E3 ubiquitin-protein ligase MIB2

Overview
NameE3 ubiquitin-protein ligase MIB2
Smed IDSMED30008362
Length (bp)2944
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 ubiquitin-protein ligase MIB2 (SMED30008362) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase MIB2 (SMED30008362) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 ubiquitin-protein ligase MIB2 (SMED30008362) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase MIB2 (SMED30008362) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008362

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30008362SMESG000042567.1 dd_Smed_v4_6800_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008362SMESG000042567.1 dd_Smed_v4_6800_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008362SMESG000042567.1 dd_Smed_v4_6800_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Human
Match: MIB1 (mindbomb E3 ubiquitin protein ligase 1 [Source:HGNC Symbol;Acc:HGNC:21086])

HSP 1 Score: 108.997 bits (271), Expect = 1.695e-23
Identity = 208/993 (20.95%), Postives = 360/993 (36.25%), Query Frame = 1
Query:    7 MNSYLGLRVFPGPSWSYKFNDL----LGTVNKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSF---------YPKRTGKVDSFTNKSDTYRSYAIVKLSTNKLERC-LLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYK--IHNEMRMVQVTNKST----LTELIKEWKDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVT----NTLPGDFVGVRFNLYPHRICMLLPRKACVDLDQRPDNSEILLPRKQIILKTNDSFD--EEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAV-SVIESKNIRIIKSILNE-FSISCKINWNTLLYSFVDLIYTYSAIDRSPEMLEVIINHTEFNYQFTDENGDNMLHIATKKNYVDLVELLLK-SQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDI------------------------YLLEKF-----------DKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNN--CIFHLSASLNGEECYK-----KWKNIVADKKID------LVENMIKKFNQFKDTSKSKYLDNF---------------SIEEMPFAVISCLILSKSENALQTWRVKLDKTGKTPEDL-----FVESVKKLKLSYININKYFIRFYRYLENKYDN-EVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKVFDGDKNHLITYDNWEELSKSVKDNECPVTMADWYLYISKTIRRLECTVCKSRNWDIVFK-CGHQ-LCDDCFKNSKKCVLC 2679
            M   +G RV  GP W +   D     +GTV    +  ++ V   WDNG    Y       +DL I DSA  GIKH G  C+ C ++ I+G +W C EC  + LCT CY GD H    H FYRI +       +  R +  K   +GIF  + V                R GKV    + S +    A   L  N  +    +G+ G  ++K +    +    + YR+   +LG                    E +  ++    ++ D V +D  ++  ++  Q+ +G     + + +   G V  + E + I V + + N  + FN  +L K  I       Q     T    + +L++   D  + K+ +     W    E +     K+G +      + L  +  G  +   P  +  +    + +        S++L    + + +T +S D  EE +K A    N DV +    L     ++  Q     A+ +  ++ ++ I+K +L +   +  +           D    ++A      ++EV ++    +    ++     LHIA  K ++ +V+ LL    H    S+  S   + LH A+     +I+ +L+    D+                         LL K            D  TALHLA  NN  E    + + L +  N  L  Q+ N     HL+      +  +       K  + DK  D      L  + + +  Q +D      +D                   E+   A I+C + +   +   + R   +K G++P DL       +++ K     ++  +   R    + N  +  E C  C       ++ PCGH   C  CS    KC  C E ++ +                                          +  EC VC  +   ++F+ CGH   C++C    KKCV C
Sbjct:   10 MVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVV--WDNGTAANYRCSGA--YDLRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKCAECTNYDLCTVCYHGDKHHLR-HRFYRITTPGSERVLLESRRKSKKITARGIFAGARVVRGVDWQWEDQDGGNGRRGKVTEIQDWSASSPHSAAYVLWDNGAKNLYRVGFEGMSDLKCVQ---DAKGGSFYRDHCPVLG--------------------EQNGNRNPGGLQIGDLVNID-LDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN-RWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWA---EAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKVASAGSAISNASGERLSQLL----KKLFETQESGDLNEELVKAAA---NGDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDVEAEDKDG-------DRAVHHAAFGDEGAVIEV-LHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCH---PSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVE----VAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADL--SIR---NKKGQSPLDLCPDPNLCKALAKCHKEKVS-GQVGSRSPSMISNDSETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRT-----------------------------------------KIEECVVCSDKKAAVLFQPCGHMCACENCANLMKKCVQC 900          

