGKVLSYWCFSPSQSMRELVCQGVRTLILTSGTLAPLSSFALEMQIPFPVCLENPHIIDKNQLWVGIVPRGPDGVQLSSAYDKRFSEECLSSLGKALSNIARVVPHGLLVFFPSYPVMEKSLEFWQVQGLARKVEALKPLFVEPRNKGSFSEVIDAYYQQVASPASN-GATFLAVCRGKASEGLDFSDMNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMRG--RSGVGGQCLSGQEWYQQQASRAVNQAIGRVIRHRHDYGAIFLCDHRFAYADARAQLPSWVRPYLKVYDNFGHVIRDVAQFFRVAQKTMPLP 759          
BLAST of RTEL1 vs. Ensembl Mouse
Match: Rtel1 (regulator of telomere elongation helicase 1 [Source:MGI Symbol;Acc:MGI:2139369])

HSP 1 Score: 556.214 bits (1432), Expect = 4.445e-179
Identity = 314/775 (40.52%), Postives = 445/775 (57.42%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVK------KVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEEL-KVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVF-FDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRC-----WYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNITIKYPPP 2392
            MP + + GV++DFPF+PY CQ  YM KV+E L+   N ILESPTGTGKTLCLLC+ LAWQ H++      K+    + E+      +             +I     +PKIIY+SRTHSQL+Q I  L+ T Y   KV ++ SREQLCI+P+V   ESN  +I  C+ +V +R C FYN  E         T I DIEDL+  G K+ +CPY+LSR M   ADI FMPYNYLLD+K R+ ++I+LKG +VIFDEAHN+E++CE+SAS  LT  ++AS +E + +VL E     Q  +   +   + S S    +L  I  LK  L  LE    ++ L  + + G+T   + +F+L          K     +LE     I   +  T       GL+K+ + ++ VF  D       S+  L   +S  Y+V I               W +  ++     + +VLS+WC +  ++M+ L    VR++ILTSGTL P+ +  L+M I F V L N H+I+ +Q+ V +  +G DG  L+S+Y  R      +SLG ++ N+++++P GLLV FPSY +M K +E W+   +   +   K L VEP++K  F+  ++ +Y + + P SN G+  L+V RGK SEGLD SD  GRGVIV GLPYP  MDPR+ LKM FLD+     + G+ G+C     WY+QQA RAVNQ+IGRVIRH  D+GAI+L D RFA AD+R QLP W++  + + ++FG  IR+   FFR      P P
Sbjct:    1 MPRVVLNGVTVDFPFQPYPCQQEYMTKVLECLQKKVNGILESPTGTGKTLCLLCSTLAWQQHLRDAVSSLKIAERVQGELFASRTLSSWGSAAAASGD--SIECYTDIPKIIYASRTHSQLTQVIRELRNTAY-RPKVCVLGSREQLCIHPEVKKQESNHMQISLCRKKVASRSCHFYNNVEAKFLEQDLATPILDIEDLVKNGSKQKMCPYYLSRNMKQQADIIFMPYNYLLDAKSRKAHSIDLKGTVVIFDEAHNVEKICEESASFDLTPRDVASGLEIINQVLEEQARVTQQGELQQEFIVDTSSSGLNMELEDIAKLKMILLRLEEAIDAVQLPGD-DRGVTKPGSYIFELFAEAQITFQTKGC---ILESLDQIIQHLAGRTGVFTNTAGLQKLMDIIQIVFSVDPPEGSPGSLVGL--GISHSYKVHIHPETSHRRAAKRSDAWSTTASR----KQGKVLSYWCFSPSQSMRELVCQGVRTLILTSGTLAPLSSFALEMQIPFPVCLENPHIIDKNQLWVGIVPRGPDGVQLSSAYDKRFSEECLSSLGKALSNIARVVPHGLLVFFPSYPVMEKSLEFWQVQGLARKVEALKPLFVEPRNKGSFSEVIDAYYQQVASPASN-GATFLAVCRGKASEGLDFSDMNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMRG--RSGVGGQCLSGQEWYQQQASRAVNQAIGRVIRHRHDYGAIFLCDHRFAYADARAQLPSWVRPYLKVYDNFGHVIRDVAQFFRVAQKTMPLP 759          
BLAST of RTEL1 vs. Ensembl Mouse
Match: Rtel1 (regulator of telomere elongation helicase 1 [Source:MGI Symbol;Acc:MGI:2139369])

HSP 1 Score: 555.829 bits (1431), Expect = 8.767e-179
Identity = 314/775 (40.52%), Postives = 445/775 (57.42%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVK------KVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEEL-KVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVF-FDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRC-----WYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNITIKYPPP 2392
            MP + + GV++DFPF+PY CQ  YM KV+E L+   N ILESPTGTGKTLCLLC+ LAWQ H++      K+    + E+      +             +I     +PKIIY+SRTHSQL+Q I  L+ T Y   KV ++ SREQLCI+P+V   ESN  +I  C+ +V +R C FYN  E         T I DIEDL+  G K+ +CPY+LSR M   ADI FMPYNYLLD+K R+ ++I+LKG +VIFDEAHN+E++CE+SAS  LT  ++AS +E + +VL E     Q  +   +   + S S    +L  I  LK  L  LE    ++ L  + + G+T   + +F+L          K     +LE     I   +  T       GL+K+ + ++ VF  D       S+  L   +S  Y+V I               W +  ++     + +VLS+WC +  ++M+ L    VR++ILTSGTL P+ +  L+M I F V L N H+I+ +Q+ V +  +G DG  L+S+Y  R      +SLG ++ N+++++P GLLV FPSY +M K +E W+   +   +   K L VEP++K  F+  ++ +Y + + P SN G+  L+V RGK SEGLD SD  GRGVIV GLPYP  MDPR+ LKM FLD+     + G+ G+C     WY+QQA RAVNQ+IGRVIRH  D+GAI+L D RFA AD+R QLP W++  + + ++FG  IR+   FFR      P P
Sbjct:    1 MPRVVLNGVTVDFPFQPYPCQQEYMTKVLECLQKKVNGILESPTGTGKTLCLLCSTLAWQQHLRDAVSSLKIAERVQGELFASRTLSSWGSAAAASGD--SIECYTDIPKIIYASRTHSQLTQVIRELRNTAY-RPKVCVLGSREQLCIHPEVKKQESNHMQISLCRKKVASRSCHFYNNVEAKFLEQDLATPILDIEDLVKNGSKQKMCPYYLSRNMKQQADIIFMPYNYLLDAKSRKAHSIDLKGTVVIFDEAHNVEKICEESASFDLTPRDVASGLEIINQVLEEQARVTQQGELQQEFIVDTSSSGLNMELEDIAKLKMILLRLEEAIDAVQLPGD-DRGVTKPGSYIFELFAEAQITFQTK---GCILESLDQIIQHLAGRTGVFTNTAGLQKLMDIIQIVFSVDPPEGSPGSLVGL--GISHSYKVHIHPETSHRRAAKRSDAWSTTASR----KQGKVLSYWCFSPSQSMRELVCQGVRTLILTSGTLAPLSSFALEMQIPFPVCLENPHIIDKNQLWVGIVPRGPDGVQLSSAYDKRFSEECLSSLGKALSNIARVVPHGLLVFFPSYPVMEKSLEFWQVQGLARKVEALKPLFVEPRNKGSFSEVIDAYYQQVASPASN-GATFLAVCRGKASEGLDFSDMNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMRG--RSGVGGQCLSGQEWYQQQASRAVNQAIGRVIRHRHDYGAIFLCDHRFAYADARAQLPSWVRPYLKVYDNFGHVIRDVAQFFRVAQKTMPLP 759          
BLAST of RTEL1 vs. Ensembl Mouse
Match: Rtel1 (regulator of telomere elongation helicase 1 [Source:MGI Symbol;Acc:MGI:2139369])

HSP 1 Score: 556.599 bits (1433), Expect = 9.930e-179
Identity = 314/775 (40.52%), Postives = 445/775 (57.42%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVK------KVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEEL-KVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVF-FDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRC-----WYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNITIKYPPP 2392
            MP + + GV++DFPF+PY CQ  YM KV+E L+   N ILESPTGTGKTLCLLC+ LAWQ H++      K+    + E+      +             +I     +PKIIY+SRTHSQL+Q I  L+ T Y   KV ++ SREQLCI+P+V   ESN  +I  C+ +V +R C FYN  E         T I DIEDL+  G K+ +CPY+LSR M   ADI FMPYNYLLD+K R+ ++I+LKG +VIFDEAHN+E++CE+SAS  LT  ++AS +E + +VL E     Q  +   +   + S S    +L  I  LK  L  LE    ++ L  + + G+T   + +F+L          K     +LE     I   +  T       GL+K+ + ++ VF  D       S+  L   +S  Y+V I               W +  ++     + +VLS+WC +  ++M+ L    VR++ILTSGTL P+ +  L+M I F V L N H+I+ +Q+ V +  +G DG  L+S+Y  R      +SLG ++ N+++++P GLLV FPSY +M K +E W+   +   +   K L VEP++K  F+  ++ +Y + + P SN G+  L+V RGK SEGLD SD  GRGVIV GLPYP  MDPR+ LKM FLD+     + G+ G+C     WY+QQA RAVNQ+IGRVIRH  D+GAI+L D RFA AD+R QLP W++  + + ++FG  IR+   FFR      P P
Sbjct:    1 MPRVVLNGVTVDFPFQPYPCQQEYMTKVLECLQKKVNGILESPTGTGKTLCLLCSTLAWQQHLRDAVSSLKIAERVQGELFASRTLSSWGSAAAASGD--SIECYTDIPKIIYASRTHSQLTQVIRELRNTAY-RPKVCVLGSREQLCIHPEVKKQESNHMQISLCRKKVASRSCHFYNNVEAKFLEQDLATPILDIEDLVKNGSKQKMCPYYLSRNMKQQADIIFMPYNYLLDAKSRKAHSIDLKGTVVIFDEAHNVEKICEESASFDLTPRDVASGLEIINQVLEEQARVTQQGELQQEFIVDTSSSGLNMELEDIAKLKMILLRLEEAIDAVQLPGD-DRGVTKPGSYIFELFAEAQITFQTK---GCILESLDQIIQHLAGRTGVFTNTAGLQKLMDIIQIVFSVDPPEGSPGSLVGL--GISHSYKVHIHPETSHRRAAKRSDAWSTTASR----KQGKVLSYWCFSPSQSMRELVCQGVRTLILTSGTLAPLSSFALEMQIPFPVCLENPHIIDKNQLWVGIVPRGPDGVQLSSAYDKRFSEECLSSLGKALSNIARVVPHGLLVFFPSYPVMEKSLEFWQVQGLARKVEALKPLFVEPRNKGSFSEVIDAYYQQVASPASN-GATFLAVCRGKASEGLDFSDMNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMRG--RSGVGGQCLSGQEWYQQQASRAVNQAIGRVIRHRHDYGAIFLCDHRFAYADARAQLPSWVRPYLKVYDNFGHVIRDVAQFFRVAQKTMPLP 759          
BLAST of RTEL1 vs. Ensembl Mouse
Match: Rtel1 (regulator of telomere elongation helicase 1 [Source:MGI Symbol;Acc:MGI:2139369])

HSP 1 Score: 556.214 bits (1432), Expect = 1.252e-178
Identity = 314/775 (40.52%), Postives = 445/775 (57.42%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVK------KVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEEL-KVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVF-FDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRC-----WYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNITIKYPPP 2392
            MP + + GV++DFPF+PY CQ  YM KV+E L+   N ILESPTGTGKTLCLLC+ LAWQ H++      K+    + E+      +             +I     +PKIIY+SRTHSQL+Q I  L+ T Y   KV ++ SREQLCI+P+V   ESN  +I  C+ +V +R C FYN  E         T I DIEDL+  G K+ +CPY+LSR M   ADI FMPYNYLLD+K R+ ++I+LKG +VIFDEAHN+E++CE+SAS  LT  ++AS +E + +VL E     Q  +   +   + S S    +L  I  LK  L  LE    ++ L  + + G+T   + +F+L          K     +LE     I   +  T       GL+K+ + ++ VF  D       S+  L   +S  Y+V I               W +  ++     + +VLS+WC +  ++M+ L    VR++ILTSGTL P+ +  L+M I F V L N H+I+ +Q+ V +  +G DG  L+S+Y  R      +SLG ++ N+++++P GLLV FPSY +M K +E W+   +   +   K L VEP++K  F+  ++ +Y + + P SN G+  L+V RGK SEGLD SD  GRGVIV GLPYP  MDPR+ LKM FLD+     + G+ G+C     WY+QQA RAVNQ+IGRVIRH  D+GAI+L D RFA AD+R QLP W++  + + ++FG  IR+   FFR      P P
Sbjct:    1 MPRVVLNGVTVDFPFQPYPCQQEYMTKVLECLQKKVNGILESPTGTGKTLCLLCSTLAWQQHLRDAVSSLKIAERVQGELFASRTLSSWGSAAAASGD--SIECYTDIPKIIYASRTHSQLTQVIRELRNTAY-RPKVCVLGSREQLCIHPEVKKQESNHMQISLCRKKVASRSCHFYNNVEAKFLEQDLATPILDIEDLVKNGSKQKMCPYYLSRNMKQQADIIFMPYNYLLDAKSRKAHSIDLKGTVVIFDEAHNVEKICEESASFDLTPRDVASGLEIINQVLEEQARVTQQGELQQEFIVDTSSSGLNMELEDIAKLKMILLRLEEAIDAVQLPGD-DRGVTKPGSYIFELFAEAQITFQTK---GCILESLDQIIQHLAGRTGVFTNTAGLQKLMDIIQIVFSVDPPEGSPGSLVGL--GISHSYKVHIHPETSHRRAAKRSDAWSTTASR----KQGKVLSYWCFSPSQSMRELVCQGVRTLILTSGTLAPLSSFALEMQIPFPVCLENPHIIDKNQLWVGIVPRGPDGVQLSSAYDKRFSEECLSSLGKALSNIARVVPHGLLVFFPSYPVMEKSLEFWQVQGLARKVEALKPLFVEPRNKGSFSEVIDAYYQQVASPASN-GATFLAVCRGKASEGLDFSDMNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMRG--RSGVGGQCLSGQEWYQQQASRAVNQAIGRVIRHRHDYGAIFLCDHRFAYADARAQLPSWVRPYLKVYDNFGHVIRDVAQFFRVAQKTMPLP 759          
BLAST of RTEL1 vs. UniProt/SwissProt
Match: sp|P0C928|RTEL1_DANRE (Regulator of telomere elongation helicase 1 OS=Danio rerio OX=7955 GN=rtel1 PE=3 SV=1)

HSP 1 Score: 587.415 bits (1513), Expect = 0.000e+0
Identity = 370/1024 (36.13%), Postives = 551/1024 (53.81%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVK------KVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKA---KEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEEL-KVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGE---EFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDD----RLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNITIKYP-PPGLGCCESISN-VPIEIQNQESS--TK---PSRI--KSRTNISAQYSSKVVSFATSLKDGSQDFAKILESYANTPPIKKPESSLTSTSLMDILKRAE-----------NHVTEIEILPVKRTFNETVCEVDDPEKNTRKVKKYKLVALKGQEKVKESNEYSFIIKRLFNEDVQGFISYKTVIEDFKKNTNVDTLFAGL-NSLLCEKDQPGLVRDFYKFIQPEFQARFAELCESVLGLDCMEGKEN 3064
            MP+I + G+++DFPF PY CQ  YM KVIE L+   N +LESPTGTGKTLCLLC+ LAW+DH K      K+T       L       +  W          +    +PKIIY+SRTHSQL+Q +N LK T Y   K+ ++ SREQLCIN +VM  ESN  K++ C+++V +R C FYN  ++    KEI++S   I D+EDL+  GKK+ VCPY+LSR +   AD+ FMPYNYLLD K RR +NI LKG +VIFDEAHN+E++CE+S S  LT  ++ S IE + ++L E    I   D+  D       S    D+T I  +KQ L  LE+  +  ++  N N G+T   + +F+L      N   K   ++ +E+ + ++       L      GL+KV + ++ VF  E  E   +  + ++L++     ++V I  +      +     W S+  +     +  VLS+WC + G +M+ L   EVR IILTSGTL P+ +   +M I F V L N HVI  DQ+ VS+  KG DG  L++++  R      +S+GN+++NLS+++P GLLV FPSY +M K +E W +    + +   K + VEP+ K  FT  ++ +Y K  DP S+ GS   +V RGK SEGLD +D  GRGV++ GLP+P  MDPR+ LKM +LD+    ++   K+ + G+ WY+QQA RAVNQ+IGRVIRH  D+GAI+L D RF +AD+R QLP W++  + I + FG  +R+   FFR      P P   G  E   N     + N  SS  TK   PS I  K++T  +   S K     +    G +  A++   Y      K+   SL   +L D   + E           +H++ + +   KR  +E+           RK+K  +          K    +   ++R  +   + F      ++ +K   N++ L A +   L+ + +   L+R  Y+FI+P  +  + E C  + G  C   +E+
Sbjct:    1 MPVIKLKGINVDFPFTPYPCQEDYMSKVIECLQKKVNGVLESPTGTGKTLCLLCSTLAWRDHFKDTISARKITERMGGAELFADRPMSS--WGTAATDGDTPTYYTDIPKIIYASRTHSQLTQVVNELKNTSY-RPKICVLGSREQLCINQEVMRHESNHIKVHMCRAKVSSRSCIFYNNVDEKSTDKEIVNS---ILDVEDLVKTGKKQRVCPYYLSRSLKQHADVIFMPYNYLLDPKSRRAHNIELKGAVVIFDEAHNVEKMCEESTSFDLTPHDLISAIEAVDRLLREQASDISKADSAEDFNVESLNSGLKMDITTIAKVKQILMDLETAINDFEMPAN-NQGITKPGSFIFELFEMANVNSKTKTETVEAMEQITGYLAGRPGVFLN---TSGLQKVADIIQLVFVAEPAEGSKKSQTGNSLKE-----FKVHIHPDNSNFKKKQITDVWASSSTKK----QGNVLSYWCFSPGFSMQELLRQEVRCIILTSGTLSPLSSFTCEMQIPFPVSLENPHVIQRDQIFVSIIEKGPDGVQLSTAFDRRFVPENMSSMGNTLVNLSRVVPHGLLVFFPSYPVMDKTLEFWRAKGHADRIENVKPMFVEPRGKGTFTEVIDGYYGKVDDPNSSGGS-FFAVCRGKASEGLDFADTYGRGVVITGLPFPPRMDPRVVLKMQYLDEMCRNKISGVKY-LTGQEWYRQQASRAVNQAIGRVIRHREDYGAIFLCDHRFKSADARNQLPSWVRPYVKIYDGFGTMVRDVAQFFRTAQKTRPVPVKKGKAEGHENQADTRLLNTGSSCLTKSVWPSDIYQKAKTLDAHVPSLKRRKLDSEEHSGREGAARLCIQYEMEMTSKRKPVSLLD-ALDDTTDKEEREDTMVGEERASHLSTLSLQHDKRLDDES-------RGGKRKIKVVQERETVTSHTAKTGKAFMMELRRCLSH--ENFKLIMEALQSYKTADNLNNLLATVAEPLIQDHNTHSLLRGLYQFIRPHHKKEYDERCLELTGEGCGYKQEH 993          
BLAST of RTEL1 vs. UniProt/SwissProt
Match: sp|Q9NZ71|RTEL1_HUMAN (Regulator of telomere elongation helicase 1 OS=Homo sapiens OX=9606 GN=RTEL1 PE=1 SV=2)

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 354/1001 (35.36%), Postives = 537/1001 (53.65%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVK------KVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEEL-KVLGEFIYSIQSTDAIID-EADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEK-CSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFG---IDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNI-----------------------TIKYPPPGLGCCESIS-NVPIEIQNQESSTKPSRIKSRTNISAQYSSKVVSFATSLKDGSQDFAKILESYANTPPIKKPESSLTSTSLMDILKRAENHVTEIEILPVKRTFNETVCEVDDPEKNTRKVK--KYKLVALKGQEKVKESNEYSFIIKRLFNEDVQGFISYKTVIEDFKKNTNVDTLFAGLNSLLCEKDQP-GLVRDFYKFIQP 2992
            MP I + GV++DFPF+PY CQ  YM KV+E L+   N ILESPTGTGKTLCLLC  LAW++H++      K+   ++ E+    +   + + N    +   I+    +PKIIY+SRTHSQL+Q IN L+ T Y   KV ++ SREQLCI+P+V   ESN  +I+ C+ +V +R C FYN  E+        + I DIEDL+  G K  VCPY+LSR +   ADI FMPYNYLLD+K RR +NI+LKG +VIFDEAHN+E++CE+SAS  LT  ++AS ++ + +VL E   + Q  +   +  AD+ S    + +L  I  LK  L  LE    +++L  + ++G+T   + +F+L          K   +D L++      G +   T T     GL+K+ + ++ VF  +  E           L + Y+V I  +            W +   +     + +VLS+WC + G +M  L    VRS+ILTSGTL P+ +  L+M I F V L N H+I+  Q+ V V  +G DG  L+S++  R      +SLG ++ N+++++P GLL+ FPSY +M K +E W + D+   M   K L VEP+ K  F+  +  +Y++ + P S  G+  L+V RGK SEGLD SD  GRGVIV GLPYP  MDPR+ LKM FLD+       G   + G+ WY+QQA RAVNQ+IGRVIRH +D+GA++L D RFA AD+R QLP W++ ++ + ++FG  IR+   FFR                           K P P     ++ S ++ +    Q SS  P+     +++  +Y  + V  A     G     +  E  A +P  ++   S ++ SL+   + AE            R   + +  V  PE+     +  + KL  +  ++++ ++N                F ++   ++D+K + +   L A L  L  E  +   L++ FY+F++P
Sbjct:    1 MPKIVLNGVTVDFPFQPYKCQQEYMTKVLECLQQKVNGILESPTGTGKTLCLLCTTLAWREHLRDGISARKIAERAQGELFP--DRALSSWGNAAAAAGDPIACYTDIPKIIYASRTHSQLTQVINELRNTSY-RPKVCVLGSREQLCIHPEVKKQESNHLQIHLCRKKVASRSCHFYNNVEEKSLEQELASPILDIEDLVKSGSKHRVCPYYLSRNLKQQADIIFMPYNYLLDAKSRRAHNIDLKGTVVIFDEAHNVEKMCEESASFDLTPHDLASGLDVIDQVLEEQTKAAQQGEPHPEFSADSPSPGLNM-ELEDIAKLKMILLRLEGAIDAVELPGD-DSGVTKPGSYIFELFAEAQITFQTKGCILDSLDQIIQHLAGRAGVFTNT----AGLQKLADIIQIVFSVDPSEGSPGSPAGLGALQS-YKVHIHPDAGHRRTAQRSDAWSTTAAR----KRGKVLSYWCFSPGHSMHELVRQGVRSLILTSGTLAPVSSFALEMQIPFPVCLENPHIIDKHQIWVGVVPRGPDGAQLSSAFDRRFSEECLSSLGKALGNIARVVPYGLLIFFPSYPVMEKSLEFWRARDLARKMEALKPLFVEPRSKGSFSETISAYYARVAAPGST-GATFLAVCRGKASEGLDFSDTNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMKGQGGAGGQFLSGQEWYRQQASRAVNQAIGRVIRHRQDYGAVFLCDHRFAFADARAQLPSWVRPHVRVYDNFGHVIRDVAQFFRVAERTMPAPAPRATAPSVRGEDAVSEAKSPGPFFSTRKAKSLDLHVPSLKQRSSGSPAAGDPESSLCVEYEQEPVP-ARQRPRGLLAALEHSEQRAGSPGEEQ-AHSCSTLSLLSEKRPAEE----------PRGGRKKIRLVSHPEEPVAGAQTDRAKLFMVAVKQELSQAN----------------FATFTQALQDYKGSDDFAALAACLGPLFAEDPKKHNLLQGFYQFVRP 958          
BLAST of RTEL1 vs. UniProt/SwissProt
Match: sp|A4K436|RTEL1_BOVIN (Regulator of telomere elongation helicase 1 OS=Bos taurus OX=9913 GN=RTEL1 PE=2 SV=1)

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 318/772 (41.19%), Postives = 452/772 (58.55%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLN-ISKINV------VPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEEL-KVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKC-SSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKK-------LSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFG---IDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFR 2365
            MP I + GV++DFPF+PY CQ  YM KV+E L++  N ILESPTGTGKTLCLLC+ LAW++H++   +       +   ++G  + ++   S  N I + +V      +PKIIY+SRTHSQL+Q I+ L+ T Y  R V ++ SREQLCI+P+V   ESN  +++ C+ +V +R C FYN  E+        T I DIEDL+  G K  +CPY+LSR +   ADI FMPYNYLLD+K RR + I+LKG +VIFDEAHN+E++CE++AS  LT  ++AS ++ + +VL E     Q  +   + + + +RS    +   +  LK  L  LE    +++L  + N+G+T   + +F+L          K   +D L++      G +   T T     GL+K+ + ++ VF         S+D+ E          S  Y+V I  +            W    N        +VLS+WC + G +M+ L    VR++ILTSGTL P+ +  L+M I F V L N HVIN  Q+ V V  KG DG  L+S++  R      +SLG  + N+S+++P GLLV FPSY +M K +E W + D    +   K L VEP+ K  F+  ME FY++ + P S+ G+I L+V RGK SEGLD +D  GRGVIV GLPYP  MDPR+ LKM FLD+       G   + G  WY+QQA RAVNQ+IGRVIRH  D+GA++L D RFA AD+R QLP W++ ++ + + FG  IR+   FFR
Sbjct:    1 MPKITLKGVTVDFPFQPYKCQEEYMSKVLECLQEKVNGILESPTGTGKTLCLLCSTLAWREHLRDAVSARR----IAERASGELFPDRTLASWGNAIPEGDVPACYTDIPKIIYASRTHSQLTQVISELRNTSYRPR-VCVLGSREQLCIHPEVKKQESNHMQVHLCRRKVASRSCHFYNNVEEKSLEQELATPILDIEDLVRSGTKHKLCPYYLSRNLKQQADIIFMPYNYLLDAKSRRAHGIDLKGTVVIFDEAHNVEKMCEEAASFDLTPHDVASELDVIDRVLEERTKVAQQAELHPEFSADSARSGLNLEPEDLAKLKMILLRLEGAIDAVELPGD-NSGVTKPGSYIFELFAEAQITFQTKGCILDSLDQLIQHLAGRAGLFTNT----AGLQKLVDIIQIVF---------SVDSAEGDPGPMVGLASQSYKVHIHLDAGHRRTAQRSDVW----NTTAARKPGKVLSYWCFSPGHSMRELVRQGVRTLILTSGTLAPMASFSLEMQIPFPVCLENPHVINQHQIWVGVIPKGPDGAQLSSAFDRRFSDECLSSLGKVLSNISRVVPHGLLVFFPSYPVMEKSLEFWRARDFTRKLEVRKPLFVEPRSKGGFSEVMEAFYARVAAPESS-GAIFLAVCRGKASEGLDFADVNGRGVIVTGLPYPPRMDPRVLLKMQFLDEMKAQSGAGGQFLSGHDWYRQQASRAVNQAIGRVIRHRHDYGAVFLCDHRFAHADTRAQLPSWVRPHVKVYDSFGHVIRDVAQFFR 748          
BLAST of RTEL1 vs. UniProt/SwissProt
Match: sp|Q5RE34|RTEL1_PONAB (Regulator of telomere elongation helicase 1 OS=Pongo abelii OX=9601 GN=RTEL1 PE=2 SV=1)

HSP 1 Score: 564.303 bits (1453), Expect = 8.386e-180
Identity = 318/768 (41.41%), Postives = 454/768 (59.11%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVK------KVTTNSEDEILLH--LNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEEL-KVLGEFIYSIQSTDAIID-EADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEK-CSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEF-DSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFG---IDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFR 2365
            MP I + GV++DFPF+PY CQ  YM KV+E L+   N ILES TGTGKTLCLLC  LAW++H++      K+    + E+     L+S GN            I+    +PKIIY+SRTHSQL+Q IN L+ T Y   KV ++ SREQLCI+P+V   ESN  +I+ C+ +V +R C FYN  E+        + I DIEDL+  G K  VCPY+LSR +   ADI FMPYNYLLD+K RR +NI+LKG +VIFDEAHN+E++CE+SAS  LT  ++AS ++ + +VL E   + Q  +   +  AD+ S    + +L  I  LK  L  LE    +++L  + ++G+T   + +F+L          K+  +D L++      G +   T T     GL+K+ + ++ VF  +  E    S+  L    S  Y+V I  +            W +   +     + +VLS+WC + G +M+ L    VRS+ILTSGTL P+ +  L+M I F V L N H+I+  Q+ V V  +G DG  L+S++  R      +SLG ++ N ++++P GLL+ FPSY +M K +E W + D+   M   K L VEP+ K  F+  +  +Y++ + P S  G+  L+V RGK SEGLD SD  GRGVIV GLPYP  MDPR+ LKM FLD+       G   + G+ WY+QQA RAVNQ+IGRVIRH +D+GA++L D RFA AD+R QLP W++ ++ + ++FG  IR+   FFR
Sbjct:    1 MPKIVLNGVTVDFPFQPYKCQQEYMTKVLECLQQKVNGILESHTGTGKTLCLLCTTLAWREHLRDGISARKIAERVQGELFPDRALSSWGNAAAAAAGDP---IACYTDIPKIIYASRTHSQLTQVINELRNTSY-RPKVCVLGSREQLCIHPEVKKQESNHIQIHLCRKKVASRSCHFYNNVEEKSLEQELASPILDIEDLVKSGSKHRVCPYYLSRNLKQQADIIFMPYNYLLDAKSRRAHNIDLKGTVVIFDEAHNVEKMCEESASFDLTPHDLASGLDIIDQVLEEQTKTAQQGEPHPEFSADSTSPGLNM-ELEDIAKLKMILLRLEGAIDAVELPGD-DSGVTKPGSYIFELFAEAQITFQTKVCILDSLDQIIQHLAGRAGVFTNT----AGLQKLADIIQIVFSVDPSEGGPGSLAGLGALQS--YKVHIHPDAGHRQTAQRSDAWSTTAAR----KRGKVLSYWCFSPGLSMRELVRQGVRSLILTSGTLAPVSSFALEMQIPFPVCLENPHIIDKHQIWVGVVPRGPDGAQLSSAFDRRFSEECLSSLGKALGNTARVVPCGLLIFFPSYPVMEKSLEFWRARDLARKMEALKPLFVEPRSKGSFSETISAYYARVAAPGST-GATFLAVCRGKASEGLDFSDTNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMKGQGGAGGQFLSGQEWYRQQASRAVNQAIGRVIRHRQDYGAVFLCDHRFAFADARAQLPSWVRPHVRVYDNFGHVIRDVAQFFR 751          
BLAST of RTEL1 vs. UniProt/SwissProt
Match: sp|Q0VGM9|RTEL1_MOUSE (Regulator of telomere elongation helicase 1 OS=Mus musculus OX=10090 GN=Rtel1 PE=1 SV=2)

HSP 1 Score: 556.599 bits (1433), Expect = 6.946e-178
Identity = 314/775 (40.52%), Postives = 445/775 (57.42%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVK------KVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEEL-KVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVF-FDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRC-----WYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNITIKYPPP 2392
            MP + + GV++DFPF+PY CQ  YM KV+E L+   N ILESPTGTGKTLCLLC+ LAWQ H++      K+    + E+      +             +I     +PKIIY+SRTHSQL+Q I  L+ T Y   KV ++ SREQLCI+P+V   ESN  +I  C+ +V +R C FYN  E         T I DIEDL+  G K+ +CPY+LSR M   ADI FMPYNYLLD+K R+ ++I+LKG +VIFDEAHN+E++CE+SAS  LT  ++AS +E + +VL E     Q  +   +   + S S    +L  I  LK  L  LE    ++ L  + + G+T   + +F+L          K     +LE     I   +  T       GL+K+ + ++ VF  D       S+  L   +S  Y+V I               W +  ++     + +VLS+WC +  ++M+ L    VR++ILTSGTL P+ +  L+M I F V L N H+I+ +Q+ V +  +G DG  L+S+Y  R      +SLG ++ N+++++P GLLV FPSY +M K +E W+   +   +   K L VEP++K  F+  ++ +Y + + P SN G+  L+V RGK SEGLD SD  GRGVIV GLPYP  MDPR+ LKM FLD+     + G+ G+C     WY+QQA RAVNQ+IGRVIRH  D+GAI+L D RFA AD+R QLP W++  + + ++FG  IR+   FFR      P P
Sbjct:    1 MPRVVLNGVTVDFPFQPYPCQQEYMTKVLECLQKKVNGILESPTGTGKTLCLLCSTLAWQQHLRDAVSSLKIAERVQGELFASRTLSSWGSAAAASGD--SIECYTDIPKIIYASRTHSQLTQVIRELRNTAY-RPKVCVLGSREQLCIHPEVKKQESNHMQISLCRKKVASRSCHFYNNVEAKFLEQDLATPILDIEDLVKNGSKQKMCPYYLSRNMKQQADIIFMPYNYLLDAKSRKAHSIDLKGTVVIFDEAHNVEKICEESASFDLTPRDVASGLEIINQVLEEQARVTQQGELQQEFIVDTSSSGLNMELEDIAKLKMILLRLEEAIDAVQLPGD-DRGVTKPGSYIFELFAEAQITFQTK---GCILESLDQIIQHLAGRTGVFTNTAGLQKLMDIIQIVFSVDPPEGSPGSLVGL--GISHSYKVHIHPETSHRRAAKRSDAWSTTASR----KQGKVLSYWCFSPSQSMRELVCQGVRTLILTSGTLAPLSSFALEMQIPFPVCLENPHIIDKNQLWVGIVPRGPDGVQLSSAYDKRFSEECLSSLGKALSNIARVVPHGLLVFFPSYPVMEKSLEFWQVQGLARKVEALKPLFVEPRNKGSFSEVIDAYYQQVASPASN-GATFLAVCRGKASEGLDFSDMNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMRG--RSGVGGQCLSGQEWYQQQASRAVNQAIGRVIRHRHDYGAIFLCDHRFAYADARAQLPSWVRPYLKVYDNFGHVIRDVAQFFRVAQKTMPLP 759          
BLAST of RTEL1 vs. TrEMBL
Match: H9CXU1 (RTEL1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 2168.66 bits (5618), Expect = 0.000e+0
Identity = 1050/1057 (99.34%), Postives = 1052/1057 (99.53%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNITIKYPPPGLGCCESISNVPIEIQNQESSTKPSRIKSRTNISAQYSSKVVSFATSLKDGSQDFAKILESYANTPPIKKPESSLTSTSLMDILKRAENHVTEIEILPVKRTFNETVCEVDDPEKNTRKVKKYKLVALKGQEKVKESNEYSFIIKRLFNEDVQGFISYKTVIEDFKKNTNVDTLFAGLNSLLCEKDQPGLVRDFYKFIQPEFQARFAELCESVLGLDCMEGKENVEIDPVVSRSNLLDCAYCLASPALIPLGAPCKHVCCFECWKIIIEGENATRICPKCSQPIRRRNLTRLNIS 3277
            MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVKKVTTNSEDEILLHLNSNGNQYWNK+KKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGF HSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNITIKYPPPGLGCCESIS+VPIEIQNQESSTKPSRIKSR NISAQYSSKVVSFATSLKDGSQDFAKILESYANTPPIKKPESS TSTSLMDILKRAENHVTEIEILPVKRTFNETVCEVDDPEKNTRKVKKYKLVALKGQEKVKESNEYSFIIKRLFNEDVQGFISYKTVIEDFKKNTNVDTLFAGL SLLCEKDQPGLVRDFYKFIQPEFQ RFAELCESVLGLDCMEGKENVEIDPVVSRSNLLDCAYCLASPALIPLGAPCKHVCCFECWKIIIEGENATRICPKCSQPIRRRNLTRLNIS
Sbjct:    1 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVKKVTTNSEDEILLHLNSNGNQYWNKLKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFKHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNITIKYPPPGLGCCESISSVPIEIQNQESSTKPSRIKSRPNISAQYSSKVVSFATSLKDGSQDFAKILESYANTPPIKKPESSFTSTSLMDILKRAENHVTEIEILPVKRTFNETVCEVDDPEKNTRKVKKYKLVALKGQEKVKESNEYSFIIKRLFNEDVQGFISYKTVIEDFKKNTNVDTLFAGLYSLLCEKDQPGLVRDFYKFIQPEFQTRFAELCESVLGLDCMEGKENVEIDPVVSRSNLLDCAYCLASPALIPLGAPCKHVCCFECWKIIIEGENATRICPKCSQPIRRRNLTRLNIS 1057          
BLAST of RTEL1 vs. TrEMBL
Match: A0A0X3PZF5 (Regulator of telomere elongation helicase 1 OS=Schistocephalus solidus OX=70667 GN=RTEL1 PE=4 SV=1)