HSP 2 Score: 83.5741 bits (205), Expect = 1.345e-15
Identity = 137/692 (19.80%), Postives = 270/692 (39.02%), Query Frame = 1
Query:  754 FEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCVKLVEGN---RIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKSTLTELIKEWKDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVTNTLPGDFVGVRFNLYPHRICMLLPRKACVDLDQRPDNSEILLPRKQIILKTNDSFDEEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAVSVIESKNIRIIKSILN----------------EFSISCKIN--WNTLLYSFVDLIYT---------YSAIDRSPEMLEVIINHTEFNYQFTDENGDN---MLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLEKFDKSTALHLALKNNCFESLCSILDSL-TNSLNPTLVDQHNNCIFHLSASLNGEECYKKWKNIVADKKIDLVENMIKKFNQF---KDTSKSKYLDNFSIEEMPFAVIS--CLILSKSENALQTWRVKLDKTGKTPEDLFVE--SVKKLKLSYININKYFIRFYRYLENKYDNEVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKV---------FDGDKNHLITYDNWEELSKSVKDNECPVTMADWYLYISKTIRRLECTVCKSRNWDIVFKCGHQLCDDCFKNSKKCVLC 2679
            F+V D V V C+++  +K  Q  +GE    +   +GK G V+ +  +   +++VC       + +N   + K+ +    +   +   L++L+K+      ++  +  D+    + E+++         V + L    V V      H       +   VD+ +       LL ++ + ++  D   +  +  A       V E      A+ +    +    L ++V    +++++K++L+                  +IS K +     LL +  D+  T         ++A+  +P  + V+++     +   DE  D+    LH+A   N+V++ ELL+   +  ++  N++ + +ALH AVE  + +I+++L+R    + + +K D  T LH AL+++    L  + D      ++       N  I  L      ++        +A    DL     K  +      D +  K L     E++   V S    ++S     L+   V  D    T   LF     +    L    + K  I     ++++   E C  C     +V+++PCGH   CE C+ +  KC +C   +E +V            D    I+  N   L K   +      +      +     +  C VC  R  +++F CGH  C  C     +C +C
Sbjct:  333 FQVGDLVQV-CYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVC----GTSWTYNPAAVSKVASAGSAISNASGERLSQLLKKL-----FETQESGDL----NEELVKAAANGDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILK-------LLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAV-NKGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPW-IVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVN-QQTALHLAVERQHTQIVRLLVRAGAKLDIQDK-DGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPNLCKALAKCHKEKVSGQVGSRSPSMISNDSETLEECMVCSDMKRDT---LFGPCGHIATCSLCSPRVKKCLI-CKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCANLMKKCVQCRAVVERRVPFIMCCGGKSSEDATDDISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPIC 995          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 98.5969 bits (244), Expect = 2.816e-20
Identity = 89/342 (26.02%), Postives = 150/342 (43.86%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFNDL----------LGTVNKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHS------------FYPKRTGKVDSFTNKSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFEL-DMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIHN 969
            +G+RV  G  W +   D           LG  +   +  D  V V+WD G    Y  G +   DLL+YD+AQIG++H    C+ C +  + G +W C  C  + LCT+CYM + H+  +H F R ++A+     +  R    +   +GIF  ++V                 P R   VD      +T RS A V  +        +G+ G+V++K +    E      Y++ L  LG+ A    E  +    + + F+  D  K ++D +V             L++ Q  +G  N ++ + IG+ G V ++ +   ++V F NH   + F+   L K H+
Sbjct:   25 VGMRVVRGVDWKWGQQDGGEGGVGTVVELGR-HGSPSTPDRTVVVQWDQGTRTNYRAGYQGAHDLLLYDNAQIGVRHPNIICDCCKKHGLRGMRWKCRVCLDYDLCTQCYMHNKHEL-AHAFDRYETAHSRPVTLSPRQGLPRIPLRGIFQGAKVVRGPDWEWGSQDGGEGKPGRV--VDIRGWDVETGRSVASVTWADGTTNVYRVGHKGKVDLKCVG---EAAGGFYYKDHLPRLGKPA----ELQRRVSADSQPFQHGDKVKCLLDTDV-------------LREMQEGHGGWNPRMAEFIGQTGTVHRITDRGDVRVQF-NHETRWTFHPGALTKHHS 341          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 97.4413 bits (241), Expect = 6.736e-20
Identity = 89/342 (26.02%), Postives = 150/342 (43.86%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFNDL----------LGTVNKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHS------------FYPKRTGKVDSFTNKSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFEL-DMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIHN 969
            +G+RV  G  W +   D           LG  +   +  D  V V+WD G    Y  G +   DLL+YD+AQIG++H    C+ C +  + G +W C  C  + LCT+CYM + H+  +H F R ++A+     +  R    +   +GIF  ++V                 P R   VD      +T RS A V  +        +G+ G+V++K +    E      Y++ L  LG+ A    E  +    + + F+  D  K ++D +V             L++ Q  +G  N ++ + IG+ G V ++ +   ++V F NH   + F+   L K H+
Sbjct:   25 VGMRVVRGVDWKWGQQDGGEGGVGTVVELGR-HGSPSTPDRTVVVQWDQGTRTNYRAGYQGAHDLLLYDNAQIGVRHPNIICDCCKKHGLRGMRWKCRVCLDYDLCTQCYMHNKHEL-AHAFDRYETAHSRPVTLSPRQGLPRIPLRGIFQGAKVVRGPDWEWGSQDGGEGKPGRV--VDIRGWDVETGRSVASVTWADGTTNVYRVGHKGKVDLKCVG---EAAGGFYYKDHLPRLGKPA----ELQRRVSADSQPFQHGDKVKCLLDTDV-------------LREMQEGHGGWNPRMAEFIGQTGTVHRITDRGDVRVQF-NHETRWTFHPGALTKHHS 341          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 97.0561 bits (240), Expect = 9.236e-20
Identity = 89/342 (26.02%), Postives = 150/342 (43.86%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFNDL----------LGTVNKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHS------------FYPKRTGKVDSFTNKSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFEL-DMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIHN 969
            +G+RV  G  W +   D           LG  +   +  D  V V+WD G    Y  G +   DLL+YD+AQIG++H    C+ C +  + G +W C  C  + LCT+CYM + H+  +H F R ++A+     +  R    +   +GIF  ++V                 P R   VD      +T RS A V  +        +G+ G+V++K +    E      Y++ L  LG+ A    E  +    + + F+  D  K ++D +V             L++ Q  +G  N ++ + IG+ G V ++ +   ++V F NH   + F+   L K H+
Sbjct:  126 VGMRVVRGVDWKWGQQDGGEGGVGTVVELGR-HGSPSTPDRTVVVQWDQGTRTNYRAGYQGAHDLLLYDNAQIGVRHPNIICDCCKKHGLRGMRWKCRVCLDYDLCTQCYMHNKHEL-AHAFDRYETAHSRPVTLSPRQGLPRIPLRGIFQGAKVVRGPDWEWGSQDGGEGKPGRV--VDIRGWDVETGRSVASVTWADGTTNVYRVGHKGKVDLKCVG---EAAGGFYYKDHLPRLGKPA----ELQRRVSADSQPFQHGDKVKCLLDTDV-------------LREMQEGHGGWNPRMAEFIGQTGTVHRITDRGDVRVQF-NHETRWTFHPGALTKHHS 442          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 97.0561 bits (240), Expect = 9.237e-20
Identity = 89/342 (26.02%), Postives = 150/342 (43.86%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFNDL----------LGTVNKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHS------------FYPKRTGKVDSFTNKSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFEL-DMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIHN 969
            +G+RV  G  W +   D           LG  +   +  D  V V+WD G    Y  G +   DLL+YD+AQIG++H    C+ C +  + G +W C  C  + LCT+CYM + H+  +H F R ++A+     +  R    +   +GIF  ++V                 P R   VD      +T RS A V  +        +G+ G+V++K +    E      Y++ L  LG+ A    E  +    + + F+  D  K ++D +V             L++ Q  +G  N ++ + IG+ G V ++ +   ++V F NH   + F+   L K H+
Sbjct:  112 VGMRVVRGVDWKWGQQDGGEGGVGTVVELGR-HGSPSTPDRTVVVQWDQGTRTNYRAGYQGAHDLLLYDNAQIGVRHPNIICDCCKKHGLRGMRWKCRVCLDYDLCTQCYMHNKHEL-AHAFDRYETAHSRPVTLSPRQGLPRIPLRGIFQGAKVVRGPDWEWGSQDGGEGKPGRV--VDIRGWDVETGRSVASVTWADGTTNVYRVGHKGKVDLKCVG---EAAGGFYYKDHLPRLGKPA----ELQRRVSADSQPFQHGDKVKCLLDTDV-------------LREMQEGHGGWNPRMAEFIGQTGTVHRITDRGDVRVQF-NHETRWTFHPGALTKHHS 428          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Celegans
Match: mib-1 (MIB (MIndBomb) ubiquitin ligase homolog [Source:UniProtKB/TrEMBL;Acc:Q9U2C5])

HSP 1 Score: 56.9954 bits (136), Expect = 5.923e-8
Identity = 90/406 (22.17%), Postives = 159/406 (39.16%), Query Frame = 1
Query: 1618 NGDNM--LHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLEKFDKSTALHLALKNNCFES-----LCSILDSLTNSLNPT-LVDQHNNCIFHLSASLNGEECYKKWKNIVADKKIDLVENMIKKFNQFKDTS----KSKYLDNFSIEEMP--------FAVISCLILSKSENALQTWRVKLDKTGKTPEDLFVESVKKLKLSYININK---YFIRFYRYLENKYDNE---VCKFCYINGVSVI-YKPCGHKIHCEYCS--FMPHKCAECNEDIEE-------KVFDGDKNHLITYDNWEELSKSVKDNECPVTMADWYLYISKT--------IRRLE-------CTVCKSRNWDIVFKCGHQLCDDCF-KNSKKCVLC 2679
            N  NM  + IA    +V  VE LL  +    N+ +  T  SALH+A  + +  ++  L+    +++  +KF +   LH AL+    E+       + + +L  +  P+ ++D            LNG+                L+  M+    Q+  +           N +++EM          A I  L+ + ++       VK D+ G T  DL  ES  +  + +I   K            E+K+D+    +C F  +N V+ +   PCGH++ C  C+      +C  C + I E        V  G + H  +  + +++S  V+         +  + + +          +RLE       C +C      +VF CGH  C DC  K  K+C +C
Sbjct:  379 NNSNMTPIQIAIMSGHVSTVEQLLLLRASYRNTTS-KTGMSALHFAAASGHANVVNKLISLGLEVHRRDKFGRGV-LHYALEKWTGEAEKDCNRLAAIQALVKAGAPSNIID------------LNGQTPV-----------FQLIREMLSNSEQYPASLVPVCAQLVRTNLNLDEMASRLRPMWQLATICFLVANGAD-----LNVK-DRRGMTVMDLCEESSFRSIIVHIAQTKQRQVMPMMMAMSEDKFDSTEVTMCTFSCLNSVATVKLDPCGHRVACVDCTEKVAIRRCPVCRQFINEAHDQDGKPVQIGSRCHEPSDGDRQQVSAEVRKQIADDAAREAKIEVEREKQNELNQLRKRLEQLELETNCAICMDLKIAVVFNCGHTACVDCADKLKKQCHIC 753          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Celegans
Match: F40G9.17 (pep chromosome:WBcel235:III:194460:210063:1 gene:WBGene00185078.1 transcript:F40G9.17.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F40G9.17)