HSP 1 Score: 724.931 bits (1870), Expect = 0.000e+0
Identity = 432/1152 (37.50%), Postives = 642/1152 (55.73%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVKKVTTNSEDEILLHLNSNGNQYWNKVKK-SQLNISKINVV--PKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKE-ILSS--ETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIP---DLTQ-------------IIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKC-SSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKIN--------WGSNKNQAVNGD--KNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKF----TLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFG---------IDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNITIKYPPPGLGCCESISNVPIEIQNQESSTKPSRIKSRTNISAQY---SSKVVSFATSLKDGSQDFAKILESYANTPPIKKPESSLTSTSLMDILKRAENHVTEIEILPVKRTFNETVCEVDDPEKNTRKVKKYK-------LVALKGQEKVKESNEY------------SFI--IKRLF---------NEDVQGFISYKTVIEDFKKN------TNVDTLFAGLNSLLCEKDQPGLVRDFYKFIQPEFQARFAELCESVLGLDCMEGKENVEI-------DP-----VVSRSNLLD-CAYCLASPALIPLGAPCKHVCCFECWKIIIEGENATRICPKCSQPIRRRNLTRL 3268
            MP++ +  + +DFP++PY CQ+ YM+ VI++L + ++AILESPTGTGKTLCLLCA+L W D+V+        + L  L +     W+     S++  S +N +  P II+SSRTH+QL+Q I A + T Y   ++G++ SR+QLC+ P+V  L+SN+AK+Y C+ RV TR C FY  F+  +E +L+S   +   DIEDL+ +G++   CPY+LSRE    AD+ FMPYNYLLD KIR  Y I+L   +VIFDEAHNIEQVCED++S  L +  +AS IEEL+V+GE+I+S    D+      N+     +    DLTQ             II LK  L  LE   H +  G  + +GL    + +F+LL   G    + +H ++L+ +  S+ +G ++ P   +   +GL  + EF++ VF +       +    E   S  YRVFI+E ++ T    N++         WG     ++ G   +N  LS+WC++ GR +  L    VR+IILTSGTLYP+ +L+L++ ++  + L+N HVI+ +Q+ V+V  K  DG  LNS Y  R+ ++Y  SLG  + NL +IIPRG+LV FPSY +MRKC++ W+S DIY   + HK++ +EP+DKT F    T  +E  YS ++D     G+ L+SV RGK SEGLDLSDH  R VI+VGLPYP   DPR+++KMS+LD+R    + G           GR WYK QA+RAVNQ +GRVIRH RD+GAI+L DERFA  ++R  LP+W++  +   + FG A+R+   FFRN  IKYP P +      +NV     + +S  + +   SRT +S  +   SS+V  +A SL D   D      + ++  P    E +   +S   IL    N        P  +   +   +   PE+N ++V+          L    G +K+K   E+            ++I  +K L           +  Q F  ++  ++ +K +      T V+T+FA L  +   ++ PGL+RDF  F++   + RF++LC+ + GL   + +   E        DP     + + + L   C  C   P   PL APC H CCF CW+ IIE EN  R CP C+  +RRR+L R+
Sbjct:    1 MPIVQVGCIHVDFPYKPYPCQVSYMQNVIDALNERRHAILESPTGTGKTLCLLCASLGWLDYVRA------QQQLTALTA-----WDTSHPISEVPFSGLNKLDNPLIIFSSRTHAQLNQAIQAFRNTAYSSHRIGVLGSRDQLCLLPEVSQLDSNSAKVYQCRLRVTTRTCDFYRNFDANREKLLASLRSSSTTDIEDLVKLGRETRSCPYYLSREAKTDADVLFMPYNYLLDPKIRSTYGIDLTNAVVIFDEAHNIEQVCEDASSATLVTSLLASAIEELRVIGEYIFSASENDSEGPPDGNDRAQSAVNSSLDLTQPSNDALMALGLPRIITLKGQLIELERLMHELPAG--SASGLIKPGDYVFELLAHAGITVQSYVHDLELINQIISASVGFNN-PKFRRG--RGLTHLAEFLQVVFAETSQSRPGAATRRES--SRAYRVFIKEEDLVTKFSRNQVGKDSSVAAAWGLPVT-SIGGKEVRNVSLSYWCLSPGRAIYELLAQNVRNIILTSGTLYPVRSLQLELGLEGAIVLQNPHVIDREQVHVAVIPKAPDGGTLNSGYAFRDSVAYQRSLGLMLANLFRIIPRGVLVFFPSYALMRKCVDYWQSSDIYGRFLDHKKVFLEPRDKTVFQQVATSYVEAAYSPSAD---AGGAALISVMRGKASEGLDLSDHASRAVIIVGLPYPPCEDPRVKIKMSYLDER----RMGETQAALCDMPTGRQWYKLQAWRAVNQGVGRVIRHIRDYGAIFLCDERFAAPEARSHLPVWIREAVHTYDSFGPAVRDAAAFFRNCEIKYPAPLMSV--KGTNVTDMSASSQSLARRNIQSSRTLVSTDFPLVSSQVHVYAKSLADTGADLLSAYPTTSSLNPSSDTEKTDPVSSTSSILSLVYN-------CPNSQP-TQVSQKSSPPERNRKRVRGEDEILESRLLNRQHGTKKLKLVKEHVNPETGVGVAPGAYIKAVKELLLKNSTDLPTADGRQSFADFQKALKTYKASQIQGSGTPVETVFAALARIFLPREAPGLLRDFAVFVREHERERFSQLCKGLTGLPVQDTQVEHEANTAQSSGDPNLAGQIPALAELFSICPRCRKRPIENPLRAPCSHCCCFTCWRDIIEKEN--RRCPVCACLVRRRHLVRI 1114          
BLAST of RTEL1 vs. TrEMBL
Match: A0A068WFR9 (Regulator of telomere length splice variant OS=Echinococcus granulosus OX=6210 GN=EgrG_000640000 PE=4 SV=1)

HSP 1 Score: 701.819 bits (1810), Expect = 0.000e+0
Identity = 428/1162 (36.83%), Postives = 628/1162 (54.04%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAW------QDHVKKVTTNSEDEILLHLNSNGNQYWNKVKK-SQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEIL---SSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQST------------DAIIDEADNESRSD---------EIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVN-ILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSA-CYRVFIQENEIATSNRNNKIN-WGSNKNQAVNGD-------KNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGID-------GRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNITIKYPPPGLGCCESI----SNVPIEIQNQESSTKPSRIKSRTN--------ISAQYSSKVVSFATSLKDGSQDFAKILESYANTPPIKKPE---------SSLTSTSLMDIL--KRAENHVTEIEILPVKRTFNETVCEVDDPE-------KNTRKVKKYKLVALKGQEKVKES---NEYSFIIKRLFNEDVQG-----FISYKTVIEDFKKN------TNVDTLFAGLNSLLCEKDQPGLVRDFYKFIQPEFQARFAELCESVLGLDCMEGKENV----------------EIDPVVSRSNLLDCAYCLASPALIPLGAPCKHVCCFECWKIIIEGENATRICPKCSQPIRRRNLTRL 3268
            MPL++   V ++FP EPY CQ  YM+ V+++L   ++AILESPTGTGKTLCLLCA+L W      Q  +K++                 Q W+       LN S     P +I+SSRTH+QL+Q + A K T Y  R++G++ SR+QLC  P+V+NLE+N+AK+Y C+ RV TR C +Y  F+ +++ L      +KI DIEDL+  G++   C Y+LSRE+   A+I FMPYNYLLD KIR LY I L   +VIFDEAHNIEQVCED+AS  LTS  +AS IEEL+V+GE+I+S+ S             + I       +R D             L+ ++ LK  L  LE       LG++A+   T++    +F+LL + G   +N     DL+++  +   +S +    + G +GL  V EF++ VF D  G +  S+  L ++ SA C+RV ++    +  N     + WG N    V+G+       KN  LS+WC+T GR M  L    VR+IILTSGTLYPI +L+ ++ ++  + L+N HV+N+DQ+ V+V  K  DG  LNSS+  R   +Y  SLG +++NL +++P G+LV FPSY +M+ C++ W++ DIYN  +  K++  EP+DKT+F      +    +   +  GS+L SV RGK SEGLDL+D   R V++VG+ YP   DPR+++KM+FLD+R    +F  D       GR WYK QA+RAVNQ++GRVIRH  DFGA++L DERFA+ ++R  LP W++S++ + + FG  ++    FFR    KYP    G  + +    S+ P+        T PSR+    +         +   ++ V S +TS   G  DF   L  Y+   P+ + E         S+  STSL+D +     +    +    P     +      +D E       K  +  K+ KLV      +  +S    +Y   ++ LF+    G     F  +K  + ++K N      ++V+ +FA L SL    D PGL+RDF  F++   + ++AELC+ + GL    G+                   E  P VS      C  C  SP    L APC H+CCF CW+IIIE  N  R CP CS  +RRR+L RL
Sbjct:    1 MPLVSFGEVEVNFPHEPYECQKNYMQSVVDALSQRRHAILESPTGTGKTLCLLCASLGWLEYSLAQQQLKRL----------------EQPWDSTSPCGPLNSSNKFDAPLLIFSSRTHAQLNQAVQAFKNTVYSGRRIGVLGSRDQLCSLPEVLNLETNSAKVYQCRLRVSTRTCEYYRNFDASRDKLLDTMKTSKITDIEDLVKFGRENRACAYYLSREVKSDAEILFMPYNYLLDLKIRTLYGIELTNAVVIFDEAHNIEQVCEDAASATLTSAFVASAIEELRVIGEYIFSLTSGGEGDDIDGLGGLEGIAQPLGRVNRLDISQPTNDGAAAIGLSSVLTLKGQLLELERLLDG--LGDSASTTDTIKPGEYVFELLGQAGITINNHGQIQDLIDQIIN-ASISMDVAKFRRG-RGLSHVSEFLQKVFVDNTGGKSSSL--LARQRSASCFRVHVKVEFPSMRNFKEITDVWGKNPISIVDGNSGSGRETKNVCLSYWCLTPGRAMHELLELNVRNIILTSGTLYPITSLQAELGLQSAIVLQNPHVVNSDQIHVAVLPKAPDGGTLNSSFEHRANSAYHRSLGLTLMNLFRVVPGGVLVFFPSYALMKMCLDAWQNSDIYNKFLDSKKIFTEPRDKTQFQQITTGYMEAATS--TAGGSVLFSVMRGKASEGLDLADQTSRAVVIVGIAYPPQEDPRVKIKMAFLDER----RFQADSIKDLPTGRQWYKLQAWRAVNQAVGRVIRHIHDFGAVFLCDERFASPEARSHLPTWMRSSVCVYDSFGPVLKAASEFFRTAQAKYPTFLKGPMKPLPARRSSTPV------GHTAPSRLGLALDGGVLRFPSAAGHIATYVGSLSTS--SGVSDF---LADYSFEEPLPEGEAESSHTSSQSTKPSTSLLDRIYCNVQQPSSEQTSKRPTSDMSSSKGPNSNDDEAFAARLLKRHQTAKRIKLVKQHLNPETGDSVTTPDYLTAVRTLFSRASMGKENHCFEEFKGALSNYKANGTEAGSSSVERVFAALASLFIPLDAPGLLRDFIVFVRDSDKPKYAELCKGLTGLSVTSGENTAASSSDAASTSAFTATKEASPPVS------CVRCKKSPITDALRAPCGHICCFSCWRIIIEEGN--RRCPVCSAFVRRRDLVRL 1115          
BLAST of RTEL1 vs. TrEMBL
Match: A0A068Y9L0 (Regulator of telomere length splice variant OS=Echinococcus multilocularis OX=6211 PE=4 SV=1)

HSP 1 Score: 698.738 bits (1802), Expect = 0.000e+0
Identity = 426/1167 (36.50%), Postives = 626/1167 (53.64%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAW------QDHVKKVTTNSEDEILLHLNSNGNQYWNKVKK-SQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEIL---SSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQST------------DAIIDEADNESRSD---------EIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVN-ILFQLLNRCGF---NHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQE--------NEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGID-------GRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNITIKYPP----PGLGCCESISNVPIEIQNQESSTKPSRIKSRTN--------ISAQYSSKVVSFATSLKDGSQDFAKILESYANTPPIKKPESSLT---------STSLMDILKRAENHVTEIEILPVKRTFNETVCEVDDPEKN------TRKVKKY---KLVALKGQEKVKESN------EYSFIIKRLFNEDVQG-----FISYKTVIEDFKKN------TNVDTLFAGLNSLLCEKDQPGLVRDFYKFIQPEFQARFAELCESVLGLDCMEGKENV----------------EIDPVVSRSNLLDCAYCLASPALIPLGAPCKHVCCFECWKIIIEGENATRICPKCSQPIRRRNLTRL 3268
            MPL++   V + FP EPY CQ  YM+ V+ +L   ++AILESPTGTGKTLCLLCA+L W      Q  +K++                 Q W+       LN S     P +I+SSRTH+QL+Q + A K T Y  R++G++ SR+QLC  P+V+NLE+N+AK+Y C+ RV TR C +Y  F+ +++ L      +KI DIEDL+  G++   C Y+LSRE+   A+I FMPYNYLLD KIR LY I L   +VIFDEAHNIEQVCED+AS  LTS  +AS IEEL+V+GE+I+S+ S             + I       +R D             L+ ++ LK  L  LE       LG++A+   T++    +F+LL + G    NH      ID +   S    +S + T  + G +GL  V EF++ VF D  G +  S+  + ++ ++C+RV ++          EI      N I+ G   + +    KN  LS+WC+T GR M  L    VR+IILTSGTLYPI +L+ ++ ++  + L+N HV+N+DQ+ V+V  K  DG  LNSS+  R   +Y  SLG +++NL +++P G+LV FPSY +M+ C++ W++ DIYN  +  K++  EP+DKT+F      +    ++  +  GS+L SV RGK SEGLDL+D   R V++VG+ YP   DPR+++KM+FLD+R    +F +D       GR WYK QA+RAVNQ++GRVIRH  DFGA++L DERFA+ ++R  LP W++S++ + + FG  ++    FFR    KYP     P        S+ P+        T PSR+    +         +   ++ V S +TS   G  DF      Y+   P+ + E+  +         STSL+D   R   +V +  +    +  +  +     P  N       R +K++   K + L  Q    E+       +Y   ++ LF+    G     F  +K  + ++K N      ++V+ +FA L SL    D PGL+RDF  F++   + ++AELC+ + GL    G++                  E  P VS      C  C  SP    L APC H+CCF CW+IIIE  N  R CP CS  +RRR+L RL
Sbjct:    1 MPLLSFGEVEVTFPHEPYECQKSYMQSVVNALSQRRHAILESPTGTGKTLCLLCASLGWLEYSLAQQQLKRL----------------EQPWDSTSPCGPLNSSNKFDAPLLIFSSRTHAQLNQAVQAFKNTVYSSRRIGVLGSRDQLCSLPEVLNLETNSAKVYQCRLRVSTRTCEYYRNFDASRDKLLDTMKTSKITDIEDLVKFGRENRACAYYLSREVKSDAEILFMPYNYLLDVKIRTLYGIELTNAVVIFDEAHNIEQVCEDAASATLTSAFVASAIEELRVIGEYIFSLTSGGEGDDINGLGGLEGIAQPLGRVNRLDISQPTNDGAAAIGLSSVLTLKGQLLELERLLDG--LGDSASTTDTIKPGEYVFELLGQAGITINNHGQIQGLIDQIINAS----ISMDVTKFRRG-RGLSHVSEFLQKVFVDNTGGKSSSL-LVRQRSASCFRVHVKVEFPSMWNFKEITDVWGRNSISIGDGNSGSGRETKNVCLSYWCLTPGRAMHELLELNVRNIILTSGTLYPITSLQAELGLQSAIVLQNPHVVNSDQIHVAVLPKAPDGGTLNSSFEHRANSAYHRSLGLTLMNLFRVVPGGVLVFFPSYALMKMCLDSWQNSDIYNKFLDSKKIFTEPRDKTQFQQITTSYMEAATN--TAGGSVLFSVMRGKASEGLDLADQTSRAVVIVGIAYPPREDPRVKIKMAFLDER----RFQVDSIKDLPTGRQWYKLQAWRAVNQAVGRVIRHIHDFGAVFLCDERFASPEARSHLPTWMRSSVCVYDSFGPVLKAASEFFRTAQAKYPTLLKGPMKPSPARRSSTPV------GHTAPSRLGLALDGGVLRFPGAAGHIATYVGSLSTS--SGVSDFPA---DYSFEEPLPEGEAESSQTSSQSTKPSTSLLD---RIYCNVQQPSLEQTSKRPSSDMSSSKGPNSNDDEAFAARLLKRHQTAKRIKLVKQHLNPETGDSVTTPDYLTAVRTLFSRASMGKENHCFEEFKGALLNYKANGTEAGSSSVERVFAALASLFIPLDAPGLLRDFIVFVRDSDKPKYAELCKGLTGLSVTSGEDTAESSSDAASTSAFTATKEASPPVS------CVRCKKSPITDALRAPCGHICCFSCWRIIIEEGN--RRCPVCSAFVRRRDLVRL 1115          
BLAST of RTEL1 vs. TrEMBL
Match: A0A5K4EMX2 (Putative regulator of telomere elongation helicase 1 rtel1 OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 672.159 bits (1733), Expect = 0.000e+0
Identity = 423/1165 (36.31%), Postives = 635/1165 (54.51%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLN-------ISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFE-KAKEILSS--ETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYS---------------------------IQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGE-----EFDSIDNLEKKLS-ACYRVFIQENEIATSNRN--NKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRL----------KLFKFGID----GRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNITIKYPPPGLGCCESISNVPIE----IQNQESSTKPSRIKSRTNISAQYSSKVVSFATSLK-----DGSQDFAKILESYAN--TP-PIK--------KPESSLTSTSLMDILKRAENHVTEIEILPVKRTFNETVCEVDDPEKNTRKVKKYKLV-----ALKGQEKVKE-----------SNEYSFIIKRLFNEDVQGFISYKTVIEDFK-----------KNTN---------VDTLFAGLNSLLCEKDQPGLVRDFYKFIQPEFQARFAELCESVLGLDCMEGK---ENVEIDPVVSRSNLLD----------------CAYCLASPALIPLGAPCKHVCCFECWKIIIE 3199
            MP I I GV IDFP++PY CQ  YM KV+ SL +GK+AILESPTGTGKTLCLLCA+LAW D               H N+ G +  +    + L+       + K+N   KIIY+SRTHSQL+Q INALK T Y  R V ++ SR+QLC+ P V +LESN+AKIY C+ RV+TR C ++  F+ K  EIL++     I DIEDL   G+K   CPYF+SRE+   + + FMPYNY+LD +IR LYNINL+   VIFDEAHNIEQVCED++SV L+S  +AS IE +K + E +                             I +   + D    E  + E   + ++I LK  L  LE     ID  N    GLT + + +F LL+R G NH        ++++  SF   +    + K   KGL +V EF+KTVF    GE      F +   L+   S +CYR+ I+++ ++ +N N   K  W +  N  V G  NR +S+WC + GR ++ L    VR IILTSGTLYP+E ++ ++++KF + LRN HVIN DQ+ +S+  +G DGE LN++Y  RE  +Y NSLG  ++ L+ ++P GLL+ FPSY  M +CIE W+  D+Y  + + K + +EP++K +F     + Y K +   ++ G+IL +V RG++SEGLDL+D+ GRGV ++G+PY  + DPR+ LKM++LD++           +L K  ID    GR WY  QA+RA+NQ++GRVIRH +D+G IYL DERFA+ +++  L  W+Q+   + N+    +++T  FFRN+  KYP          ++ P+E    + N  ++T   R  +RT  S + S+ + +  ++ +         D   ++ SY +  +P P K        K +  L+S S+ D +     ++ + + +    +++  + E    ++  +  K+ KL+      LK  E V             S++Y  ++K +   D      Y + + DFK           KN N         ++ LF  L+ +    + PGL++D   FI PE + R+AELC ++ GL  ++     + V+    VSRS  L+                C  C A PA +P+ + CKH+ CF+CW+ II+
Sbjct:    1 MPQIAIDGVEIDFPYQPYDCQFEYMTKVLLSLNEGKHAILESPTGTGKTLCLLCASLAWLDKQANSVQLISATDAKHQNTMGKRPTSDNVDNALSHQNFLASLGKVNNGCKIIYASRTHSQLAQAINALKGTVYSRRSVSVVGSRDQLCLLPDVTSLESNSAKIYACRMRVQTRTCEYFRNFDSKRDEILTNLKSEGIVDIEDLSNYGQKIKCCPYFISRELKTDSSLIFMPYNYVLDPRIRSLYNINLENTTVIFDEAHNIEQVCEDASSVTLSSALLASAIEHVKCVCEVVLDHTKEQQEIELSDSNCNVNQNSEQKLSVIMNRKGLFDMTHPEGNAIEALSIEKMITLKGQLIELE---RLIDELNVPPEGLTKDGSFIFDLLSRAGINHWTNNTIQTVIDEIMSFTNSTHNVKIRK--TKGLHEVSEFLKTVFGYLPGEANVTFNFKTNFKLQHNDSISCYRLHIKDDILSANNCNKYGKNAWDTQPNTTV-GTTNRTISYWCFSPGRAIQQLIQQNVRCIILTSGTLYPVEPIEAELNLKFPITLRNPHVINPDQLNLSIIPRGPDGEKLNATYSVRETSAYRNSLGLLLIQLADVVPAGLLIFFPSYSFMSQCIEYWKDGDVYEKLSRSKHIFIEPREKNQFNKIFNE-YRKTACIENSVGAILFAVMRGRVSEGLDLADNAGRGVFILGIPYAPIHDPRVSLKMAYLDEQFVKLKSNSTHDQLQKTLIDKYPTGRQWYNLQAWRAINQAVGRVIRHYKDYGIIYLCDERFASNNAQLNLAGWMQTKCKVYNNVELVVKDTDEFFRNMRNKYPS---------TDRPLESTSIVNNTLTATSSLRSVNRTKPSLEKSNVISNLPSAFELNIFSPKVNDSVTLITSYHSDRSPGPSKLHECNIDYKKDLCLSSASIFDTVYIESENIDQNKYISDCNSYSSDILEQKLLQR--KPCKRIKLMEQKNNCLKLSENVSSTTTIVDNDSSLSSKYMTLLKSVLKSDRTDESVYASRLNDFKQVMQEYRKSISKNRNSLNSHSNQLIEVLFTQLSRIFIPLEVPGLLQDAICFILPEHRKRYAELCHNLTGLPIVQSNSIDKFVDTSNQVSRSQALNSNQPVKLEKIPEVSMRCCKCSADPAQVPVISCCKHIACFKCWRHIID 1147          
BLAST of RTEL1 vs. Ensembl Cavefish
Match: rtel1 (regulator of telomere elongation helicase 1 [Source:NCBI gene;Acc:103025871])

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 319/782 (40.79%), Postives = 458/782 (58.57%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVK------KVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKA---KEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEEL-KVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGI----KGLEKVQEFMKTVFFDEIGE---EFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFG---IDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNITIKYPPP 2392
            MP++++ GV++DFPF PY CQ  YM KVIE L+   N +LESPTGTGKTLCLLCA L W+++ K      K++       L       +  W          +    +PKIIY+SRTHSQL+Q ++ LK T Y   KV ++ SREQLCIN ++M  ESN  K++ C+++V TR C FYN  ++    K+I++S   I D+EDL+  GKK+ VCPY+LSR +   AD+ FMPYNYLLD K RR +NI LKG +VIFDEAHN+E++CE+S S  LT  ++ S I+ + K+L E    I   D+  D       S    D+T I  +KQ L  LE   +S ++ +N N G+T   + +++L  +   N   K   ++ +E+ + ++         K GI     GL+KV + ++ VF  +  E   +   ++++++     ++V I  +      + +   W S+  +     +  VLS+WC   G +M+ L   EVR IILTSGTL P+ +   +M I F V L N HVI  DQ+ VS+  KG DG  L++++  R       SLGN+I+NLS+++P GLLV FPSY ++ K +E W +    + +   K + VEP+ K  FT  ++ FY K +DP SN GS   +V RGK SEGLD +D  GRGVI+ GLP+P  MDPR+ LKM +LD+  +    G   + G+ WY+QQA RAVNQ+IGRVIRH  D+GAI+L D RF   D R QLP W++  + + N FG  +R+   FFR      P P
Sbjct:    1 MPVLSLRGVNVDFPFTPYPCQTDYMNKVIECLQSKVNGVLESPTGTGKTLCLLCATLGWREYFKDSISARKISEKMGGAELFPDRPMSS--WGTAATDGDVPAYYTDIPKIIYASRTHSQLTQVVSELKNTAY-RPKVCVLGSREQLCINQEIMKQESNHIKVHMCRAKVSTRSCLFYNNVDEKSTDKDIMNS---ILDVEDLVKTGKKERVCPYYLSRSLKQHADLIFMPYNYLLDPKSRRAHNIELKGAVVIFDEAHNVEKMCEESTSFDLTPYDLTSAIDAVDKLLREQASDIGKGDSSEDFNVESLNSGLKLDITTIAKIKQILMDLELTINSFEMPSN-NQGITKPGSYIYELFEKTHVNFDTKTAIVEAMEQITGYLA-------GKPGIFLNTSGLQKVADIIQLVFVVDPAEGSKKSQMVNSMKQ-----FKVHIHPDTSNFKKKQSTDVWASSSAKK----QGNVLSYWCFCPGFSMQELLRQEVRCIILTSGTLSPLSSFTCEMQIPFPVSLENPHVIQKDQIFVSIVDKGPDGVQLSTAFDKRFVPENMASLGNTIVNLSRVVPHGLLVFFPSYPVLDKTLEFWRANGHADRIENMKPMFVEPRGKGTFTEVIDGFYDKVNDPKSNGGS-FFAVCRGKASEGLDFADTYGRGVIITGLPFPPRMDPRVVLKMQYLDEMCRNKSSGMKYLSGQEWYRQQASRAVNQAIGRVIRHREDYGAIFLCDHRFKNTDVRAQLPSWVRPYVRMDN-FGTVVRDAAQFFRVAQKLRPVP 757          
BLAST of RTEL1 vs. Ensembl Cavefish
Match: rtel1 (regulator of telomere elongation helicase 1 [Source:NCBI gene;Acc:103025871])

HSP 1 Score: 568.54 bits (1464), Expect = 0.000e+0
Identity = 319/782 (40.79%), Postives = 458/782 (58.57%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVK------KVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKA---KEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEEL-KVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGI----KGLEKVQEFMKTVFFDEIGE---EFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFG---IDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNITIKYPPP 2392
            MP++++ GV++DFPF PY CQ  YM KVIE L+   N +LESPTGTGKTLCLLCA L W+++ K      K++       L       +  W          +    +PKIIY+SRTHSQL+Q ++ LK T Y   KV ++ SREQLCIN ++M  ESN  K++ C+++V TR C FYN  ++    K+I++S   I D+EDL+  GKK+ VCPY+LSR +   AD+ FMPYNYLLD K RR +NI LKG +VIFDEAHN+E++CE+S S  LT  ++ S I+ + K+L E    I   D+  D       S    D+T I  +KQ L  LE   +S ++ +N N G+T   + +++L  +   N   K   ++ +E+ + ++         K GI     GL+KV + ++ VF  +  E   +   ++++++     ++V I  +      + +   W S+  +     +  VLS+WC   G +M+ L   EVR IILTSGTL P+ +   +M I F V L N HVI  DQ+ VS+  KG DG  L++++  R       SLGN+I+NLS+++P GLLV FPSY ++ K +E W +    + +   K + VEP+ K  FT  ++ FY K +DP SN GS   +V RGK SEGLD +D  GRGVI+ GLP+P  MDPR+ LKM +LD+  +    G   + G+ WY+QQA RAVNQ+IGRVIRH  D+GAI+L D RF   D R QLP W++  + + N FG  +R+   FFR      P P
Sbjct:    1 MPVLSLRGVNVDFPFTPYPCQTDYMNKVIECLQSKVNGVLESPTGTGKTLCLLCATLGWREYFKDSISARKISEKMGGAELFPDRPMSS--WGTAATDGDVPAYYTDIPKIIYASRTHSQLTQVVSELKNTAY-RPKVCVLGSREQLCINQEIMKQESNHIKVHMCRAKVSTRSCLFYNNVDEKSTDKDIMNS---ILDVEDLVKTGKKERVCPYYLSRSLKQHADLIFMPYNYLLDPKSRRAHNIELKGAVVIFDEAHNVEKMCEESTSFDLTPYDLTSAIDAVDKLLREQASDIGKGDSSEDFNVESLNSGLKLDITTIAKIKQILMDLELTINSFEMPSN-NQGITKPGSYIYELFEKTHVNFDTKTAIVEAMEQITGYLA-------GKPGIFLNTSGLQKVADIIQLVFVVDPAEGSKKSQMVNSMKQ-----FKVHIHPDTSNFKKKQSTDVWASSSAKK----QGNVLSYWCFCPGFSMQELLRQEVRCIILTSGTLSPLSSFTCEMQIPFPVSLENPHVIQKDQIFVSIVDKGPDGVQLSTAFDKRFVPENMASLGNTIVNLSRVVPHGLLVFFPSYPVLDKTLEFWRANGHADRIENMKPMFVEPRGKGTFTEVIDGFYDKVNDPKSNGGS-FFAVCRGKASEGLDFADTYGRGVIITGLPFPPRMDPRVVLKMQYLDEMCRNKSSGMKYLSGQEWYRQQASRAVNQAIGRVIRHREDYGAIFLCDHRFKNTDVRAQLPSWVRPYVRMDN-FGTVVRDAAQFFRVAQKLRPVP 757          
BLAST of RTEL1 vs. Ensembl Cavefish
Match: brip1 (BRCA1 interacting protein C-terminal helicase 1 [Source:ZFIN;Acc:ZDB-GENE-081107-11])

HSP 1 Score: 247.284 bits (630), Expect = 4.445e-67
Identity = 189/671 (28.17%), Postives = 315/671 (46.94%), Query Frame = 2
Query:  407 VVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTR---KCFFYNQFEKAKEILSSE-----TKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTD---------AIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWG---SNKNQAVNGDKNRV--LSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQD--KTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRF--QLPLWLQSNIVISNHFGDAI 2341
             VPKI + +RTH Q++Q    LKRT Y    + +++SR+  C++P+VM   +   +   CK  ++ +    C FY+   K +E  S +      +  DIE+L+ +G K   C Y+ +RE+   A I F PYNYLLD  IR    INL+G IV+ DEAHNIE    +SAS  L    +    EE++ L    Y+I+ ++         ++++     S S    D      +     +LE  FH          G+T      F LL +         H   +LEK    IG+ +    T          Q  +K++F   +  EF    N   + +  YRV +Q++ I ++ ++     G     + +     K  V  LSFWC+      + L         +  G ++   +L     I                + V     G  G  L +++   E  ++ + +G  +L + + + RG+L   PSY ++ K  +RW +  ++  + + K +I EP+   K+ F   ++ +Y       S  G++L++V RGK+SEGLD +D   R V+ VG+P+P++ D ++ LKM + D   K       GR WY+ QAYRA+NQ++GR IRH  D+GA+ L D+RF +  +++   L  W++  +    +F  A+
Sbjct:  259 TVPKIFFGTRTHKQITQIARELKRTLYSTVPMTILSSRDHTCVHPEVMPHANRNER---CKELLEAKNGLSCRFYHNVHKMREQSSLQWVHGLHQAWDIEELVRLGTKLRSCAYYAARELMQEACIVFCPYNYLLDPLIRESMEINLQGQIVVLDEAHNIEDCARESASFTLNQAQLLQAREEIESL--VSYNIRRSNHEPLLAFCCSLLNWVQESSGSLRERDYESACKVWTGREVLEI-FHGF--------GITAAT---FPLLQK---------HLEAVLEK-EERIGLVNGREDTVQVPTIASSTQSVLKSLF---MVLEFLFRQNC--RFADDYRVALQQSYIWSTQQDAPDAQGFFARPQRRRQTRTKTMVHTLSFWCLNPAVVSERL-----HIFFMHLGIMFSSTSLTHCFWITL--------CCFTPGVWVGTVGMGPQGRRLCATFQHTETFAFQDEVGALLLKVCQTVSRGVLCFLPSYKLLDKLRDRWMNTGLWEKLEECKAVITEPRGGAKSDFDELLQTYYEAIRQSGSRDGALLIAVCRGKVSEGLDFTDDNARAVVTVGIPFPNIKDLQVELKMKYNDQHSKSRGLLPGGR-WYEIQAYRALNQALGRCIRHKNDWGALILVDDRFRSNPNKYITGLSKWVRQLVRHHENFTSAM 883          

HSP 2 Score: 66.6254 bits (161), Expect = 1.252e-10
Identity = 28/56 (50.00%), Postives = 39/56 (69.64%), Query Frame = 2
Query:  119 NICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQ 286
             I GV I+FP + Y  Q+  M  ++  L  G++ +LESPTG+GK+L LLC+ALAWQ
Sbjct:    9 TIGGVKINFPCKAYPSQLAMMNSIVRGLNHGQHCLLESPTGSGKSLALLCSALAWQ 64          
BLAST of RTEL1 vs. Ensembl Cavefish
Match: ercc2 (ERCC excision repair 2, TFIIH core complex helicase subunit [Source:NCBI gene;Acc:103044920])

HSP 1 Score: 236.884 bits (603), Expect = 2.763e-65
Identity = 209/776 (26.93%), Postives = 348/776 (44.85%), Query Frame = 2
Query:  116 INICGVSIDFPFEP-YACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKR-TQYCDRKVG--------MIASREQLCINPKVMNLESNTAKIYGCKSRVKTR------------KCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINL-KGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSAC---YRVFIQENEIATSNRNNKINWGSNKNQAVNG-------------DK-----NRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNI 2311
            +NI G+ + FP++  Y  Q  YM ++  +L    + +LE P+GTGKT+ LL   +A+Q                             K   L ++K+      IY SRT  ++ + +  L++  ++  ++ G         ++SR+ LCI+P+V +L         C S   +              C FY +F+     +   + I +++DL   G+KK  CPY+L+R     A+I    Y+YLLD KI  L +  L K ++V+FDEAHNI+ VC DS SV +T   +  C   +  L       Q+T   I E D     +E   L +   LK+     E++ +       +N  L  EV     L      +     HF+  L++   ++    +  L  H +   E   +F+K ++      E   ID   K L  C    R  ++  EIA     + I   S+    V+              DK     N VL F CM     +K +     +S+++TSGTL P++     +D +       +  +    +   +  +G D   ++S + TRE  +   + GN +L +S I+P G++  F SY  M   +  W    I  ++ ++K + +E  D  + ++A+E++     +    +G+ILLSVARGK+SEG+D   H GR VI+ G+PY       ++ ++ +L D     +F I    +    A R   Q +GR IR   D+G +   D+R+A AD R +LP W+Q +I
Sbjct:    3 LNIEGLLVYFPYDYIYPEQYSYMLELKRTLDAKGHGVLEMPSGTGKTISLLSLIVAYQ-----------------------------KAYPLEVTKL------IYCSRTVPEIEKVVEELRKLMEFYTKETGEKNNFLALALSSRKNLCIHPEVSSLRFGKEVDGKCHSLTASYIRAQHHSNPSQPVCRFYEEFDAVGRQVPIPSGIYNLDDLKDFGRKKGWCPYYLARYSILHANIVVYSYHYLLDPKIADLVSKELAKKSVVVFDEAHNIDNVCIDSMSVNITRRTLDRCQTNVDTL-------QNTIQRIKETDAAKLREEYRRLVE--GLKEANVARETDIYL------SNPVLPDEV-----LQEAIPGSIRTAEHFVGFLKRFLEYL----KARLRIHHVVQ-ESSPQFLKDIY------EKVCIDR--KPLRFCAERLRSLLRTLEIADIADFSPITLISHFATLVSTYSKGFTIIIEPFEDKTPTIANPVLHFSCMDPSIAIKPVFE-RFQSVVITSGTLSPLDIYPRILDFRPVTMASFTMTLARTCLCPLIVGRGNDQVAMSSKFETREDFAVIRNYGNLLLEMSAIVPDGIVAFFTSYVYMENIVASWYEQGILENIQRNKLIFIETPDAAETSMALEKYQEACEN---GRGAILLSVARGKVSEGIDFVHHFGRAVIMFGVPYVYTQSRILKARLEYLRD-----QFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMIFADKRYARADKRGKLPRWIQEHI 701          
BLAST of RTEL1 vs. Ensembl Cavefish
Match: ercc2 (ERCC excision repair 2, TFIIH core complex helicase subunit [Source:NCBI gene;Acc:103044920])