HSP 1 Score: 48.9062 bits (115), Expect = 6.285e-6
Identity = 50/164 (30.49%), Postives = 80/164 (48.78%), Query Frame = 1
Query: 1537 YSAIDRSPEMLE-VIINHTEFNYQFTDENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIY-LLEKFDKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNNCIFHLSASLNGEECYKKWKNIVADKKI 2022
            ++A+  S  +L+  I+N  E  ++ TD+ G   L IA+    VD+V  LL      V   N S K ++LHYA   N+ EI+K+L+  + +I  L +KF  +TALH A        + +++ +   SL+    D   N   HL+   N  +      N  AD K+
Sbjct:   56 FAAVGGSLPLLQFAILNDPEMAHK-TDDLGWTPLMIASSAGRVDVVRYLLTLPDVDVKHTN-SNKQTSLHYACSKNHVEIVKLLIEADPNIINLPDKF-GATALHRAASRGNDVIVRALVSTGKCSLDRQ--DGEGNTALHLACDENRGDVAILLVNRGADMKM 214          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Celegans
Match: F40G9.17 (pep chromosome:WBcel235:III:194462:200328:1 gene:WBGene00185078.1 transcript:F40G9.17.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F40G9.17)

HSP 1 Score: 48.9062 bits (115), Expect = 6.285e-6
Identity = 50/164 (30.49%), Postives = 80/164 (48.78%), Query Frame = 1
Query: 1537 YSAIDRSPEMLE-VIINHTEFNYQFTDENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIY-LLEKFDKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNNCIFHLSASLNGEECYKKWKNIVADKKI 2022
            ++A+  S  +L+  I+N  E  ++ TD+ G   L IA+    VD+V  LL      V   N S K ++LHYA   N+ EI+K+L+  + +I  L +KF  +TALH A        + +++ +   SL+    D   N   HL+   N  +      N  AD K+
Sbjct:   56 FAAVGGSLPLLQFAILNDPEMAHK-TDDLGWTPLMIASSAGRVDVVRYLLTLPDVDVKHTN-SNKQTSLHYACSKNHVEIVKLLIEADPNIINLPDKF-GATALHRAASRGNDVIVRALVSTGKCSLDRQ--DGEGNTALHLACDENRGDVAILLVNRGADMKM 214          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Fly
Match: mib2 (gene:FBgn0086442 transcript:FBtr0336840)

HSP 1 Score: 131.724 bits (330), Expect = 8.247e-31
Identity = 160/655 (24.43%), Postives = 272/655 (41.53%), Query Frame = 1
Query:   22 GLRVFPGPSWSYKFND----LLGTVNKINNLNDLF-----VEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHS---------FYPKRTGKVDSFTN-KSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVI--DFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKSTLTELIKEWKDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVTNTLPGDFV------GVRFNLYPHRICMLLPRKACVDLDQRPDNSEILLPRKQIILKT------NDSFDEEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAVSVIESKNIRIIKSILNEFSISCKINWNTLLYSFVDLIYTYSAIDRSPEMLEVIINH-TEFNYQFTDENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRY-NCDIYLLEKFDKSTALHLALKNNCFES 1875
            G+RV  GP+W +   D     +GTV +I            V V WD+G    Y +G + ++DL+I D+AQ+G++H    C+GC++  I G  + C +C  + LC  CY  D H  E H F R  + N +G  +  R    + + +GIF+ S+V                RTG+V       +++ RS A V   T       LG+ G V++K +      +    Y++ + +LG                 +T EL     ++   F V D V V C  + +L K Q  +G  N ++ + + K G V ++ +   I+V +EN    + F+   L K+        V+ +  + +L+    D+ K +  +     W+   EI+     KI  +V     GD        G  + L P   C+ L R       +R ++   L  R+   + T        S  ++ +++A       +D   ++LD   S + + +  +  + V   +    + S L    IS   N N +     D    Y+A    P  + V++ H  E N  F + +  + LHI   K     V  LL  QH    ++  S   +ALH A+   N E++++L    N D  +      +   H ALK N   +
Sbjct:    8 GIRVVRGPNWIWSNQDDGEGHVGTVCEIGRCGSTHSPENTVVVNWDSGHRTNYRVGYQNQYDLIIVDNAQVGVRHSNVVCDGCSKAGIAGIVFKCAQCPNYHLCAYCYAEDLHDIE-HPFIRYTTPNSLGVRLPMRKGAKRIQLRGIFVGSKVVRGPDWEWNEQDGGEGRTGRVMEIRGWDNESCRSVANVAWVTGSTNVYRLGHKGNVDLKYITATCGGH---YYKDHMPVLG-----------------QTEELQPVAPMVKPSFSVGDRVKV-CLEVDALMKLQQGHGGWNPRMVEHLSKLGTVHRITDKGDIRVQYENCPNRWTFHPAALVKV--------VSFR--VGDLVTIINDANKVQQLQKGHGEWI---EIMRHALGKICKVVKVYSDGDLRIQQLDDGFEWTLNPK--CVKLERSPLATAAERSNSMMDLSHRRADHVMTPLSGLSGSSVADKLVREAA---QGHLDFVRQYLDVNPSQVDVMSGGKACIQVASHQGYVDLVSYL----ISKGANVNAVDKEG-DSALHYAAFGNQPATMRVLLQHGAEVN--FLNSSHCSALHICAHKKTPHCVRELL--QHNANVNIQDSYGDTALHDAIGKENTEVVELLCNAPNLDFTVKNNRGFNVLHHAALKGNVVAA 613          

HSP 2 Score: 55.4546 bits (132), Expect = 2.633e-7
Identity = 33/116 (28.45%), Postives = 47/116 (40.52%), Query Frame = 1
Query: 2347 VIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKV-FDGDKNHLITYDNWEELSKSVKDNECPVTMADWYLYISKTIRRLE----CTVCKSRNWDIVFKCGHQLCDDCFKNSKKCVLC 2679
            V ++PC H+I CE C     KC  C   IE ++   G    L T       S S   +   +   D   Y+   +   E    C +C  R  D+ F CGH  C  C +  + C +C
Sbjct:  930 VRFEPCQHQIACEECGIRMKKCLRCAVAIERRLTVSGRVVALPT-------STSSPSDPTRLPSGDLLRYLENKVLEFEESHFCGICMERKRDVAFLCGHGACSHCAETLRTCHMC 1038          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Fly
Match: mib2 (gene:FBgn0086442 transcript:FBtr0081142)

HSP 1 Score: 131.724 bits (330), Expect = 8.247e-31
Identity = 160/655 (24.43%), Postives = 272/655 (41.53%), Query Frame = 1
Query:   22 GLRVFPGPSWSYKFND----LLGTVNKINNLNDLF-----VEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHS---------FYPKRTGKVDSFTN-KSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVI--DFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKSTLTELIKEWKDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVTNTLPGDFV------GVRFNLYPHRICMLLPRKACVDLDQRPDNSEILLPRKQIILKT------NDSFDEEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAVSVIESKNIRIIKSILNEFSISCKINWNTLLYSFVDLIYTYSAIDRSPEMLEVIINH-TEFNYQFTDENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRY-NCDIYLLEKFDKSTALHLALKNNCFES 1875
            G+RV  GP+W +   D     +GTV +I            V V WD+G    Y +G + ++DL+I D+AQ+G++H    C+GC++  I G  + C +C  + LC  CY  D H  E H F R  + N +G  +  R    + + +GIF+ S+V                RTG+V       +++ RS A V   T       LG+ G V++K +      +    Y++ + +LG                 +T EL     ++   F V D V V C  + +L K Q  +G  N ++ + + K G V ++ +   I+V +EN    + F+   L K+        V+ +  + +L+    D+ K +  +     W+   EI+     KI  +V     GD        G  + L P   C+ L R       +R ++   L  R+   + T        S  ++ +++A       +D   ++LD   S + + +  +  + V   +    + S L    IS   N N +     D    Y+A    P  + V++ H  E N  F + +  + LHI   K     V  LL  QH    ++  S   +ALH A+   N E++++L    N D  +      +   H ALK N   +
Sbjct:    8 GIRVVRGPNWIWSNQDDGEGHVGTVCEIGRCGSTHSPENTVVVNWDSGHRTNYRVGYQNQYDLIIVDNAQVGVRHSNVVCDGCSKAGIAGIVFKCAQCPNYHLCAYCYAEDLHDIE-HPFIRYTTPNSLGVRLPMRKGAKRIQLRGIFVGSKVVRGPDWEWNEQDGGEGRTGRVMEIRGWDNESCRSVANVAWVTGSTNVYRLGHKGNVDLKYITATCGGH---YYKDHMPVLG-----------------QTEELQPVAPMVKPSFSVGDRVKV-CLEVDALMKLQQGHGGWNPRMVEHLSKLGTVHRITDKGDIRVQYENCPNRWTFHPAALVKV--------VSFR--VGDLVTIINDANKVQQLQKGHGEWI---EIMRHALGKICKVVKVYSDGDLRIQQLDDGFEWTLNPK--CVKLERSPLATAAERSNSMMDLSHRRADHVMTPLSGLSGSSVADKLVREAA---QGHLDFVRQYLDVNPSQVDVMSGGKACIQVASHQGYVDLVSYL----ISKGANVNAVDKEG-DSALHYAAFGNQPATMRVLLQHGAEVN--FLNSSHCSALHICAHKKTPHCVRELL--QHNANVNIQDSYGDTALHDAIGKENTEVVELLCNAPNLDFTVKNNRGFNVLHHAALKGNVVAA 613          

HSP 2 Score: 55.4546 bits (132), Expect = 2.633e-7
Identity = 33/116 (28.45%), Postives = 47/116 (40.52%), Query Frame = 1
Query: 2347 VIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKV-FDGDKNHLITYDNWEELSKSVKDNECPVTMADWYLYISKTIRRLE----CTVCKSRNWDIVFKCGHQLCDDCFKNSKKCVLC 2679
            V ++PC H+I CE C     KC  C   IE ++   G    L T       S S   +   +   D   Y+   +   E    C +C  R  D+ F CGH  C  C +  + C +C
Sbjct:  930 VRFEPCQHQIACEECGIRMKKCLRCAVAIERRLTVSGRVVALPT-------STSSPSDPTRLPSGDLLRYLENKVLEFEESHFCGICMERKRDVAFLCGHGACSHCAETLRTCHMC 1038          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Fly
Match: mib2 (gene:FBgn0086442 transcript:FBtr0336841)

HSP 1 Score: 131.724 bits (330), Expect = 8.247e-31
Identity = 160/655 (24.43%), Postives = 272/655 (41.53%), Query Frame = 1
Query:   22 GLRVFPGPSWSYKFND----LLGTVNKINNLNDLF-----VEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHS---------FYPKRTGKVDSFTN-KSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVI--DFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKSTLTELIKEWKDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVTNTLPGDFV------GVRFNLYPHRICMLLPRKACVDLDQRPDNSEILLPRKQIILKT------NDSFDEEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAVSVIESKNIRIIKSILNEFSISCKINWNTLLYSFVDLIYTYSAIDRSPEMLEVIINH-TEFNYQFTDENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRY-NCDIYLLEKFDKSTALHLALKNNCFES 1875
            G+RV  GP+W +   D     +GTV +I            V V WD+G    Y +G + ++DL+I D+AQ+G++H    C+GC++  I G  + C +C  + LC  CY  D H  E H F R  + N +G  +  R    + + +GIF+ S+V                RTG+V       +++ RS A V   T       LG+ G V++K +      +    Y++ + +LG                 +T EL     ++   F V D V V C  + +L K Q  +G  N ++ + + K G V ++ +   I+V +EN    + F+   L K+        V+ +  + +L+    D+ K +  +     W+   EI+     KI  +V     GD        G  + L P   C+ L R       +R ++   L  R+   + T        S  ++ +++A       +D   ++LD   S + + +  +  + V   +    + S L    IS   N N +     D    Y+A    P  + V++ H  E N  F + +  + LHI   K     V  LL  QH    ++  S   +ALH A+   N E++++L    N D  +      +   H ALK N   +
Sbjct:    8 GIRVVRGPNWIWSNQDDGEGHVGTVCEIGRCGSTHSPENTVVVNWDSGHRTNYRVGYQNQYDLIIVDNAQVGVRHSNVVCDGCSKAGIAGIVFKCAQCPNYHLCAYCYAEDLHDIE-HPFIRYTTPNSLGVRLPMRKGAKRIQLRGIFVGSKVVRGPDWEWNEQDGGEGRTGRVMEIRGWDNESCRSVANVAWVTGSTNVYRLGHKGNVDLKYITATCGGH---YYKDHMPVLG-----------------QTEELQPVAPMVKPSFSVGDRVKV-CLEVDALMKLQQGHGGWNPRMVEHLSKLGTVHRITDKGDIRVQYENCPNRWTFHPAALVKV--------VSFR--VGDLVTIINDANKVQQLQKGHGEWI---EIMRHALGKICKVVKVYSDGDLRIQQLDDGFEWTLNPK--CVKLERSPLATAAERSNSMMDLSHRRADHVMTPLSGLSGSSVADKLVREAA---QGHLDFVRQYLDVNPSQVDVMSGGKACIQVASHQGYVDLVSYL----ISKGANVNAVDKEG-DSALHYAAFGNQPATMRVLLQHGAEVN--FLNSSHCSALHICAHKKTPHCVRELL--QHNANVNIQDSYGDTALHDAIGKENTEVVELLCNAPNLDFTVKNNRGFNVLHHAALKGNVVAA 613          

HSP 2 Score: 55.4546 bits (132), Expect = 2.633e-7
Identity = 33/116 (28.45%), Postives = 47/116 (40.52%), Query Frame = 1
Query: 2347 VIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKV-FDGDKNHLITYDNWEELSKSVKDNECPVTMADWYLYISKTIRRLE----CTVCKSRNWDIVFKCGHQLCDDCFKNSKKCVLC 2679
            V ++PC H+I CE C     KC  C   IE ++   G    L T       S S   +   +   D   Y+   +   E    C +C  R  D+ F CGH  C  C +  + C +C
Sbjct:  930 VRFEPCQHQIACEECGIRMKKCLRCAVAIERRLTVSGRVVALPT-------STSSPSDPTRLPSGDLLRYLENKVLEFEESHFCGICMERKRDVAFLCGHGACSHCAETLRTCHMC 1038          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Fly
Match: mib1 (gene:FBgn0263601 transcript:FBtr0075520)

HSP 1 Score: 112.849 bits (281), Expect = 6.425e-25
Identity = 100/382 (26.18%), Postives = 158/382 (41.36%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFNDL----LGTVNKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSF---------YPKRTGKVDSFTN-KSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCVKLVEGNRIKVCFENHNEEYYFNSKILYKIHN------EMRMVQVTNKSTLTELIK-------EWKDSIKWKMTKIDDIYWV 1080
            +G RV  GP W +   D     +GTV    +  +  V V WDNG    Y       +DL I DSA  G+KH G  C+ C ++ I G +W C EC  + LC+ CY GD H    H FYRI +     T +  R +  K   +GIF  + V                R GKV+   +  S + RS A V           +G+ G  ++K++N    +NV   YR+ L +LG +                       K    F++ D V VD  ++  ++  Q+ +G     + + +   G V  ++ +   V   N    + FN  +L K+ +      E ++  +    +  E IK       EW D+++  + KI  +  V
Sbjct:  108 VGARVIRGPDWKWNKQDGGEGHVGTVRNFESAEE--VVVVWDNGTAANYRCAGA--YDLRILDSAPTGVKHEGTMCDTCRQQPIFGIRWKCAECINYDLCSICYHGDKHHLR-HRFYRITTPGGERTMLEPRRKSKKVLARGIFPGARVVRGVDWQWEDQDGGVGRRGKVNEIQDWSSASPRSAAYVIWDNGSKNLYRVGFEGMADLKVVNDAKGSNV---YRDHLPLLGENG--------------------PGKGPHGFQIGDKVTVD-LDLEIVQSLQHGHGGWTDGMFECLSNAGMVVGIDEDHDIVVAYNSGNRWTFNPAVLTKVSSPTTAPPEFQVGDIVKICSDVESIKILQRGHGEWADAMQLTLGKIGRVQQV 460          