HSP 1 Score: 225.713 bits (574), Expect = 8.736e-62
Identity = 201/754 (26.66%), Postives = 335/754 (44.43%), Query Frame = 2
Query:  179 MEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKR-TQYCDRKVG--------MIASREQLCINPKVMNLESNTAKIYGCKSRVKTR------------KCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINL-KGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSAC---YRVFIQENEIATSNRNNKINWGSNKNQAVNG-------------DK-----NRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNI 2311
            M ++  +L    + +LE P+GTGKT+ LL   +A+Q                             K   L ++K+      IY SRT  ++ + +  L++  ++  ++ G         ++SR+ LCI+P+V +L         C S   +              C FY +F+     +   + I +++DL   G+KK  CPY+L+R     A+I    Y+YLLD KI  L +  L K ++V+FDEAHNI+ VC DS SV +T   +  C   +  L       Q+T   I E D     +E   L +   LK+     E++ +       +N  L  EV     L      +     HF+  L++   ++    +  L  H +   E   +F+K ++      E   ID   K L  C    R  ++  EIA     + I   S+    V+              DK     N VL F CM     +K +     +S+++TSGTL P++     +D +       +  +    +   +  +G D   ++S + TRE  +   + GN +L +S I+P G++  F SY  M   +  W    I  ++ ++K + +E  D  + ++A+E++     +    +G+ILLSVARGK+SEG+D   H GR VI+ G+PY       ++ ++ +L D     +F I    +    A R   Q +GR IR   D+G +   D+R+A AD R +LP W+Q +I
Sbjct:    1 MLELKRTLDAKGHGVLEMPSGTGKTISLLSLIVAYQ-----------------------------KAYPLEVTKL------IYCSRTVPEIEKVVEELRKLMEFYTKETGEKNNFLALALSSRKNLCIHPEVSSLRFGKEVDGKCHSLTASYIRAQHHSNPSQPVCRFYEEFDAVGRQVPIPSGIYNLDDLKDFGRKKGWCPYYLARYSILHANIVVYSYHYLLDPKIADLVSKELAKKSVVVFDEAHNIDNVCIDSMSVNITRRTLDRCQTNVDTL-------QNTIQRIKETDAAKLREEYRRLVE--GLKEANVARETDIYL------SNPVLPDEV-----LQEAIPGSIRTAEHFVGFLKRFLEYL----KARLRIHHVVQ-ESSPQFLKDIY------EKVCIDR--KPLRFCAERLRSLLRTLEIADIADFSPITLISHFATLVSTYSKGFTIIIEPFEDKTPTIANPVLHFSCMDPSIAIKPVFE-RFQSVVITSGTLSPLDIYPRILDFRPVTMASFTMTLARTCLCPLIVGRGNDQVAMSSKFETREDFAVIRNYGNLLLEMSAIVPDGIVAFFTSYVYMENIVASWYEQGILENIQRNKLIFIETPDAAETSMALEKYQEACEN---GRGAILLSVARGKVSEGIDFVHHFGRAVIMFGVPYVYTQSRILKARLEYLRD-----QFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMIFADKRYARADKRGKLPRWIQEHI 677          
BLAST of RTEL1 vs. Ensembl Sea Lamprey
Match: RTEL1-TNFRSF6B (RTEL1-TNFRSF6B readthrough (NMD candidate) [Source:HGNC Symbol;Acc:HGNC:44095])

HSP 1 Score: 287.73 bits (735), Expect = 3.043e-88
Identity = 161/378 (42.59%), Postives = 228/378 (60.32%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDH-VKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLNIS---KINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEI-LSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIE------ELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLE 1207
            MP++ I G+ + FPF PY CQ  YM +VI+ L  GKN ILESPTGTGKTLCLLCA LAW++H V +     E +         N + +  ++++  ++    +  +PKIIYSSRTHSQLSQ +N LK   Y  R V ++ SREQLCI+P V+  ESN AK++ C+++  +R CF+YN  E    + L+    I D+E+L+  GKK  VCPYF+++E+   ADI FMPYNYLLD+K RR ++I+L G IVIFDEAHN+E++CE++AS  LT   +AS I+      ++KV  E +  + STD    +  +      I D+  I   KQ L  LE E   ++L    +  +T + + LF+L  R G         +D LE
Sbjct:    1 MPVLTIGGIPVSFPFTPYKCQEDYMAQVIDCLNLGKNGILESPTGTGKTLCLLCATLAWREHQVGQHVRQREQQ---------NSWGDDGREAEAAVTYPGGVGNIPKIIYSSRTHSQLSQAMNELKNASYKPR-VCVLGSREQLCIHPDVVKQESNHAKVHLCRAKTTSRSCFYYNNVEGECAVHLTPTPGIMDVEELVKKGKKHQVCPYFMTQELKHDADIIFMPYNYLLDTKSRRAHSIDLSGKIVIFDEAHNVERLCENAASFDLTPFELASSIDAVSHFLQMKVKEEGL--LGSTDKFNGDGSSTGMDVSIEDVANI---KQLLLNLEREIDLVELPRGGS--ITKQGSFLFELFERAGIGSQIMKTLMDGLE 361          
BLAST of RTEL1 vs. Ensembl Sea Lamprey
Match: RTEL1-TNFRSF6B (RTEL1-TNFRSF6B readthrough (NMD candidate) [Source:HGNC Symbol;Acc:HGNC:44095])

HSP 1 Score: 286.574 bits (732), Expect = 7.292e-88
Identity = 161/377 (42.71%), Postives = 228/377 (60.48%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDH-VKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLNIS---KINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIE------ELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLE 1207
            MP++ I G+ + FPF PY CQ  YM +VI+ L  GKN ILESPTGTGKTLCLLCA LAW++H V +     E +         N + +  ++++  ++    +  +PKIIYSSRTHSQLSQ +N LK   Y  R V ++ SREQLCI+P V+  ESN AK++ C+++  +R CF+YN  E+ K    +   I D+E+L+  GKK  VCPYF+++E+   ADI FMPYNYLLD+K RR ++I+L G IVIFDEAHN+E++CE++AS  LT   +AS I+      ++KV  E +  + STD    +  +      I D+  I   KQ L  LE E   ++L    +  +T + + LF+L  R G         +D LE
Sbjct:    1 MPVLTIGGIPVSFPFTPYKCQEDYMAQVIDCLNLGKNGILESPTGTGKTLCLLCATLAWREHQVGQHVRQREQQ---------NSWGDDGREAEAAVTYPGGVGNIPKIIYSSRTHSQLSQAMNELKNASYKPR-VCVLGSREQLCIHPDVVKQESNHAKVHLCRAKTTSRSCFYYNNVEEKKTDFIA--GIMDVEELVKKGKKHQVCPYFMTQELKHDADIIFMPYNYLLDTKSRRAHSIDLSGKIVIFDEAHNVERLCENAASFDLTPFELASSIDAVSHFLQMKVKEEGL--LGSTDKFNGDGSSTGMDVSIEDVANI---KQLLLNLEREIDLVELPRGGS--ITKQGSFLFELFERAGIGSQIMKTLMDGLE 358          
BLAST of RTEL1 vs. Ensembl Sea Lamprey
Match: RTEL1-TNFRSF6B (RTEL1-TNFRSF6B readthrough (NMD candidate) [Source:HGNC Symbol;Acc:HGNC:44095])

HSP 1 Score: 271.937 bits (694), Expect = 6.314e-83
Identity = 148/340 (43.53%), Postives = 207/340 (60.88%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDH-VKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYG------CKSRVKTRKCFFYNQFEKAKEILSSET---KIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDL 1096
            MP++ I G+ + FPF PY CQ  YM +VI+ L  GKN ILESPTGTGKTLCLLCA LAW++H V +     E +     NS     W+   ++      +  +PKIIYSSRTHSQLSQ +N LK   Y  R V ++ SREQLCI+P V+  ESN AK++       C+++  +R CF+YN  E    + +S+    +I D+E+L+  GKK  VCPYF+++E+   ADI FMPYNYLLD+K RR ++I+L G IVIFDEAHN+E++CE++AS  LT   +AS I+    +  F+     T  ++ +   E           + ++KQ L  LE E   ++L
Sbjct:    1 MPVLTIGGIPVSFPFTPYKCQEDYMAQVIDCLNLGKNGILESPTGTGKTLCLLCATLAWREHQVGQHVRQREQQ-----NSCTAISWSPRNQTLPVTGGVGNIPKIIYSSRTHSQLSQAMNELKNASYKPR-VCVLGSREQLCIHPDVVKQESNHAKVWNNRLVHLCRAKTTSRSCFYYNNVEVYCSLRASQRLAGRIMDVEELVKKGKKHQVCPYFMTQELKHDADIIFMPYNYLLDTKSRRAHSIDLSGKIVIFDEAHNVERLCENAASFDLTPFELASSID---AVSHFLQMKSRTQTVLHDVSIED----------VANIKQLLLNLEREIDLVEL 321          
BLAST of RTEL1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009331.1 (pep scaffold:Pmarinus_7.0:GL478127:7852:42501:1 gene:ENSPMAG00000008437.1 transcript:ENSPMAT00000009331.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 246.899 bits (629), Expect = 1.327e-70
Identity = 156/489 (31.90%), Postives = 251/489 (51.33%), Query Frame = 2
Query: 1607 FEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDD-------RLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNITIKYPPP-------GLGCCESISNVPIEIQNQESSTKPSRIKSRTNISAQYSS--KVVSFATSLKDGSQDFAKILESYANTPPIKKPESSLTSTSLMDIL----KRAENHVTEIEILPVKRTFNETVCEVDDPEKNTRKVKKYKLVALKGQEK------VKESNEYSFIIKRLFNEDVQGFISYKTVIEDFKKNTNVDTLFAGLNSLLCEKDQP-GLVRDFYKFIQP 2992
            F ++L N HVI+  Q+ V +  KG D   LNS+Y  R   +Y +SLG +I+NL++IIP GLLV FPSY +M  C++ W++  + + + + K + VEP+ K  FT A+  FY K +DP  +  +   +V RGK+SEGLD +D  GR VI+ GLP+P  MDP I+LKM FLD+        ++    G+ G+ WY QQA RAVNQ+IGRVIRH  D+GAI L D RF++A +  QLP W++ ++     FG  +R    FFR  T   P P       G   C           + +++      K+R  + A   S  ++ +       G    A++   +   P   +P  +     L+D L    +R  N V+ +     +   ++ +  +DD ++ +   KK  +V    QE+       + S  Y   ++R  +++     ++ + + ++K+  ++  LF  L  +  E      L+R FY F++P
Sbjct:    1 FPIKLENPHVIDKHQVWVGIVEKGPDSVQLNSAYRNRSCPAYMSSLGKTIVNLARIIPNGLLVFFPSYTVMDMCLQHWKNEGLSSKIEEIKPMFVEPKQKGLFTEAINGFYDKINDPRCSAAA-FFAVCRGKVSEGLDFADANGRAVIITGLPFPPQMDPWIKLKMQFLDEMKAKRSTEMQCEFVGLSGQEWYTQQASRAVNQAIGRVIRHRHDYGAIILCDHRFSSASAVAQLPSWMRPSVKAYPEFGAVVRELSQFFRTATKMLPAPQRKVSCRGQVACGEADGAGCSSSSLQANACGDLRKARA-VDAHVPSLRRLAADPGDYHAGVSGLARLCVEF--EPEDGRP--ACRPAGLLDALEFSERRERNGVSHLPGEEQQTLRHDKI--LDDEQRGS---KKKMVVVSNHQERAHAGGVAERSRAYIQDVRRTLSQE--NHANFCSAMHEYKRMDDLQLLFQKLGPIFTEDPMKYRLLRQFYIFVRP 476          
BLAST of RTEL1 vs. Ensembl Sea Lamprey
Match: ercc2 (excision repair cross-complementation group 2 [Source:ZFIN;Acc:ZDB-GENE-040426-997])

HSP 1 Score: 208.379 bits (529), Expect = 1.460e-56
Identity = 203/772 (26.30%), Postives = 337/772 (43.65%), Query Frame = 2
Query:  215 NAILESPTGTGKTLCLLCAALAWQDHVKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKR-TQYCDRKVG--------MIASREQLCINPKVMNLESNTAKIYGCKS----RVKTRK--------CFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSR-EMFDSADITFMPYNYLLDSKIRRLYNINL-KGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSAC---YRVFIQENEIATSNRNNKI----NWGSNKNQAVNG---------DK-----NRVLSFWCMTAGRTMKSLAGCEVR-SIILTSGTLYPIETLKLD-MDIKFEVELRNSHVINA------DQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISN---HFGDAIRNTCNFFR 2365
            + +LE P+GTGKT+ LL   +A+Q                        + N+V+K             ++Y SRT  ++ + I  +K+   Y ++            ++SR+ LCI+P+V  L         C S     V+ R         C FY  F      +     I  ++DL   G++K  CPYFL+R      A++    Y+YLLD KI  L +  + K ++V+FDEAHNI+ VC DS SV +T   +  C   ++ L       Q+T   I E D     +E   L +   L+      E++ H       AN  L  EV    Q       N  N  HF+  L++   ++      T   H +   E    F+K        E +D I    K L  C    R  ++  EIA     + +    N+ +  +   NG         DK     N +L F   +  + +      + R S+ +  GT   +    LD ++ +F   LR    + A        + + +  +G D   ++S + TRE I+   + GN +L ++ ++P G++  F SY  M   +  W    I  ++ ++K + +E QD  + ++A+E+++    +    +G++LLSVARGK+SEG+D   H GR VI+ G+PY       ++ ++ FL D      + I    +    A R   Q +GR IR   D+G +   D+R++ AD R +LP W+Q +I  +N      +A++ T +F R
Sbjct:    3 HGVLEMPSGTGKTVSLLALIVAYQ----------------------RAFPNEVQK-------------LVYCSRTVPEIEKVIEEMKKLVAYYEKHTKEPMKFLALSLSSRKNLCIHPEVSALRFGKEVDGRCHSLTASYVRNRHSSDGSVPVCSFYEDFNTNGREVPMPPGIYSLDDLKEYGRQKHWCPYFLARYSQIMHANVVVYSYHYLLDPKIADLVSKEMSKKSVVVFDEAHNIDNVCIDSMSVNITRRTLDRCSTNIETL-------QTTIQKIRETDATKLKEEYRRLVE--GLRDASVARETDVHL------ANPVLPDEV---LQDAEAVPGNSRNAEHFVSFLKRFVEYLKSRLRVT---HVLS--ESTPAFLK--------ETYDRICIDRKPLRFCSERLRSLLRTLEIADIADFSPLTLVCNFATLVSTYTNGFTLIIEPFEDKTPTILNPILRFRRHSKNQKLSVHMVNDTRASVNVPCGTRALLNRFPLDKVNTRF-TALRCITGVLALTFSPNRGLAMKIVARGNDQVTMSSKFETREDIAVIRNYGNLLLEMTCVVPDGVVCFFTSYHYMESIVAAWYEQGILENIQRNKLIFIETQDGAETSVALEKYHEACEN---GRGAVLLSVARGKVSEGIDFVHHYGRAVIMFGIPYVYTQSRILKARLEFLRDH-----YQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGVMVFADKRYSRADKRGKLPRWIQEHITDANLNLTIDEALQVTKHFLR 699          
BLAST of RTEL1 vs. Ensembl Yeast
Match: RAD3 (5' to 3' DNA helicase; involved in nucleotide excision repair and transcription; subunit of RNA polII initiation factor TFIIH and of Nucleotide Excision Repair Factor 3 (NEF3); homolog of human XPD protein; mutant has aneuploidy tolerance; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000000973])

HSP 1 Score: 223.787 bits (569), Expect = 1.346e-61
Identity = 206/800 (25.75%), Postives = 347/800 (43.38%), Query Frame = 2
Query:  143 FPFEP-YACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKR-TQYCDRKVGM--------IASREQLCINPKVMNLESNTAKIYGCKSRVKTRK--------------CFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKI-RRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQ--LLNRCGFNHSNKLHFIDLLEKCSSFIG--------MSSEPTLTKHGIKGL------------EKVQEFMKTVFFDEIGEEFDSIDNLE--KKLSACYR----VFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQ---SNIVISNHFGDAIRNTCNFFRNIT 2374
            FP+   Y  Q  YM  + ++L  G N+ILE P+GTGKT+ LL   +A+Q H  +                                      KIIY SRT S++ + +  L+    Y  +++G         + SR+ LC++P+V      T     C+     +               C ++      +        +   E LL   ++K++CPYF+ R M    +I    Y+YLLD KI  R+ N   K +IVIFDEAHNI+ VC +S S+ LT+  +         L E I  ++       + D++   DE   L Q +H    L   E  F              VE  +L Q  L      N     HF+  L++   ++         +S  P      +K L            E++   ++T+   E+ E+F ++ ++     L + Y     + I+  EI              +N AV    N ++ F C+ A   +K +      S+I+TSGT+ P++     ++ K  ++   +  +     +  + TKG+D   ++S +  R   S   + G+ ++  +KI P G++V FPSY  M   +  W++  I + + +HK ++VE  D  + +LA+E +    S+    +G+ILLSVARGK+SEG+D     GR V+++G+P+       ++ ++ F+ +      + I    +    A R   Q +GRV+R   D+G + L D RF+    R QLP W+    S+  ++     AI NT  F R + 
Sbjct:   12 FPYPKIYPEQYNYMCDIKKTLDVGGNSILEMPSGTGKTVSLLSLTIAYQMHYPEHR------------------------------------KIIYCSRTMSEIEKALVELENLMDYRTKELGYQEDFRGLGLTSRKNLCLHPEVSKERKGTVVDEKCRRMTNGQAKRKLEEDPEANVELCEYHENLYNIEVEDYLPKGVFSFEKLLKYCEEKTLCPYFIVRRMISLCNIIIYSYHYLLDPKIAERVSNEVSKDSIVIFDEAHNIDNVCIESLSLDLTTDALRRATRGANALDERISEVR-------KVDSQKLQDEYEKLVQGLHSADILTDQEEPF--------------VETPVLPQDLLTEAIPGNIRRAEHFVSFLKRLIEYLKTRMKVLHVISETPKSFLQHLKQLTFIERKPLRFCSERLSLLVRTLEVTEV-EDFTALKDIATFATLISTYEEGFLLIIEPYEI--------------ENAAV---PNPIMRFTCLDASIAIKPVFE-RFSSVIITSGTISPLDMYPRMLNFKTVLQKSYAMTLAKKSFLPMIITKGSDQVAISSRFEIRNDPSIVRNYGSMLVEFAKITPDGMVVFFPSYLYMESIVSMWQTMGILDEVWKHKLILVETPDAQETSLALETYRKACSN---GRGAILLSVARGKVSEGIDFDHQYGRTVLMIGIPFQYTESRILKARLEFMRE-----NYRIRENDFLSFDAMRHAAQCLGRVLRGKDDYGVMVLADRRFSR--KRSQLPKWIAQGLSDADLNLSTDMAISNTKQFLRTMA 725          
BLAST of RTEL1 vs. Ensembl Yeast
Match: CHL1 (Probable DNA helicase; involved in sister-chromatid cohesion and genome integrity and interstrand cross-link repair; interacts with ECO1 and CTF18; mutants are defective in silencing, rDNA recombination, aging and the heat shock response; FANCJ-like helicase family member; mutations in the human homolog, DDX11/ChLR1, cause Warsaw breakage syndrome [Source:SGD;Acc:S000005929])