HSP 2 Score: 53.1434 bits (126), Expect = 1.334e-6
Identity = 32/121 (26.45%), Postives = 69/121 (57.02%), Query Frame = 1
Query: 1537 YSAIDRSPEMLEVIINHTEFNYQFTD--ENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLEKFDKSTALHLALKNNCFESLCSILD 1893
            ++A+  +P  +++++  T   +   +  ++G   LH+A   N+V++ ELL+      ++  N++ + +ALH AVE  + +I+K+L++   D+ + +K D  T LH AL+++    L  + D
Sbjct:  706 HAALKGNPSAMKILLTKTNRPWIVEEKKDDGYTALHLAALNNHVEIAELLVHMGKANMDRQNVNLQ-TALHLAVERQHVQIVKLLVQDGADLNIPDK-DGDTPLHEALRHHTLSQLKQLQD 824          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Fly
Match: mib1 (gene:FBgn0263601 transcript:FBtr0333578)

HSP 1 Score: 102.834 bits (255), Expect = 7.049e-22
Identity = 93/360 (25.83%), Postives = 149/360 (41.39%), Query Frame = 1
Query:   73 LGTVNKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSF---------YPKRTGKVDSFTN-KSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCVKLVEGNRIKVCFENHNEEYYFNSKILYKIHN------EMRMVQVTNKSTLTELIK-------EWKDSIKWKMTKIDDIYWV 1080
            +GTV    +  +  V V WDNG    Y       +DL I DSA  G+KH G  C+ C ++ I G +W C EC  + LC+ CY GD H    H FYRI +     T +  R +  K   +GIF  + V                R GKV+   +  S + RS A V           +G+ G  ++K++N    +NV   YR+ L +LG +                       K    F++ D V VD  ++  ++  Q+ +G     + + +   G V  ++ +   V   N    + FN  +L K+ +      E ++  +    +  E IK       EW D+++  + KI  +  V
Sbjct:   19 VGTVRNFESAEE--VVVVWDNGTAANYRCAGA--YDLRILDSAPTGVKHEGTMCDTCRQQPIFGIRWKCAECINYDLCSICYHGDKHHLR-HRFYRITTPGGERTMLEPRRKSKKVLARGIFPGARVVRGVDWQWEDQDGGVGRRGKVNEIQDWSSASPRSAAYVIWDNGSKNLYRVGFEGMADLKVVNDAKGSNV---YRDHLPLLGENG--------------------PGKGPHGFQIGDKVTVD-LDLEIVQSLQHGHGGWTDGMFECLSNAGMVVGIDEDHDIVVAYNSGNRWTFNPAVLTKVSSPTTAPPEFQVGDIVKICSDVESIKILQRGHGEWADAMQLTLGKIGRVQQV 349          

HSP 2 Score: 53.1434 bits (126), Expect = 1.341e-6
Identity = 32/121 (26.45%), Postives = 69/121 (57.02%), Query Frame = 1
Query: 1537 YSAIDRSPEMLEVIINHTEFNYQFTD--ENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLEKFDKSTALHLALKNNCFESLCSILD 1893
            ++A+  +P  +++++  T   +   +  ++G   LH+A   N+V++ ELL+      ++  N++ + +ALH AVE  + +I+K+L++   D+ + +K D  T LH AL+++    L  + D
Sbjct:  595 HAALKGNPSAMKILLTKTNRPWIVEEKKDDGYTALHLAALNNHVEIAELLVHMGKANMDRQNVNLQ-TALHLAVERQHVQIVKLLVQDGADLNIPDK-DGDTPLHEALRHHTLSQLKQLQD 713          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 121.324 bits (303), Expect = 1.945e-27
Identity = 192/906 (21.19%), Postives = 344/906 (37.97%), Query Frame = 1
Query:    7 MNSYLGLRVFPGPSWSYKFNDL----LGTVNKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSF---------YPKRTGKV---DSFTNKSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKS-------TLTELIKEWKDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVT----NTLPGDFVGVRFNLYPHRICMLLPRKACVDLDQRPDNSEILLPRKQIILKTNDSFD--EEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAVSVIESKNIRIIKSILNEFSISCKI---NWNTLLY--------SFVDLIYTYSAI-----DRSPEMLEVIINHTEFNY-----------QFTDENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLE--KFDKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNN--CIFHLSASLNGEECYKKWKNIVADKKIDLVE----------------NMIKKFNQFKDTSKSKY-----------LDNFSIEEMPFAVISCLILSKSENALQTWRVKLDKTGKTPEDLFVESVKKLKLSYININK----YFIRFYRYLENKYDNEVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKV 2445
            M   +G RV  GP W +   D     +GTV    +  ++ V   WDNG    Y       +D+ I DSA  GIKH G  C+ C ++ I+G +W C EC  + LCT CY GD H    H FYRI +       +  R +  K   +GIF    V                R GKV     ++  S    +Y +       L R  +G+ G  ++K +    +    T YR+   +LG                    E +  ++    ++ D V +D  ++  ++  Q+ +G     + + +   G V  + E + I V + + N  + FN  +L K  N +R  +V   +        + +L++   D  + K+ +     W    E +     K+G +      + L  +  G  +   P  +  + P  + V        S++L    + + +T +S D  EE +K A    N D+ +    L     ++  Q     A+          +  +L + S+  +    + +  ++        S +++++   A       R    L + +N                    D  GD  LH A  K   D++ +LL++   +  ++  +  ++ALH+A    N   +++L+      ++++  K D  TALHLA  NN  E    + + L +  N  L  Q+ N     HL+      +  +    + A+ K+D+ +                + +++    +D SK +            L     E+   A I+C + +   +   T R   +K G++P DL  +      L+  +  K       R      N    E C  C       ++ PCGH   C  CS    KC  C E ++ + 
Sbjct:   10 MMEGVGARVIRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVV--WDNGTAANYRCSGA--YDVRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKCAECTNYDLCTTCYHGDKHHLR-HRFYRITTPGSERVLLESRRKSKKITARGIFAGGRVVRGVDWQWEDQDGGNGRRGKVTEIQDWSAASPHSAAYVLWDNGAKNLYR--VGFEGMSDLKCVQ---DAKGGTFYRDHCPVLG--------------------EQNGNRNPGGLQIGDLVNID-LDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN-RWTFNPAVLTKA-NVVRSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWA---EAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGERLSQLL----KKLFETQESGDINEELVKAAA---NGDLAKVEDILKRPDVDVNGQCAGHTAMQAASQNGHVDVLKLLLKHSVDLEAEDKDGDRAVHHASFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADV--TITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVE----VAELLVHQGNANLDVQNVNQQTALHLAVERQHTQIVRLL--VRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADL--TIR---NKKGQSPLDLCPDPSLCKALAKCHKEKTSGQVGSRSPSLNSNNETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRT 859          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 120.168 bits (300), Expect = 4.677e-27
Identity = 195/913 (21.36%), Postives = 347/913 (38.01%), Query Frame = 1
Query:    7 MNSYLGLRVFPGPSWSYKFNDL----LGTVNKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSF---------YPKRTGKV---DSFTNKSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKS-------TLTELIKEWKDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVT----NTLPGDFVGVRFNLYPHRICMLLPRKACVD------LDQRPD-NSEILLPRKQIILKTNDSFD--EEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAVSVIESKNIRIIKSILNEFSISCKI---NWNTLLY--------SFVDLIYTYSAI-----DRSPEMLEVIINHTEFNYQFT-----------DENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLE--KFDKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNN--CIFHLSASLNGEECYKKWKNIVADKKIDLVE----------------NMIKKFNQFKDTSKSKY-----------LDNFSIEEMPFAVISCLILSKSENALQTWRVKLDKTGKTPEDLFVESVKKLKLSYININK----YFIRFYRYLENKYDNEVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKV 2445
            M   +G RV  GP W +   D     +GTV    +  ++ V   WDNG    Y       +D+ I DSA  GIKH G  C+ C ++ I+G +W C EC  + LCT CY GD H    H FYRI +       +  R +  K   +GIF    V                R GKV     ++  S    +Y +       L R  +G+ G  ++K +    +    T YR+   +LG                    E +  ++    ++ D V +D  ++  ++  Q+ +G     + + +   G V  + E + I V + + N  + FN  +L K  N +R  +V   +        + +L++   D  + K+ +     W    E +     K+G +      + L  +  G  +   P  +  + P  + V       L + P   +E L    + + +T +S D  EE +K A    N D+ +    L     ++  Q     A+          +  +L + S+  +    + +  ++        S +++++   A       R    L + +N        T           D  GD  LH A  K   D++ +LL++   +  ++  +  ++ALH+A    N   +++L+      ++++  K D  TALHLA  NN  E    + + L +  N  L  Q+ N     HL+      +  +    + A+ K+D+ +                + +++    +D SK +            L     E+   A I+C + +   +   T R   +K G++P DL  +      L+  +  K       R      N    E C  C       ++ PCGH   C  CS    KC  C E ++ + 
Sbjct:   10 MMEGVGARVIRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVV--WDNGTAANYRCSGA--YDVRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKCAECTNYDLCTTCYHGDKHHLR-HRFYRITTPGSERVLLESRRKSKKITARGIFAGGRVVRGVDWQWEDQDGGNGRRGKVTEIQDWSAASPHSAAYVLWDNGAKNLYR--VGFEGMSDLKCVQ---DAKGGTFYRDHCPVLG--------------------EQNGNRNPGGLQIGDLVNID-LDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN-RWTFNPAVLTKA-NVVRSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWA---EAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGAVLTESPSVPAERLSQLLKKLFETQESGDINEELVKAAA---NGDLAKVEDILKRPDVDVNGQCAGHTAMQAASQNGHVDVLKLLLKHSVDLEAEDKDGDRAVHHASFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADV--TITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVE----VAELLVHQGNANLDVQNVNQQTALHLAVERQHTQIVRLL--VRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADL--TIR---NKKGQSPLDLCPDPSLCKALAKCHKEKTSGQVGSRSPSLNSNNETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRT 870          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 117.857 bits (294), Expect = 2.005e-26
Identity = 192/914 (21.01%), Postives = 344/914 (37.64%), Query Frame = 1
Query:    7 MNSYLGLRVFPGPSWSYKFNDL----LGTVNKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSF---------YPKRTGKV---DSFTNKSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKS-------TLTELIKEWKDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVT----NTLPGDFVGVRFNLYPHRICMLLPRKACVDLDQRPDNSEILLPRKQIILKTNDSFD--EEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAVSVIESKNIRIIKSILNEFSISCKI---NWNTLLY--------SFVDLIYTYSAI-----DRSPEMLEVIINHTEFNY-----------QFTDENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLE--KFDKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNN--CIFHLSASLNGEECYKKWKNIVADKKIDLVE----------------NMIKKFNQFKDTSKSKY-------------------LDNFSIEEMPFAVISCLILSKSENALQTWRVKLDKTGKTPEDLFVESVKKLKLSYININK----YFIRFYRYLENKYDNEVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKV 2445
            M   +G RV  GP W +   D     +GTV    +  ++ V   WDNG    Y       +D+ I DSA  GIKH G  C+ C ++ I+G +W C EC  + LCT CY GD H    H FYRI +       +  R +  K   +GIF    V                R GKV     ++  S    +Y +       L R  +G+ G  ++K +    +    T YR+   +LG                    E +  ++    ++ D V +D  ++  ++  Q+ +G     + + +   G V  + E + I V + + N  + FN  +L K  N +R  +V   +        + +L++   D  + K+ +     W    E +     K+G +      + L  +  G  +   P  +  + P  + V        S++L    + + +T +S D  EE +K A    N D+ +    L     ++  Q     A+          +  +L + S+  +    + +  ++        S +++++   A       R    L + +N                    D  GD  LH A  K   D++ +LL++   +  ++  +  ++ALH+A    N   +++L+      ++++  K D  TALHLA  NN  E    + + L +  N  L  Q+ N     HL+      +  +    + A+ K+D+ +                + +++    +D SK +                    L     E+   A I+C + +   +   T R   +K G++P DL  +      L+  +  K       R      N    E C  C       ++ PCGH   C  CS    KC  C E ++ + 
Sbjct:   10 MMEGVGARVIRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVV--WDNGTAANYRCSGA--YDVRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKCAECTNYDLCTTCYHGDKHHLR-HRFYRITTPGSERVLLESRRKSKKITARGIFAGGRVVRGVDWQWEDQDGGNGRRGKVTEIQDWSAASPHSAAYVLWDNGAKNLYR--VGFEGMSDLKCVQ---DAKGGTFYRDHCPVLG--------------------EQNGNRNPGGLQIGDLVNID-LDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN-RWTFNPAVLTKA-NVVRSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWA---EAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGERLSQLL----KKLFETQESGDINEELVKAAA---NGDLAKVEDILKRPDVDVNGQCAGHTAMQAASQNGHVDVLKLLLKHSVDLEAEDKDGDRAVHHASFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADV--TITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVE----VAELLVHQGNANLDVQNVNQQTALHLAVERQHTQIVRLL--VRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTVRTEKCLKLIMGLGTQGAEKKSAASIACFLAANGADL--TIR---NKKGQSPLDLCPDPSLCKALAKCHKEKTSGQVGSRSPSLNSNNETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRT 867          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Zebrafish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:ZFIN;Acc:ZDB-GENE-050628-1])

HSP 1 Score: 70.8626 bits (172), Expect = 6.146e-12
Identity = 38/103 (36.89%), Postives = 57/103 (55.34%), Query Frame = 1
Query:  130 DNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIF 435
            D+G    Y  G +  FDLL+YD+AQIG++H    C+ C +  I+G +W C  C  + LCT+CYM + H   +H F R ++A+     +  R    +   KGIF
Sbjct:    1 DSGTRTNYRSGYQGAFDLLLYDNAQIGVRHSNIICDSCKKHGIMGMRWKCKVCFDYDLCTQCYMNNKHDL-THAFERYETAHSQPVSLTPRQNLSRIILKGIF 102          

HSP 2 Score: 55.4546 bits (132), Expect = 3.086e-7
Identity = 78/343 (22.74%), Postives = 133/343 (38.78%), Query Frame = 1
Query: 1729 YSALHYAVENNNCEIIKILMRYN-CDIYLLEKFDKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNNCIFHLSASLNGEECYKKWKNIVADKKIDLVENMIKKFNQFKDTSKSKYLDNFSIEEMPFAVISCLILSKSENALQTWRVKLDKTGKTPEDLFVES-VKKLKLSYININKYF--------------IRFYRYLENKYDNEV---------CKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKVFDGDKNHLITYDNWE-ELSKSVKDNECPVTMADWYLYISKTIRRLECTVCKSRNWDIVFKCGHQLCDDCFKNSKKCVLC 2679
            +SALH A  NN+ ++ +IL++   CDI +    ++ T L LA+      +L ++L      +N    D+  +   H S S       ++   +++  + D           +     S  + N  +     A I+C +    E A  ++    +  GK+P DL  +S V+ L  S+   ++                +R      N   N           C  C    + V++ PC H + CE C+    KC  C   I +K         I  D  E E S S +++E    +        +   R+ C +C   +  +VF+CGH  C DC    K C +C
Sbjct:  568 FSALHLAALNNHRDVAEILLKEGRCDINIRNNRNQ-TPLQLAVTQGHM-ALVALLVMEGADVNAE--DEDGDTAMHTSLS------RQQLTTVISSAEGD-------GAVLYGRLCSSGLMGNTELN--VGAAIACFL--AQEGADISY---ANHKGKSPLDLVTDSSVQTLIRSFAEKHRLHAVSCGTGSSSSSSSLRRVHTTPNTMTNLAVPSVTGPSECLICSELALLVLFSPCQHSVACEECAHRMKKCIRCQVTITKK---------IRQDQTEVECSPSSENSEQHHLLEQLQSRYRQMEERITCPICIDNHIRLVFQCGHASCIDCSSALKTCPIC 877          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Zebrafish
Match: gabpb1 (GA binding protein transcription factor subunit beta 1 [Source:ZFIN;Acc:ZDB-GENE-061027-46])