HSP 1 Score: 110.153 bits (274), Expect = 6.035e-25
Identity = 69/187 (36.90%), Postives = 101/187 (54.01%), Query Frame = 2
Query:  416 KIIYSSRTHSQLSQCINALK--------RTQYCDRKVGMI--ASREQLCINPKVMNLESNTAKIYGCKS-RVKTRKCFFY---NQFEKAKEILSSE----TKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASC 922
            KI Y+SRT+SQL Q  + L+        R +  D KV  +  AS++QLCINPKVM  ++  A    C   R     C FY   N++    + L+      ++I DIEDL+ +GK   +CPY+ SRE    A++  +PY YLL    R    INL+ +IVI DEAHN+ +      S Q++  ++ +C
Sbjct:  232 KIYYASRTYSQLGQFTSQLRLPSFPSSFRDKVPDEKVKYLPLASKKQLCINPKVMKWKTLEAINDACADLRHSKEGCIFYQNTNEWRHCPDTLALRDMIFSEIQDIEDLVPLGKSLGICPYYASREALPIAEVVTLPYQYLLSESTRSSLQINLENSIVIIDEAHNLIETINSIYSSQISLEDLKNC 418          

HSP 2 Score: 108.997 bits (271), Expect = 1.449e-24
Identity = 81/315 (25.71%), Postives = 153/315 (48.57%), Query Frame = 2
Query: 1463 DKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVE----LRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNS-LGNSILNLSKIIPR--GLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLS-NKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFG-------IDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFF 2362
            +KN  + +  +   +  +S+   + + ++L  GT+ P+     ++  +   E    L  +HVI  + +   +  +      L  ++  R   S  N+ L    ++LSK +P+  G++  FPSY  +   I+ W+  D + ++   +++  E +D        +   S  SD ++  +GS+LL++  GK+SEG++  D   R V++VGLP+P++    + +K   L    K+ K G          + + +    +AVNQS+GR IRH+ D+  IYL D R+   + R +L  W+Q +I   +     I +T  FF
Sbjct:  553 EKNYSIKYMLLEPSKPFESILN-QAKCVVLAGGTMEPMSEFLSNLLPEVPSEDITTLSCNHVIPKENLQTYITNQPE----LEFTFEKRMSPSLVNNHLFQFFVDLSKAVPKKGGIVAFFPSYQYLAHVIQCWKQNDRFATLNNVRKIFYEAKDG-------DDILSGYSDSVAEGRGSLLLAIVGGKLSEGINFQDDLCRAVVMVGLPFPNIFSGELIVKRKHL--AAKIMKSGGTEEEASRATKEFMENICMKAVNQSVGRAIRHANDYANIYLLDVRYNRPNFRKKLSRWVQDSINSEHTTHQVISSTRKFF 853          

HSP 3 Score: 60.4622 bits (145), Expect = 1.229e-9
Identity = 27/47 (57.45%), Postives = 33/47 (70.21%), Query Frame = 2
Query:  146 PFEPYACQIIYMEKVIESLKDGKN-AILESPTGTGKTLCLLCAALAW 283
            P++PY  Q+  ME V   L +GK  AILESPTGTGKTL L+CA + W
Sbjct:   13 PYKPYDIQVQLMETVYRVLSEGKKIAILESPTGTGKTLSLICATMTW 59          
BLAST of RTEL1 vs. Ensembl Nematostella
Match: EDO39388 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA32])

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 372/1042 (35.70%), Postives = 550/1042 (52.78%), Query Frame = 2
Query:  113 LINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAW-QDHVKKVTTNSEDEILLHLNSNGNQ--YWNKVKKSQL--------NISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEAD-NESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNR-----------VLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKF---GIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNITIKY-----------------PPPGLGCC-----ESISNVPIEIQNQESSTKPSR--------IKSRTN-------ISAQYSSKVVSFATSLKDGSQDFAKILESYANTPPIKKPESSLTSTSLMDILKRAENHVTEIEILPVKRTFNETVCEVDDPEKNTRKVKKYKLVALKGQEKVKESNEYSFIIKRLFNEDVQGFISYKTVIEDFKKNTNVDTLFAGLNSLLCE-KDQPGLVRDFYKFIQ-PEFQARFAELCESVLGLD 3043
            ++ +  V +DFPF+PY CQ+ YMEKVIE L+  KNA+LESPTGTGKTLCLLCA LAW Q +V  +              +G Q    NK+ ++          N      +PKIIY+SRTHSQLSQ +  LK T Y  R V +I SREQLCIN  V+  +SN+AK++ C+++V  R C FYN  E  K   +  T+I DIEDL+ +G+K  VCPY+++RE+  SADI FMPYNYLLD K R+ +N+++ G+IV+FDEAHN+E+VCE++ S  LTS +IASC+E++ +  E++ + +      D+ D  E  +D  P+  ++  LK     LE E   I L ++ +   +   + +F+LL   G   + K   ++ LEK +         TL  +G++G    + F    F D +   F+  D   K  ++ ++V +Q    +   +     W S    +  G  +            ++ +WC + G  MK L    V S+ILTSGTL P+ +   +M I F + L N HVI   QMMV+V TK  DG  LNSSY  R    Y   LGN+I N ++ IP GLLV FPSY +M KC+E W++  I+  + Q+K +  EP+ K  F   ME FY+K +DP  N G+   +V RGK+SEGLD SD  GR V++ GLP+P MMD +++LKMSFLD+  +  K    G+ GR WY+QQA RAVNQ++GRVIRH +DFGAI L D RF   D+  +LP W++  + I   FG   R    FFR   I                   P P          ES  +V +    +E   KPS         ++S+ +       ++ +Y +  +   T      +    +LES      +K  E S+ STS    L++  +      I+  K T N +      P+K  + VK     A +  +  K      +I+K   +   + + ++  V+ ++K+  ++D L +GL  L  + +    L   F  +I+ P+ + R  E  + + G D
Sbjct:    1 MVVVRKVDVDFPFKPYDCQVAYMEKVIECLQTRKNAVLESPTGTGKTLCLLCATLAWRQSYVANLQLQQRGLCAAKEEEDGFQKSLGNKLAEAASGTWDDSCSNKGSNFEIPKIIYASRTHSQLSQAVQELKATVYRPR-VSIIGSREQLCINSDVLKQDSNSAKVHMCRAKVTARTCHFYNNLEGNKSNPAFTTEILDIEDLVRLGQKHKVCPYYMARELKTSADIIFMPYNYLLDPKSRKAHNLDISGSIVVFDEAHNLEKVCEETVSFDLTSFDIASCVEDVLLCMEYVANAE------DDPDIGEGGTDIDPEDLKV--LKALFSKLEEEIDQIQLPSDGSK--SFPGDFMFELLGNVGIKPNTKDRVLETLEKIN---------TLLANGLRG----KHFALQKFTDALQIVFNKTDKGPKSGNS-FKVHVQVEPDSKKKQKGLDIWTSGSKLSKKGTSSLYFYSFFMRTMIMIHYWCFSPGHAMKDLMSQGVSSVILTSGTLSPLNSFTAEMQIPFPIRLENPHVIEKHQMMVAVVTKAPDGATLNSSYEFRSTPGYMTGLGNTIANFARTIPNGLLVFFPSYPVMNKCLEHWQNTGIWARLSQYKPMFAEPRGKGDFVQTMEDFYAKINDPSLN-GATFFAVCRGKVSEGLDFSDINGRAVVITGLPFPPMMDAKVKLKMSFLDEMSRKDKSAIKGLTGREWYRQQASRAVNQAVGRVIRHRQDFGAILLCDVRFTYPDALRELPSWVKPQVKIFKEFGHVQRELIQFFRKADIMVDKSAMKVRQPRDLEKSDPSPTSAVRTTEPEESRIDVFVPAMFREKPKKPSHRLSPPARAVRSQASSASGQARMTVEYETPTLRTPTLSAPPPRPQGNLLES------LKSSEGSMESTSNDSPLRKHSSPSLSDAIMRTKGTTNTS----HKPKKVFKIVKTKSESAEENSKAQKLEAAKMYIVKVKQSLSGENYKAFSRVLANYKQCNDLDQLISGLTLLFTQNRSLYPLFLGFSNYIRDPQDKKRLFEAYKEITGED 1006          
BLAST of RTEL1 vs. Ensembl Nematostella
Match: EDO46754 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNX6])

HSP 1 Score: 145.206 bits (365), Expect = 1.331e-35
Identity = 82/278 (29.50%), Postives = 144/278 (51.80%), Query Frame = 2
Query: 1469 NRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQ 2302
            N +L F CM A   +K +     +S+++TSGTL PI+     +D +       +  +    +   + ++G+D   + + +  RE ++   + GN +  +S ++P G++  F SY  M   +  W    I +++ ++K L +E  D  + +LA+   Y K  +  + +G+ILLSVARGK+SEG+D   H GR VI+ G+PY       ++ ++ +L +     +F I    +    A R   Q +GR IR   D+G +   D+RF+  D R +LP W+Q
Sbjct:  406 NPILHFSCMDASIAVKPVFD-RFQSVVITSGTLSPIDMYPKILDFRPVTMATFTMTLARTCLCPMIVSRGSDQVAMTTKFEMREDLAVIRNYGNLLTEMSAVVPDGIVCFFTSYLYMESVVSLWHDQGIISNIQKNKLLFIETTDAAETSLALHN-YQKACE--NGRGAILLSVARGKVSEGIDFDHHYGRAVIMFGIPYVYTQSRILKARLEYLRE-----QFNIRENDFLTFDAMRHAAQCVGRAIRGKTDYGIMVFADKRFSKVDKRGKLPKWIQ 674          

HSP 2 Score: 103.99 bits (258), Expect = 1.151e-22
Identity = 85/290 (29.31%), Postives = 136/290 (46.90%), Query Frame = 2
Query:  179 MEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKR-TQYCDRKVG--------MIASREQLCINPKVMNLESNTAKIYG-CKS------RVKTRK------CFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINL-KGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDA 979
            M ++  +L    + +LE P+GTGKT+ LL   +A+                             +K   L ++K+      IY SRT  ++ + +  LK+ T+Y + + G         ++SR+ LCI+P+V   E    K+ G C S      R+K ++      C FY  F+             +++DL   G+KK  CPYFL+R     A++    Y+Y+LD KI  L +  L K  +V+FDEAHNI+ VC DS SV ++   +      ++ L   I  I++TDA
Sbjct:    1 MLELKRTLDAKGHCLLEMPSGTGKTVSLLSLIVAY-----------------------------LKNKPLELTKL------IYCSRTVPEIEKVMEELKKLTEYYESETGEKPNILALALSSRKNLCIHPEVAG-EREGKKVDGKCLSMTASFVRLKHKEDSSVPVCNFYEDFDSLGRDEKMPPGSYNLDDLRQFGRKKGWCPYFLARRAIYHANVIVYSYHYMLDPKIADLVSKELDKKAVVVFDEAHNIDNVCIDSMSVTISRRTLDRSHANVESLASVIDRIKATDA 254          
BLAST of RTEL1 vs. Ensembl Medaka
Match: ercc2 (ERCC excision repair 2, TFIIH core complex helicase subunit [Source:NCBI gene;Acc:101163020])

HSP 1 Score: 239.58 bits (610), Expect = 2.851e-66
Identity = 204/773 (26.39%), Postives = 351/773 (45.41%), Query Frame = 2
Query:  116 INICGVSIDFPFEP-YACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKR-TQYCDRKVG--------MIASREQLCINPKVMNLESNTAKIYGCKS----RVKTRK--------CFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINL-KGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVN-------------GDK-----NRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNI 2311
            +NI G+ + FP++  Y  Q  YM ++  +L    + +LE P+GTGKT+ LL   +A+Q                             K   L+++K+      IY SRT  ++ + +  L++  ++  ++ G         ++SR+ LCI+P+V +L         C S     ++ ++        C FY +F+     +     I +++DL   G++K  CPY+L+R     A+I    Y+YLLD KI  L +  L K ++V+FDEAHNI+ VC DS SV +T   +  C   ++ L       Q T   I + D     +E   L +   LK+     E++ +       AN  L  E+     L      +     HF+  L +   F+          H ++  E   +F+K +F +++  +   +    ++L +  R      EIA     + +   SN    V+              D+     N VL F CM     +K +     +S+++TSGTL P++     +D +       +  +    +   +  +G D   L+S + TRE  +   + GN +L +S I+P G++  F SY  M   +  W    I  ++ ++K + +E QD  + ++A+E++     +    +G+ILLSVARGK+SEG+D   H GR VI+ G+PY       ++ ++ +L D     +F I    +    A R   Q +GR IR   D+G +   D+R+A AD R +LP W+Q +I
Sbjct:    3 LNIEGLLVYFPYDYIYPEQYSYMLELKRTLDAKGHGVLEMPSGTGKTISLLSLIVAYQ-----------------------------KAFPLDVTKL------IYCSRTVPEIEKVVEELRKLMEFYAKETGEVNNFLALALSSRKNLCIHPEVSSLRFGKEVDGKCHSLTASYIRAQRHSNPDQPVCRFYEEFDAVGRQVPLPAGIYNLDDLKDFGRRKGWCPYYLARYSILHANIVVYSYHYLLDPKIADLVSKELAKKSVVVFDEAHNIDNVCIDSMSVNITRRTLDRCQSNVETL-------QHTIQKIKDTDAAKLREEYRRLVE--GLKEANVARETDVYL------ANPVLPDEI-----LQEAVPGSIRTAEHFLGFLRR---FLEYLKSRLRVHHVVQ--ESAPQFLKDIF-EKVCIDRKPLRFCAERLQSLLRTL----EIADIADFSAVTLISNFATLVSTYSLGFTIIIEPFDDRTPTIANPVLHFSCMDPSIAIKPVFQ-RFQSVVITSGTLSPLDIYPKILDFRPVTMASFTMTLARTCLCPLIVGRGNDQVALSSKFETREDFAVIRNYGNLLLEMSAIVPDGIVAFFTSYVYMENIVASWYEQGILENIQRNKLIFIETQDAAETSMALEKYQEACEN---GRGAILLSVARGKVSEGIDFVHHFGRAVIMFGVPYVYTQSRILKARLEYLRD-----QFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMIFADKRYARADKRGKLPRWIQEHI 701          
BLAST of RTEL1 vs. Ensembl Medaka
Match: ercc2 (ERCC excision repair 2, TFIIH core complex helicase subunit [Source:NCBI gene;Acc:101163020])

HSP 1 Score: 239.58 bits (610), Expect = 2.981e-66
Identity = 204/773 (26.39%), Postives = 351/773 (45.41%), Query Frame = 2
Query:  116 INICGVSIDFPFEP-YACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKR-TQYCDRKVG--------MIASREQLCINPKVMNLESNTAKIYGCKS----RVKTRK--------CFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINL-KGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVN-------------GDK-----NRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNI 2311
            +NI G+ + FP++  Y  Q  YM ++  +L    + +LE P+GTGKT+ LL   +A+Q                             K   L+++K+      IY SRT  ++ + +  L++  ++  ++ G         ++SR+ LCI+P+V +L         C S     ++ ++        C FY +F+     +     I +++DL   G++K  CPY+L+R     A+I    Y+YLLD KI  L +  L K ++V+FDEAHNI+ VC DS SV +T   +  C   ++ L       Q T   I + D     +E   L +   LK+     E++ +       AN  L  E+     L      +     HF+  L +   F+          H ++  E   +F+K +F +++  +   +    ++L +  R      EIA     + +   SN    V+              D+     N VL F CM     +K +     +S+++TSGTL P++     +D +       +  +    +   +  +G D   L+S + TRE  +   + GN +L +S I+P G++  F SY  M   +  W    I  ++ ++K + +E QD  + ++A+E++     +    +G+ILLSVARGK+SEG+D   H GR VI+ G+PY       ++ ++ +L D     +F I    +    A R   Q +GR IR   D+G +   D+R+A AD R +LP W+Q +I
Sbjct:    3 LNIEGLLVYFPYDYIYPEQYSYMLELKRTLDAKGHGVLEMPSGTGKTISLLSLIVAYQ-----------------------------KAFPLDVTKL------IYCSRTVPEIEKVVEELRKLMEFYAKETGEVNNFLALALSSRKNLCIHPEVSSLRFGKEVDGKCHSLTASYIRAQRHSNPDQPVCRFYEEFDAVGRQVPLPAGIYNLDDLKDFGRRKGWCPYYLARYSILHANIVVYSYHYLLDPKIADLVSKELAKKSVVVFDEAHNIDNVCIDSMSVNITRRTLDRCQSNVETL-------QHTIQKIKDTDAAKLREEYRRLVE--GLKEANVARETDVYL------ANPVLPDEI-----LQEAVPGSIRTAEHFLGFLRR---FLEYLKSRLRVHHVVQ--ESAPQFLKDIF-EKVCIDRKPLRFCAERLQSLLRTL----EIADIADFSAVTLISNFATLVSTYSLGFTIIIEPFDDRTPTIANPVLHFSCMDPSIAIKPVFQ-RFQSVVITSGTLSPLDIYPKILDFRPVTMASFTMTLARTCLCPLIVGRGNDQVALSSKFETREDFAVIRNYGNLLLEMSAIVPDGIVAFFTSYVYMENIVASWYEQGILENIQRNKLIFIETQDAAETSMALEKYQEACEN---GRGAILLSVARGKVSEGIDFVHHFGRAVIMFGVPYVYTQSRILKARLEYLRD-----QFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMIFADKRYARADKRGKLPRWIQEHI 701          
BLAST of RTEL1 vs. Ensembl Medaka
Match: ddx11 (DEAD/H-box helicase 11 [Source:NCBI gene;Acc:101163814])