HSP 1 Score: 64.6994 bits (156), Expect = 2.130e-10
Identity = 39/95 (41.05%), Postives = 63/95 (66.32%), Query Frame = 1
Query: 1633 LHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLEKFDKSTALHLALKNNCFESLCSILD-SLTNSLN 1914
            LH+A  + ++ +VELLLK     VN+ +M  + SALH+AVE+ +  ++++L+RY  D++ L KF K+ AL +AL N+C E L  IL  ++ N +N
Sbjct:   75 LHMAASEGHLRIVELLLK-HGADVNAKDM-LQMSALHWAVEHTHTAVVELLLRYGADVHALSKFCKN-ALDIALDNSCHE-LAHILQVAMQNQIN 165          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 120.168 bits (300), Expect = 5.249e-27
Identity = 154/655 (23.51%), Postives = 271/655 (41.37%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFND----LLGTVNKINNLN-----DLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSF------YPKRTGKVDSFTN----KSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFE-LDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKSTLTELIKEWKDSIKWKMTKIDDIYWVPD-TEIIEMIHEKIGVIVTNTLPGDFVGVRFNLYPHRICMLLPRKACVDLDQRPDNSEILLPRKQIILKTNDSFDEEQIKKAIIMLNEDVDEFTKWLDAE-KSNLTIQAWNQLAVSVIESKNIRIIKSILNEFS--ISCKINWNTLLYSFVDLIYTYSAIDRSPEMLEVIINHTEFNYQFTDENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLEKFDKSTALHLALKNNCFESLCSILDSLTN 1905
            +G+RV  G  W +   D     +GTV +I         D  V V+WD+G    Y  G +  +DLL+YD+AQ G++H    C+ C +  I G +W C  C  + LCT+CYM + H   SH F R ++A+     +  R    +   KGIF  ++V               GKV    +      +T RS A V  +        +G+ G+V++K +      +    YR+ L  LG+ A    E  +   +E   F+  D  K ++D E+             L++ Q  +G  N K+ + IG+ G V ++ E   ++V + N    + F+   L K           N   + ++++   +    K  ++    W  D    +  I + I V     +     G  +   P          AC+   QR +++ ++            + + ++ K  ++ + E +   ++  D E  ++L I+A            N   ++ +L ++   +  K    T L     L Y         E+++V++     N    D+ GD  LH A   N   +V +LL S+      +N + K +AL+ AV     E++++L   NC I + + F   T LH A+  + F S+  IL  + N
Sbjct:   11 VGMRVVRGIDWKWSNQDNGEGSMGTVVEIGRQGSPTTPDKTVVVQWDHGTRTNYRTGFQGAYDLLLYDNAQTGVRHPNIICDCCKKHGIRGMRWKCKVCFDYDLCTQCYMNNKHDL-SHIFERYETADSRPVILSTRQGLPRVVLKGIFQGAKVVRGPDWEWGNQDGGEGKVGRVVDIRGWDVETGRSVASVTWADGTTNVYRVGHKGKVDLKCITDAPGGH---YYRDHLPKLGKPA----ELQRKESSERHPFQHGDKVKCLLDVEI-------------LREMQEGHGGWNPKMAEFIGQTGTVHRITERGDVRVQY-NSETRWTFHPGALTK----------QNSFWVGDVVRVMDNMDAVKKLQVGHGEWTDDMVSALGQIGKVIKVFGDGDMRVSVGGQSWTFNP----------ACLTSYQREEDANLMT-----------TENAKESKNTLVSILEKL--LSQKTDCESPTSLVIEA---------AQGNTAKVREMLQKYPDKVDIKNQGRTALQVASHLGYM--------EVVKVLL-QANANIDLRDDEGDTALHYAAYGNQAGVVRVLL-SKGANAELLN-NAKCTALYIAVNKGFTEVVQVLCNPNCAINMQDSFG-DTPLHYAITAD-FRSIIEILTEVPN 588          

HSP 2 Score: 76.2554 bits (186), Expect = 2.124e-13
Identity = 99/427 (23.19%), Postives = 167/427 (39.11%), Query Frame = 1
Query: 1483 CKINWNTLLYSFVDLIYTYSAIDRSPEMLEVIINHTEFNYQFTDENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYN-CDIYLLEKFDKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNNCIFHLSASLNGEECYKKWKNIVADKKIDLVENMIKKFNQFKDTSKSKYLDNFSIEEMPF-------AVISC-LILSKSENALQTWRVKLDKTGKTPEDLFVESVKKL-----KLSYININKYFI----RFYRYLENKYDN---------EVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKVFDGDKNHLITYDNWE-ELSKSVKDNECPVTMADWYLYISKTIRRLECTVCKSRNWDIVFKCGHQLCDDCFKNSKKCVLC 2679
            C IN   +  SF D    Y+       ++E++      ++   +  G N+LH +  K  V  V  +L+    +V+S      ++ALH A  NN+ E+++IL++   CD+ L    ++ T LHLA+      SL  +L  +T   +    D+  +   H                      I  V   +K  +  ++ + S  L       +P        + ++C L LS ++      R      GK+P DL V  V+ L       + I+++   +    R      N   N           C  C    V V + PC H I CE CS    KC +C   I  K         +  D+ E E S S++ ++    M +      +   R+ C +C   +  +VF+CGH  C +C  +   C +C
Sbjct:  555 CAIN---MQDSFGDTPLHYAITADFRSIIEILTEVPNIDFTVQNNQGFNLLHHSALKGNVLAVSKILERARQLVDS-KKEDGFTALHLATLNNHQEVVEILIKEGRCDVNLRNNRNQ-TPLHLAVAQGHI-SLVHLL--VTEGADVNAEDEDGDTPMH----------------------IVFVRQHLKSIDSQQEGNGSSLLTKLEASGLPGNIELNVGSAMACFLALSGADINYANHR------GKSPLDLIVFPVQDLLCFHVSHAIISLDSPTVSCSLRRVHTTPNTMTNLSPCSAASPAECLVCSELAVLVSFFPCQHSIVCEECSRRMKKCIKCQVCIARK---------LRQDSTEVECSPSLEVSDQKKVMEELQNRYRQMEERITCPICIDNHIKLVFQCGHGSCTECSTSLTACPIC 936          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Xenopus
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:100170182])

HSP 1 Score: 108.997 bits (271), Expect = 1.738e-23
Identity = 214/991 (21.59%), Postives = 352/991 (35.52%), Query Frame = 1
Query:    7 MNSYLGLRVFPGPSWSYKFNDL----LGTVNKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSF---------YPKRTGKVDSFTNKSDTYRSYAIVKLSTNKLERC-LLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIHNEMR---MVQVTNKST----LTELIKEWKDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVT----NTLPGDFVGVRFNLYPHRICMLLPRKACVDLDQRPDNSEILLPRKQIILKTNDSFD--EEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAVSVIESKNIRIIKSILNEFSISCKINWNTLLYSFVDLIYTYSAIDRSPEMLEVIINHTEFNYQFTDENGDNMLHIATKKNYVDLVELLLK-SQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDI------------------------YLLEKF-----------DKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNN--CIFHLSASLNGEECYK-----KWKNIVADKKID------LVENMIKKFNQFKDTSKSKYLDNF---------------SIEEMPFAVISCLILSKSENALQTWRVKLDKTGKTPEDLFVESVKKLKLSYININKYFIRFYRYLENKYDN-----EVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKVFDGDKNHLITYDNWEELSKSVKDNECPVTMADWYLYISKTIRRLECTVCKSRNWDIVFK-CGHQ-LCDDCFKNSKKCVLC 2679
            M   +G RV  GP W +   D     +GTV    +  ++ V   WDNG    Y       +DL I DSA  GIKH G  C+ C ++ I+G +W C EC  + LCT CY GD H    H FYRI +       +  R +  K   +GIF  + V                R GKV    + S +    A   L  N  +    +G+ G  ++K +    +    + YR+   +LG                    E +  ++     + D V +D   +  ++  Q+ +G     + + +   G V  + E + I V + + N  + FN  +L K  N +R     Q     T    + +L++   D  + K+ +     W    E +     K+G +      N L  +  G  +   P  +     R A V         E L    + + +T +S D  EE +K A    N DV +    L  +  ++  Q     A+          I  +L + S+  +           D    ++A      ++EV ++    +    ++     LHIA  K ++ +V+ LL    H    S+  S   + LH A+     +I+ +L+    D+                         LL K            D  TALHLA  NN  E    + + L +  N  L  Q+ N     HL+      +  +     + K  + DK  D      L  + + +  Q +D      +D                   E+   A I+C + +   +   T R   +K G++P DL  +      L+  +  K   +   +  +   N     E C  C       ++ PCGH   C  CS    KC  C E ++ +                                          +  EC VC  +   ++F+ CGH   C++C    KKCV C
Sbjct:   10 MVEGVGARVARGPDWKWGKQDGGEGHVGTVRSFESPEEVVVV--WDNGTAANYRCSGA--YDLRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKCAECTNYDLCTVCYHGDKHHLR-HRFYRITTPGSERVLLESRRKSKKITARGIFAGARVVRGVDWQWEDQDGGNGRRGKVTEIQDWSASSPHSAAYVLWDNGAKNLYRVGFEGMSDLKCVQ---DAKGGSFYRDHCPVLG--------------------EQNGNRNPGGLLIGDLVNID-LELEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN-RWTFNPAVLTKA-NVVRSGDAAQGAEGGTSPFQVGDLVQICYDLERIKLLQRGHGEWA---EAMLPTLGKVGRVQQIYSDNDLKVEVCGTSWTYNPAAV----SRVASVGSAISNATGERLSQLLKKLFETQESGDLNEELVKAAA---NGDVAKVEDLLKRQDVDVNGQCAGHTAMQAASQNGHVDILKLLLKHSVDVEAE-----DKDGDRAVHHAAFGDEGTVVEV-LHRGGADLNARNKRRQTPLHIAVNKGHLQVVKKLLDFGCH---PSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVE----VAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDTTWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADL--TIR---NKKGQSPLDLCPDPNLCKALAKCHKEKSSGQVGSHSPSMISNDSETLEECMVCSDLKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRT-----------------------------------------KIEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQC 900          