HSP 1 Score: 210.69 bits (535), Expect = 8.897e-56
Identity = 179/707 (25.32%), Postives = 316/707 (44.70%), Query Frame = 2
Query:  410 VPKIIYSSRTHSQLSQCINALKRTQYC-DRKVGMIASREQLCINPKV-------------MNLESNTAKIYGCKSRVKTRK------CFF--YNQFEKAK-EILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLG-EFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLC-ILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEK--------------CSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSID-----NLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPI----ETLKLDMDIKFE--VELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFY------SKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFF 2362
            V KI Y SRTHSQL+Q ++ ++++ +  D  +  + SR+ LCIN +V             M ++ N  +    +   K ++      C F   +  ++ + E+L +   + DIE L+ +GK    CPY+ +R     A +  +PY  +L    RR   + LKG +VI DEAHN+               +  SCI   ++ G +   +        D   +  ++  +  + QI+   + L  +L  +        N  AG   E++ +   L +   ++ N        EK                S + + ++ TL K   +  E +  ++KT+  ++        D       EK LSA   + I+   +A +N N       ++   ++    + L      A    + L  C  RS+I+  GT+ P+    E L L   +  E  VE    HVI  + ++  V   G  G+ L+ ++ +R+     +  G  + N+  ++P G++  FPSY  +R+ +  WE+      +   K++  EP+   +    + +F       ++ S  L+  G++L SV  GK+SEG++ SD  GR V++VG+PYP++  P ++ KMS+LD  L   +    G+   +    +AVNQSIGR IRH  D+ ++ L D R++   +  +LP W++S       FG A      FF
Sbjct:  207 VTKIYYCSRTHSQLAQFVHEVQKSPFSKDISLVTLGSRQNLCINEEVRRLGSIQRINDRCMEMQKNKHEKQRPEDGAKRKRGPAKSVCPFNKASALQQMRDEVLGT---VYDIEQLIKVGKDIHSCPYYATRLAIPPAKLVVLPYQMVLHEATRRAAGVQLKGQVVIIDEAHNLS--------------DTLSCIHSSELNGSQLCRAYSQLTQYADRYKSRLKAKNLMYIKQILFAIERLVRVLGGKVGQNPQSQNTQAG--TEMHTINNFLFKAEIDNINWFKLQRYFEKSMISRKLSGFVEKYAGSGVTLHTQNTLNKEN-RRTEGLLNYLKTLKSNQNSASVPQPDLQESAEAEKVLSASPMMQIEGFFMALTNSNTDGRVLVHRQGTLSESSIKFL--LLNPAVHFAEVLKEC--RSVIIAGGTMQPVSDFKEELLLSAGVGQERIVEFACGHVIPPENILPIVMCSGPSGQELDFTFQSRDLPCMMDETGRILSNICNVVPGGVVCFFPSYEYLRRIMCHWEASGALTRLSNKKKIFQEPKKPNQVEHVLSEFSRCIQRCAQESSGLT--GALLFSVVGGKMSEGINFSDDLGRCVVMVGMPYPNIKSPELQEKMSYLDKHLPHSQGKSPGQALVENLCMKAVNQSIGRAIRHRGDYSSVVLCDRRYSRPATLSKLPAWIRSRTSTYATFGPAFAALRKFF 887          

HSP 2 Score: 60.8474 bits (146), Expect = 8.521e-9
Identity = 26/58 (44.83%), Postives = 38/58 (65.52%), Query Frame = 2
Query:  134 SIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAW-QDHVKKV 304
            +  FP++PY  Q  +M+ +  +L   K  I ESPTGTGK+L L+C AL+W +DH +K 
Sbjct:    7 TFPFPYQPYDIQEQFMQALYRALDQSKVGIFESPTGTGKSLSLICGALSWLRDHEEKT 64          
BLAST of RTEL1 vs. Ensembl Medaka
Match: brip1 (BRCA1 interacting protein C-terminal helicase 1 [Source:NCBI gene;Acc:101173242])

HSP 1 Score: 205.682 bits (522), Expect = 1.693e-53
Identity = 101/301 (33.55%), Postives = 174/301 (57.81%), Query Frame = 2
Query: 1475 VLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTK--FTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRF--QLPLWLQSNIVISNHFGDAIRNTCNFFR 2365
             LSFWC+        L+G  VRSI+LTSGTL P+ +   ++ +KF ++L  +HVIN  Q+ V     G  G+ L +++   E  ++ + +G+ +L++ K+I +G+L   PSY ++ K  +RW +  ++  + Q K +I EP+   K  F   ++ +Y          G++L++V RGK+SEGLD +D   R V+ +G+P+P++ D ++ LKM + D   K     + G  WY+ QAYRA+NQ++GR IRH  D+GA+ L D+R+    +++   L  W++  +     F +A+++   F R
Sbjct:  608 TLSFWCLNPAVAFSDLSG-SVRSIVLTSGTLSPMGSFSSELGVKFSIQLEANHVINKSQVWVGTVGAGPQGKKLCATFQHTETYAFQDEVGDLLLHICKVIAKGVLCFLPSYKLLDKLRDRWSNTGLWEKLEQQKTVITEPRGGAKGDFDELLQTYYDAIKCCDERDGALLIAVCRGKVSEGLDFTDDNARAVVTIGIPFPNIKDLQVELKMKYNDQHCKSRGL-LPGHRWYEIQAYRALNQALGRCIRHKNDWGALILVDDRYGNNPNKYITGLSKWVRQLVQHHYTFSNAMQSLKAFSR 906          

HSP 2 Score: 126.716 bits (317), Expect = 5.462e-29
Identity = 72/223 (32.29%), Postives = 115/223 (51.57%), Query Frame = 2
Query:  410 VPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSET-----KIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEEL-------------KVLGEFIYS----IQSTDAIIDEADNESRS 1012
            +PKI + +RTH Q++Q  + LKRT Y    + +++SR+  C+NP+V+   +   +          + C FY+  +K ++  + +      +  D+EDL+T+ K+   C Y+ +RE+   A I F PYNYLLD  IR    I+L G I++ DEAHNIE    +S S  L   ++ +C EEL             + L +F Y+    IQ    ++ E   ES S
Sbjct:  259 IPKIFFGTRTHKQITQIAHELKRTVYSSVHMTILSSRDHTCVNPEVVPHFNRNERCKDLLEAKNGKSCRFYHGVQKMRDHHTLQRVHGLHEAWDVEDLVTVAKRLRSCSYYAARELMQGASIIFCPYNYLLDPMIRESMEIDLAGQILVLDEAHNIEDCARESTSFTLDESSLKTCREELDSMVKNNIRRSQHEPLRDFCYALINWIQECQVLLSERGYESAS 481          

HSP 3 Score: 63.1586 bits (152), Expect = 1.928e-9
Identity = 27/56 (48.21%), Postives = 37/56 (66.07%), Query Frame = 2
Query:  119 NICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQ 286
             I GV I FP + Y  Q+  M  ++  L  G++ +LESPTG+GK+L LLC+ LAWQ
Sbjct:    9 TIGGVKIHFPCKAYPSQLSMMNSIVRGLNYGQHCLLESPTGSGKSLALLCSTLAWQ 64          
BLAST of RTEL1 vs. Ensembl Medaka
Match: brip1 (BRCA1 interacting protein C-terminal helicase 1 [Source:NCBI gene;Acc:101173242])

HSP 1 Score: 205.682 bits (522), Expect = 1.762e-53
Identity = 101/301 (33.55%), Postives = 174/301 (57.81%), Query Frame = 2
Query: 1475 VLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTK--FTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRF--QLPLWLQSNIVISNHFGDAIRNTCNFFR 2365
             LSFWC+        L+G  VRSI+LTSGTL P+ +   ++ +KF ++L  +HVIN  Q+ V     G  G+ L +++   E  ++ + +G+ +L++ K+I +G+L   PSY ++ K  +RW +  ++  + Q K +I EP+   K  F   ++ +Y          G++L++V RGK+SEGLD +D   R V+ +G+P+P++ D ++ LKM + D   K     + G  WY+ QAYRA+NQ++GR IRH  D+GA+ L D+R+    +++   L  W++  +     F +A+++   F R
Sbjct:  608 TLSFWCLNPAVAFSDLSG-SVRSIVLTSGTLSPMGSFSSELGVKFSIQLEANHVINKSQVWVGTVGAGPQGKKLCATFQHTETYAFQDEVGDLLLHICKVIAKGVLCFLPSYKLLDKLRDRWSNTGLWEKLEQQKTVITEPRGGAKGDFDELLQTYYDAIKCCDERDGALLIAVCRGKVSEGLDFTDDNARAVVTIGIPFPNIKDLQVELKMKYNDQHCKSRGL-LPGHRWYEIQAYRALNQALGRCIRHKNDWGALILVDDRYGNNPNKYITGLSKWVRQLVQHHYTFSNAMQSLKAFSR 906          

HSP 2 Score: 126.716 bits (317), Expect = 6.801e-29
Identity = 72/223 (32.29%), Postives = 115/223 (51.57%), Query Frame = 2
Query:  410 VPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSET-----KIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEEL-------------KVLGEFIYS----IQSTDAIIDEADNESRS 1012
            +PKI + +RTH Q++Q  + LKRT Y    + +++SR+  C+NP+V+   +   +          + C FY+  +K ++  + +      +  D+EDL+T+ K+   C Y+ +RE+   A I F PYNYLLD  IR    I+L G I++ DEAHNIE    +S S  L   ++ +C EEL             + L +F Y+    IQ    ++ E   ES S
Sbjct:  259 IPKIFFGTRTHKQITQIAHELKRTVYSSVHMTILSSRDHTCVNPEVVPHFNRNERCKDLLEAKNGKSCRFYHGVQKMRDHHTLQRVHGLHEAWDVEDLVTVAKRLRSCSYYAARELMQGASIIFCPYNYLLDPMIRESMEIDLAGQILVLDEAHNIEDCARESTSFTLDESSLKTCREELDSMVKNNIRRSQHEPLRDFCYALINWIQECQVLLSERGYESAS 481          

HSP 3 Score: 63.1586 bits (152), Expect = 1.884e-9
Identity = 27/56 (48.21%), Postives = 37/56 (66.07%), Query Frame = 2
Query:  119 NICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQ 286
             I GV I FP + Y  Q+  M  ++  L  G++ +LESPTG+GK+L LLC+ LAWQ
Sbjct:    9 TIGGVKIHFPCKAYPSQLSMMNSIVRGLNYGQHCLLESPTGSGKSLALLCSTLAWQ 64          
BLAST of RTEL1 vs. Planmine SMEST
Match: SMESG000064419.1 (SMESG000064419.1)

HSP 1 Score: 2184.07 bits (5658), Expect = 0.000e+0
Identity = 1057/1057 (100.00%), Postives = 1057/1057 (100.00%), Query Frame = 2
Query:  107 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNITIKYPPPGLGCCESISNVPIEIQNQESSTKPSRIKSRTNISAQYSSKVVSFATSLKDGSQDFAKILESYANTPPIKKPESSLTSTSLMDILKRAENHVTEIEILPVKRTFNETVCEVDDPEKNTRKVKKYKLVALKGQEKVKESNEYSFIIKRLFNEDVQGFISYKTVIEDFKKNTNVDTLFAGLNSLLCEKDQPGLVRDFYKFIQPEFQARFAELCESVLGLDCMEGKENVEIDPVVSRSNLLDCAYCLASPALIPLGAPCKHVCCFECWKIIIEGENATRICPKCSQPIRRRNLTRLNIS 3277
            MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNITIKYPPPGLGCCESISNVPIEIQNQESSTKPSRIKSRTNISAQYSSKVVSFATSLKDGSQDFAKILESYANTPPIKKPESSLTSTSLMDILKRAENHVTEIEILPVKRTFNETVCEVDDPEKNTRKVKKYKLVALKGQEKVKESNEYSFIIKRLFNEDVQGFISYKTVIEDFKKNTNVDTLFAGLNSLLCEKDQPGLVRDFYKFIQPEFQARFAELCESVLGLDCMEGKENVEIDPVVSRSNLLDCAYCLASPALIPLGAPCKHVCCFECWKIIIEGENATRICPKCSQPIRRRNLTRLNIS
Sbjct:    1 MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNITIKYPPPGLGCCESISNVPIEIQNQESSTKPSRIKSRTNISAQYSSKVVSFATSLKDGSQDFAKILESYANTPPIKKPESSLTSTSLMDILKRAENHVTEIEILPVKRTFNETVCEVDDPEKNTRKVKKYKLVALKGQEKVKESNEYSFIIKRLFNEDVQGFISYKTVIEDFKKNTNVDTLFAGLNSLLCEKDQPGLVRDFYKFIQPEFQARFAELCESVLGLDCMEGKENVEIDPVVSRSNLLDCAYCLASPALIPLGAPCKHVCCFECWKIIIEGENATRICPKCSQPIRRRNLTRLNIS 1057          
BLAST of RTEL1 vs. Planmine SMEST
Match: SMESG000064419.1 (SMESG000064419.1)

HSP 1 Score: 2133.22 bits (5526), Expect = 0.000e+0
Identity = 1033/1033 (100.00%), Postives = 1033/1033 (100.00%), Query Frame = 2
Query:  179 MEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNITIKYPPPGLGCCESISNVPIEIQNQESSTKPSRIKSRTNISAQYSSKVVSFATSLKDGSQDFAKILESYANTPPIKKPESSLTSTSLMDILKRAENHVTEIEILPVKRTFNETVCEVDDPEKNTRKVKKYKLVALKGQEKVKESNEYSFIIKRLFNEDVQGFISYKTVIEDFKKNTNVDTLFAGLNSLLCEKDQPGLVRDFYKFIQPEFQARFAELCESVLGLDCMEGKENVEIDPVVSRSNLLDCAYCLASPALIPLGAPCKHVCCFECWKIIIEGENATRICPKCSQPIRRRNLTRLNIS 3277
            MEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNITIKYPPPGLGCCESISNVPIEIQNQESSTKPSRIKSRTNISAQYSSKVVSFATSLKDGSQDFAKILESYANTPPIKKPESSLTSTSLMDILKRAENHVTEIEILPVKRTFNETVCEVDDPEKNTRKVKKYKLVALKGQEKVKESNEYSFIIKRLFNEDVQGFISYKTVIEDFKKNTNVDTLFAGLNSLLCEKDQPGLVRDFYKFIQPEFQARFAELCESVLGLDCMEGKENVEIDPVVSRSNLLDCAYCLASPALIPLGAPCKHVCCFECWKIIIEGENATRICPKCSQPIRRRNLTRLNIS
Sbjct:    1 MEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVFFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCNFFRNITIKYPPPGLGCCESISNVPIEIQNQESSTKPSRIKSRTNISAQYSSKVVSFATSLKDGSQDFAKILESYANTPPIKKPESSLTSTSLMDILKRAENHVTEIEILPVKRTFNETVCEVDDPEKNTRKVKKYKLVALKGQEKVKESNEYSFIIKRLFNEDVQGFISYKTVIEDFKKNTNVDTLFAGLNSLLCEKDQPGLVRDFYKFIQPEFQARFAELCESVLGLDCMEGKENVEIDPVVSRSNLLDCAYCLASPALIPLGAPCKHVCCFECWKIIIEGENATRICPKCSQPIRRRNLTRLNIS 1033          
BLAST of RTEL1 vs. Planmine SMEST
Match: SMESG000018012.1 (SMESG000018012.1)

HSP 1 Score: 325.479 bits (833), Expect = 1.791e-97
Identity = 220/736 (29.89%), Postives = 370/736 (50.27%), Query Frame = 2
Query:  131 VSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVM---NLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTV--FFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGS----NKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFG-IDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPL--WLQ 2302
            V + FP EPY  Q+  M ++I S+   +N ++E PTG+GKT+ LLC+ L W   +K+  +       L LNS  ++     K+            KI + +RTH Q+ Q I  LK++ Y + ++ +++ R   C+N +V+    ++ N      CK   K   C +    +   E         DIE +    KK  +CPYF  +    SADI F PYNY+L+  IR+   +NL+ NI+I DEAHNIE +C + AS+   SI++   I+ LK+L            I+ ++  E    ++  LT +  + + + +L S+    D         T ++    QLL  C  +  N  +F + L K  + I ++ E T +   I        FM+ +  F   +    DS    +K     + + I E E      N K+  G      K +A   + N VL+ WCM  G   K ++    RSIILTSGTL P+ + + +++ KF    +  HV+  ++  ++    G  G  + + + T  K+S+ + LG  +L  S+++P G+L+   S+ ++   ++RW +  + N + +HK + +EP+  ++    ++ ++    D     G++LL+V RGK SEG+D +D   R VI VG+PYPS+ DP++ LKM++  ++ K F    + G  WY  QA+RA+NQ++GR IRH  D+GA+ + D R   ++  +   L  W+Q
Sbjct:    9 VPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGW---LKQYQSQ------LLLNSRNDECKENAKQV-----------KIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQN------CKDLCKKMGCIYKIDNQPHPE------TTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASM---SISLKD-IDYLKML---------LPHILKKSGKEDCQHDL--LTMLEKMHEVIELLSSKLFYKD---EDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVNEEITDSTSEIPS-----SFMQLIDSFIMLVKLMMDS----DKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKADVLNNNFVLNIWCMNPGIVFKQISDIS-RSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKD-----GALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQ 679          
BLAST of RTEL1 vs. Planmine SMEST
Match: SMESG000018012.1 (SMESG000018012.1)

HSP 1 Score: 257.684 bits (657), Expect = 2.424e-74
Identity = 168/552 (30.43%), Postives = 284/552 (51.45%), Query Frame = 2
Query:  674 DIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTV--FFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGS----NKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFG-IDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPL--WLQ 2302
            DIE +    KK  +CPYF  +    SADI F PYNY+L+  IR+   +NL+ NI+I DEAHNIE +C + AS+ ++  +I    + LK+L            I+ ++  E    ++  LT +  + + + +L S+    D         T ++    QLL  C  +  N  +F + L K  + I ++ E T +   I        FM+ +  F   +    DS    +K     + + I E E      N K+  G      K +A   + N VL+ WCM  G   K ++    RSIILTSGTL P+ + + +++ KF    +  HV+  ++  ++    G  G  + + + T  K+S+ + LG  +L  S+++P G+L+   S+ ++   ++RW +  + N + +HK + +EP+  ++    ++ ++    D     G++LL+V RGK SEG+D +D   R VI VG+PYPS+ DP++ LKM++  ++ K F    + G  WY  QA+RA+NQ++GR IRH  D+GA+ + D R   ++  +   L  W+Q
Sbjct:   18 DIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDI----DYLKML---------LPHILKKSGKEDCQHDL--LTMLEKMHEVIELLSSKLFYKD---EDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVNEEITDSTSEIPS-----SFMQLIDSFIMLVKLMMDS----DKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKADVLNNNFVLNIWCMNPGIVFKQISDIS-RSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKD-----GALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQ 536          
BLAST of RTEL1 vs. Planmine SMEST
Match: SMESG000018012.1 (SMESG000018012.1)

HSP 1 Score: 232.261 bits (591), Expect = 1.040e-65
Identity = 159/551 (28.86%), Postives = 269/551 (48.82%), Query Frame = 2
Query:  674 DIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTV--FFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGS----NKNQAVNGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPL--WLQ 2302
            DIE +    KK  +CPYF  +    SADI F PYNY+L+  IR+   +NL+ NI+I DEAHNIE +C + AS+ ++  +I    + LK+L            I+ ++  E    ++  LT +  + + + +L S+    D         T ++    QLL  C  +  N  +F + L K  + I ++ E T +   I        FM+ +  F   +    DS    +K     + + I E E      N K+  G      K +A   + N VL+ WCM  G   K ++    RSIILTSGTL P+ + + +++ KF    +  HV+  ++  ++    G  G  + + + T  K+S+ + LG  +L  S+++P G+L+   S+ ++   ++RW +  + N + +HK + +EP+  ++    ++ ++    D     G++LL+V RGK SEG+D +D   R VI VG+PYPS+ DP+                            A+RA+NQ++GR IRH  D+GA+ + D R   ++  +   L  W+Q
Sbjct:   18 DIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDI----DYLKML---------LPHILKKSGKEDCQHDL--LTMLEKMHEVIELLSSKLFYKD---EDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVNEEITDSTSEIPS-----SFMQLIDSFIMLVKLMMDS----DKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKADVLNNNFVLNIWCMNPGIVFKQISDIS-RSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKD-----GALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPK----------------------------AFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQ 507          
The following BLAST results are available for this feature:
BLAST of RTEL1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RTEL10.000e+035.36regulator of telomere elongation helicase 1 [Sourc... [more]
RTEL10.000e+035.36regulator of telomere elongation helicase 1 [Sourc... [more]
RTEL10.000e+035.36regulator of telomere elongation helicase 1 [Sourc... [more]
RTEL10.000e+034.67regulator of telomere elongation helicase 1 [Sourc... [more]
RTEL1-TNFRSF6B6.863e-16939.14RTEL1-TNFRSF6B readthrough (NMD candidate) [Source... [more]
back to top
BLAST of RTEL1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rtel-14.355e-12533.42Regulator of telomere elongation helicase 1 homolo... [more]
rtel-14.355e-12533.42Regulator of telomere elongation helicase 1 homolo... [more]
dog-19.114e-4235.29Deletions Of G-rich DNA [Source:UniProtKB/TrEMBL;... [more]
chl-11.106e-3833.45ATP-dependent DNA helicase chl-1 [Source:UniProtK... [more]
chl-11.106e-3833.45ATP-dependent DNA helicase chl-1 [Source:UniProtK... [more]
back to top
BLAST of RTEL1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG40782.764e-16336.66gene:FBgn0029798 transcript:FBtr0070807[more]
CG40782.764e-16336.66gene:FBgn0029798 transcript:FBtr0332398[more]
Xpd4.686e-5724.67gene:FBgn0261850 transcript:FBtr0071576[more]
CG114033.854e-3631.38gene:FBgn0026876 transcript:FBtr0070245[more]
back to top
BLAST of RTEL1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rtel10.000e+036.13regulator of telomere elongation helicase 1 [Sourc... [more]
brip16.557e-8129.36BRCA1 interacting protein C-terminal helicase 1 [S... [more]
brip17.028e-8129.36BRCA1 interacting protein C-terminal helicase 1 [S... [more]
brip17.433e-8129.36BRCA1 interacting protein C-terminal helicase 1 [S... [more]
brip18.586e-8129.36BRCA1 interacting protein C-terminal helicase 1 [S... [more]
back to top
BLAST of RTEL1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phlpp25.351e-8629.97PH domain and leucine rich repeat protein phosphat... [more]
phlpp23.267e-8529.88PH domain and leucine rich repeat protein phosphat... [more]
phlpp21.986e-8429.75PH domain and leucine rich repeat protein phosphat... [more]
ephx33.345e-6826.14epoxide hydrolase 3 [Source:Xenbase;Acc:XB-GENE-59... [more]
ephx33.976e-6826.13epoxide hydrolase 3 [Source:Xenbase;Acc:XB-GENE-59... [more]
back to top
BLAST of RTEL1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rtel11.993e-17940.52regulator of telomere elongation helicase 1 [Sourc... [more]
Rtel14.445e-17940.52regulator of telomere elongation helicase 1 [Sourc... [more]
Rtel18.767e-17940.52regulator of telomere elongation helicase 1 [Sourc... [more]
Rtel19.930e-17940.52regulator of telomere elongation helicase 1 [Sourc... [more]
Rtel11.252e-17840.52regulator of telomere elongation helicase 1 [Sourc... [more]
back to top
BLAST of RTEL1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P0C928|RTEL1_DANRE0.000e+036.13Regulator of telomere elongation helicase 1 OS=Dan... [more]
sp|Q9NZ71|RTEL1_HUMAN0.000e+035.36Regulator of telomere elongation helicase 1 OS=Hom... [more]
sp|A4K436|RTEL1_BOVIN0.000e+041.19Regulator of telomere elongation helicase 1 OS=Bos... [more]
sp|Q5RE34|RTEL1_PONAB8.386e-18041.41Regulator of telomere elongation helicase 1 OS=Pon... [more]
sp|Q0VGM9|RTEL1_MOUSE6.946e-17840.52Regulator of telomere elongation helicase 1 OS=Mus... [more]
back to top
BLAST of RTEL1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9CXU10.000e+099.34RTEL1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A0X3PZF50.000e+037.50Regulator of telomere elongation helicase 1 OS=Sch... [more]
A0A068WFR90.000e+036.83Regulator of telomere length splice variant OS=Ech... [more]
A0A068Y9L00.000e+036.50Regulator of telomere length splice variant OS=Ech... [more]
A0A5K4EMX20.000e+036.31Putative regulator of telomere elongation helicase... [more]
back to top
BLAST of RTEL1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rtel10.000e+040.79regulator of telomere elongation helicase 1 [Sourc... [more]
rtel10.000e+040.79regulator of telomere elongation helicase 1 [Sourc... [more]
brip14.445e-6728.17BRCA1 interacting protein C-terminal helicase 1 [S... [more]
ercc22.763e-6526.93ERCC excision repair 2, TFIIH core complex helicas... [more]
ercc28.736e-6226.66ERCC excision repair 2, TFIIH core complex helicas... [more]
back to top
BLAST of RTEL1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RTEL1-TNFRSF6B3.043e-8842.59RTEL1-TNFRSF6B readthrough (NMD candidate) [Source... [more]
RTEL1-TNFRSF6B7.292e-8842.71RTEL1-TNFRSF6B readthrough (NMD candidate) [Source... [more]
RTEL1-TNFRSF6B6.314e-8343.53RTEL1-TNFRSF6B readthrough (NMD candidate) [Source... [more]
ENSPMAT00000009331.11.327e-7031.90pep scaffold:Pmarinus_7.0:GL478127:7852:42501:1 ge... [more]
ercc21.460e-5626.30excision repair cross-complementation group 2 [Sou... [more]
back to top
BLAST of RTEL1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RAD31.346e-6125.755' to 3' DNA helicase; involved in nucleotide exci... [more]
CHL16.035e-2536.90Probable DNA helicase; involved in sister-chromati... [more]
back to top
BLAST of RTEL1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO393880.000e+035.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467541.331e-3529.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RTEL1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ercc22.851e-6626.39ERCC excision repair 2, TFIIH core complex helicas... [more]
ercc22.981e-6626.39ERCC excision repair 2, TFIIH core complex helicas... [more]
ddx118.897e-5625.32DEAD/H-box helicase 11 [Source:NCBI gene;Acc:10116... [more]
brip11.693e-5333.55BRCA1 interacting protein C-terminal helicase 1 [S... [more]
brip11.762e-5333.55BRCA1 interacting protein C-terminal helicase 1 [S... [more]
back to top
BLAST of RTEL1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064419.10.000e+0100.00SMESG000064419.1[more]
SMESG000064419.10.000e+0100.00SMESG000064419.1[more]
SMESG000018012.11.791e-9729.89SMESG000018012.1[more]
SMESG000018012.12.424e-7430.43SMESG000018012.1[more]
SMESG000018012.11.040e-6528.86SMESG000018012.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30008368
GenBankAFD29612.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008368 ID=SMED30008368|Name=RTEL1|organism=Schmidtea mediterranea sexual|type=transcript|length=3287bp
AATGCTGATTTAAAATTTACTTATTTAAAATTATTTTTAATTTTTATTTA
TAACACCATAATTATTGAAAATTAATTAAAACGTTACTGACAGTTTATCT
TTGGCAATGCCACTTATTAATATCTGTGGAGTATCAATAGATTTTCCATT
CGAACCTTATGCATGCCAAATAATATACATGGAAAAAGTTATTGAATCTT
TGAAAGATGGTAAAAATGCCATTTTGGAATCTCCAACTGGTACAGGTAAA
ACTCTTTGTCTACTCTGTGCAGCATTAGCTTGGCAAGATCATGTGAAAAA
GGTTACAACTAATTCAGAGGATGAAATTCTACTACATTTGAATTCAAATG
GAAATCAGTATTGGAATAAAGTGAAGAAATCTCAATTGAATATCTCTAAA
ATCAACGTAGTTCCAAAAATTATTTATTCTTCCAGAACTCATTCACAGCT
GAGCCAATGTATCAATGCTTTGAAACGAACTCAATATTGTGACAGGAAAG
TTGGTATGATTGCATCTCGTGAGCAGCTTTGTATAAATCCCAAAGTAATG
AATCTTGAATCAAATACTGCAAAAATATATGGATGTAAATCTCGAGTAAA
GACTCGCAAATGTTTTTTTTACAATCAATTTGAAAAAGCAAAAGAAATTC
TATCATCTGAAACTAAAATTGCTGATATAGAAGATCTATTGACGATTGGC
AAAAAGAAATCTGTTTGTCCATATTTTTTGTCTCGCGAAATGTTCGATTC
AGCCGATATAACGTTTATGCCTTACAATTATTTATTAGATTCAAAAATTA
GACGACTTTACAATATTAATTTAAAGGGCAATATCGTGATATTTGATGAA
GCTCATAATATAGAGCAGGTGTGTGAAGATAGTGCTTCTGTTCAATTAAC
ATCGATTAATATTGCTAGTTGTATTGAAGAATTAAAAGTGCTTGGTGAAT
TTATTTATTCAATCCAATCTACAGATGCAATAATAGATGAAGCTGACAAT
GAATCCAGATCAGATGAAATACCAGATTTAACGCAAATTATCCACTTGAA
GCAAAATCTATGCATTTTAGAATCCGAATTTCACTCGATCGATTTGGGAA
ACAATGCAAATGCCGGATTGACGGTTGAAGTTAACATTCTATTTCAACTG
CTAAACCGCTGTGGATTTAATCACTCCAACAAGTTACATTTTATCGATTT
GCTAGAAAAATGTTCCTCTTTTATCGGAATGTCATCTGAACCAACTTTGA
CCAAACACGGAATTAAAGGCCTGGAAAAAGTCCAAGAATTTATGAAAACT
GTTTTCTTTGATGAAATCGGCGAAGAATTTGATTCAATCGACAATCTTGA
GAAAAAGTTATCCGCTTGTTATCGAGTTTTTATTCAGGAAAATGAGATTG
CCACTTCGAATAGAAATAATAAAATCAATTGGGGTTCGAATAAGAATCAG
GCTGTTAATGGAGATAAAAACCGGGTTCTCAGTTTTTGGTGCATGACAGC
AGGACGCACAATGAAATCATTGGCCGGTTGTGAAGTTCGCAGCATTATCC
TTACGAGCGGAACGCTCTATCCAATTGAAACTCTGAAATTGGACATGGAT
ATTAAATTTGAAGTAGAATTGCGCAATAGTCATGTAATAAATGCCGACCA
GATGATGGTTTCGGTGTGTACTAAAGGTGCTGATGGTGAACCGCTAAATT
CCAGCTATTTAACTCGCGAGAAAATATCATATACAAATTCCCTTGGAAAT
TCTATTTTAAATCTATCGAAAATTATTCCACGTGGCTTACTGGTGGTTTT
CCCATCGTATGGAATGATGAGAAAATGTATTGAACGATGGGAAAGTTGTG
ACATTTATAATTCTATGATGCAACACAAACAACTTATTGTTGAACCTCAA
GATAAAACTAAATTTACACTGGCAATGGAGCAATTTTATTCTAAAAATTC
TGATCCTTTGTCTAATAAAGGATCGATTTTACTATCTGTTGCAAGAGGCA
AAATTAGTGAGGGTCTGGATCTATCTGATCATCAAGGAAGAGGAGTAATT
GTAGTCGGGTTACCATATCCTTCCATGATGGATCCTCGCATTCGTCTAAA
AATGTCTTTTCTTGATGATCGTTTAAAATTATTTAAATTTGGAATCGATG
GACGTTGTTGGTACAAGCAACAAGCATATCGTGCTGTTAATCAATCAATT
GGCCGTGTTATTCGACATAGTCGAGATTTTGGAGCCATTTATCTATTTGA
TGAAAGATTTGCTACTGCAGATTCTCGCTTTCAATTACCGTTGTGGTTAC
AATCTAATATTGTAATTTCTAATCATTTTGGCGATGCTATCCGAAATACT
TGCAATTTCTTTCGAAATATAACTATAAAGTACCCCCCTCCTGGACTCGG
CTGTTGCGAATCGATATCGAATGTGCCTATTGAGATTCAAAATCAAGAAA
GTTCAACCAAACCCTCTAGAATAAAAAGCCGTACAAATATTAGCGCACAA
TACTCATCAAAGGTTGTATCATTTGCTACAAGTCTCAAAGATGGTTCACA
AGATTTTGCTAAAATATTAGAAAGCTATGCTAATACTCCACCGATTAAAA
AGCCAGAATCATCATTGACAAGCACATCGTTAATGGATATTCTTAAAAGA
GCTGAGAATCATGTTACAGAGATTGAAATACTACCAGTTAAGAGAACGTT
CAATGAGACGGTTTGTGAAGTAGATGATCCCGAAAAAAATACGAGAAAGG
TTAAAAAGTACAAATTAGTTGCATTAAAAGGACAAGAAAAGGTAAAGGAA
TCCAATGAGTATTCCTTTATTATTAAACGGTTATTCAATGAAGATGTTCA
AGGATTTATCAGTTATAAAACGGTAATTGAAGATTTCAAAAAGAATACCA
ATGTCGATACGCTATTTGCTGGCCTTAATTCACTGCTTTGTGAAAAAGAT
CAACCCGGCCTTGTAAGGGATTTCTATAAATTTATTCAACCGGAATTTCA
GGCACGTTTTGCAGAGCTATGTGAATCGGTGCTGGGGTTAGACTGTATGG
AGGGAAAGGAAAATGTTGAAATTGACCCTGTTGTGAGTAGGAGTAATTTA
TTGGATTGCGCATATTGTTTAGCTTCACCGGCTCTGATACCACTTGGTGC
GCCCTGCAAGCATGTATGTTGTTTCGAATGTTGGAAAATTATTATTGAAG
GAGAAAATGCTACTAGAATTTGTCCTAAATGCTCTCAACCAATACGTAGA
AGGAATTTGACCCGATTAAATATATCATAGATTTTTG
back to top

protein sequence of SMED30008368-orf-1

>SMED30008368-orf-1 ID=SMED30008368-orf-1|Name=SMED30008368-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1058bp
MPLINICGVSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTL
CLLCAALAWQDHVKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKIN
VVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVMNL
ESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKK
KSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAH
NIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNES
RSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLN
RCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTVF
FDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKINWGSNKNQAV
NGDKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIK
FEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSI
LNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDK
TKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVV
GLPYPSMMDPRIRLKMSFLDDRLKLFKFGIDGRCWYKQQAYRAVNQSIGR
VIRHSRDFGAIYLFDERFATADSRFQLPLWLQSNIVISNHFGDAIRNTCN
FFRNITIKYPPPGLGCCESISNVPIEIQNQESSTKPSRIKSRTNISAQYS
SKVVSFATSLKDGSQDFAKILESYANTPPIKKPESSLTSTSLMDILKRAE
NHVTEIEILPVKRTFNETVCEVDDPEKNTRKVKKYKLVALKGQEKVKESN
EYSFIIKRLFNEDVQGFISYKTVIEDFKKNTNVDTLFAGLNSLLCEKDQP
GLVRDFYKFIQPEFQARFAELCESVLGLDCMEGKENVEIDPVVSRSNLLD
CAYCLASPALIPLGAPCKHVCCFECWKIIIEGENATRICPKCSQPIRRRN
LTRLNIS*
back to top
Aliases
The feature 'RTEL1' has the following synonyms
Synonym
RTEL1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003678DNA helicase activity
GO:0008026ATP-dependent helicase activity
GO:0016818hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0003676nucleic acid binding
GO:0005524ATP binding
GO:0004003ATP-dependent DNA helicase activity
GO:0003677DNA binding
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0000166nucleotide binding
GO:0004386helicase activity
GO:0016787hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR013020Rad3/Chl1-like
IPR001148CA_dom
IPR006555ATP-dep_Helicase_C
IPR006554Helicase-like_DEXD_c2
IPR010614DEAD_2
IPR027417P-loop_NTPase
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
IPR014013Helic_SF1/SF2_ATP-bd_DinG/Rad3
Vocabulary: biological process
TermDefinition
GO:0006139nucleobase-containing compound metabolic process
GO:0032508DNA duplex unwinding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006555ATP-dependent helicase, C-terminalSMARTSM00491Cxpdneu3coord: 568..720
e-value: 2.7E-49
score: 179.8
IPR006555ATP-dependent helicase, C-terminalPFAMPF13307Helicase_C_2coord: 550..733
e-value: 1.8E-50
score: 171.5
IPR006554Helicase-like, DEXD box c2 typeSMARTSM00488deadxpdcoord: 9..300
e-value: 1.2E-63
score: 227.4
IPR013020ATP-dependent helicase Rad3/Chl1-likeTIGRFAMTIGR00604TIGR00604coord: 12..748
e-value: 1.8E-147
score: 490.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 529..730
e-value: 1.1E-45
score: 157.5
NoneNo IPR availablePANTHERPTHR11472DNA REPAIR DEAD HELICASE RAD3/XP-D SUBFAMILY MEMBERcoord: 8..798
NoneNo IPR availablePANTHERPTHR11472:SF34REGULATOR OF TELOMERE ELONGATION HELICASE 1coord: 8..798
NoneNo IPR availableCDDcd17970DEAHc_FancJcoord: 35..266
e-value: 2.00512E-52
score: 179.465
NoneNo IPR availableCDDcd18788SF2_C_XPDcoord: 514..718
e-value: 1.74804E-54
score: 184.73
NoneNo IPR availableCDDcd17970DEAHc_FancJcoord: 476..507
e-value: 8.45691E-5
score: 42.3342
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 998..1052
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 988..1056
e-value: 5.8E-6
score: 27.9
IPR010614DEAD2PFAMPF06733DEAD_2coord: 107..266
e-value: 4.3E-48
score: 163.2
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 1001..1043
score: 8.816
IPR014013Helicase superfamily 1/2, ATP-binding domain, DinG/Rad3-typePROSITEPS51193HELICASE_ATP_BIND_2coord: 7..298
score: 28.207
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 28..714