HSP 2 Score: 82.0333 bits (201), Expect = 3.515e-15
Identity = 91/401 (22.69%), Postives = 163/401 (40.65%), Query Frame = 1
Query: 1537 YSAIDRSPEMLEVIINHTEFNYQFTDENGDN---MLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLEKFDKSTALHLALKNNCFESLCSILDSL-TNSLNPTLVDQHNNCIFHLSASLNGEECYKKWKNIVADKKIDLVENMIKKFNQF---KDTSKSKYLDNFSIEEMPFAVIS--CLILSKSENALQTWRVKLDKTGKTPEDLFVE--SVKKLKLSYININKYFIRFYRYLENKYDNEVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKVF-----DGDKNHLITYD----NWEELSKSVKDNECPVTMADWYLYISKTIRRLECTVCKSRNWDIVFKCGHQLCDDCFKNSKKCVLC 2679
            ++A+  +P  + V+++     +   DE  D+    LH+A   N+V++ ELL+   +  ++  N++ + +ALH AVE  + +I+++L+R    + + +K D  T LH AL+++    L  + D      ++ T     N  I  L      ++        +A    DL     K  +      D +  K L     E+    V S    ++S     L+   V  D    T   LF     +    L    + K  I     ++++   E C  C     +V+++PCGH   CE C+ +  KC +C   +E +V       G     +T D    N + L K   +      +      +     +  C VC  R  +++F CGH  C  C     +C +C
Sbjct:  602 HAALRGNPSAMRVLLSKLPRPW-IVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVN-QQTALHLAVERQHTQIVRLLVRAEAKLDIQDK-DGDTPLHEALRHHTLSQLRQLQDMQDVGKVDTTWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPNLCKALAKCHKEKSSGQVGSHSPSMISNDSETLEECMVCSDLKRDT---LFGPCGHIATCSLCSPRVKKCLI-CKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQCRAVVERRVPFVMCCSGKGTEDVTDDIAGGNIQALQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPIC 995          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 100.523 bits (249), Expect = 5.249e-21
Identity = 92/336 (27.38%), Postives = 149/336 (44.35%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFND----LLGTVNKINNLN-----DLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSF------YPKRTGKVDSFTN----KSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFEL-DMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYK 960
            +G+RV  G  W +   D     +GTV +I         D  V V+WD+G    Y  G +  +DLL+YD+AQ G++H    C+ C +  I G +W C  C  + LCT+CYM + H   SH F R ++A+     +  R    +   KGIF  ++V               GKV    +      +T RS A V  +        +G+ G+V++K +      +    YR+ L  LG+ A    E  +   +E   F+  D  K ++D E+             L++ Q  +G  N K+ + IG+ G V ++ E   ++V + N    + F+   L K
Sbjct:   24 VGMRVVRGIDWKWSNQDNGEGSMGTVVEIGRQGSPTTPDKTVVVQWDHGTRTNYRTGFQGAYDLLLYDNAQTGVRHPNIICDCCKKHGIRGMRWKCKVCFDYDLCTQCYMNNKHDL-SHIFERYETADSRPVILSTRQGLPRVVLKGIFQGAKVVRGPDWEWGNQDGGEGKVGRVVDIRGWDVETGRSVASVTWADGTTNVYRVGHKGKVDLKCITDAPGGH---YYRDHLPKLGKPA----ELQRKESSERHPFQHGDKVKCLLDVEI-------------LREMQEGHGGWNPKMAEFIGQTGTVHRITERGDVRVQY-NSETRWTFHPGALTK 337          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 100.523 bits (249), Expect = 6.182e-21
Identity = 92/336 (27.38%), Postives = 149/336 (44.35%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFND----LLGTVNKIN-----NLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSF------YPKRTGKVDSFTN----KSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFEL-DMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYK 960
            +G+RV  G  W +   D     +GTV +I         D  V V+WD+G    Y  G +  +DLL+YD+AQ G++H    C+ C +  I G +W C  C  + LCT+CYM + H   SH F R ++A+     +  R    +   KGIF  ++V               GKV    +      +T RS A V  +        +G+ G+V++K +      +    YR+ L  LG+ A    E  +   +E   F+  D  K ++D E+             L++ Q  +G  N K+ + IG+ G V ++ E   ++V + N    + F+   L K
Sbjct:   11 VGMRVVRGIDWKWSNQDNGEGSMGTVVEIGRQGSPTTPDKTVVVQWDHGTRTNYRTGFQGAYDLLLYDNAQTGVRHPNIICDCCKKHGIRGMRWKCKVCFDYDLCTQCYMNNKHDL-SHIFERYETADSRPVILSTRQGLPRVVLKGIFQGAKVVRGPDWEWGNQDGGEGKVGRVVDIRGWDVETGRSVASVTWADGTTNVYRVGHKGKVDLKCITDAPGGH---YYRDHLPKLGKPA----ELQRKESSERHPFQHGDKVKCLLDVEI-------------LREMQEGHGGWNPKMAEFIGQTGTVHRITERGDVRVQY-NSETRWTFHPGALTK 324          

HSP 2 Score: 54.6842 bits (130), Expect = 7.869e-7
Identity = 79/352 (22.44%), Postives = 134/352 (38.07%), Query Frame = 1
Query: 1729 YSALHYAVENNNCEIIKILMRYN-CDIYLLEKFDKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNNCIFHLSASLNGEECYKKWKNIVADKKIDLVENMIKKFNQFKDTSKSKYLDNFSIEEMPF-------AVISC-LILSKSENALQTWRVKLDKTGKTPEDLFVESVKKLKLSYI--NINKYF--------------IRFYRYLENKYDN---------EVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKVFDGDKNHLITYDNWE-ELSKSVKDNECPVTMADWYLYISKTIRRLECTVCKSRNWDIVFKCGHQLCDDCFKNSKKCVLC 2679
            ++ALH A  NN+ E+++IL++   CD+ L    ++ T LHLA+      SL  +L  +T   +    D+  +   H                      I  V   +K  +  ++ + S  L       +P        + ++C L LS ++      R      GK+P DL  +     +++++  N  + F              +R      N   N           C  C    V V + PC H I CE CS    KC +C   I  K         +  D+ E E S S++ ++    M +      +   R+ C +C   +  +VF+CGH  C +C  +   C +C
Sbjct:  633 FTALHLATLNNHQEVVEILIKEGRCDVNLRNNRNQ-TPLHLAVAQGHI-SLVHLL--VTEGADVNAEDEDGDTPMH----------------------IVFVRQHLKSIDSQQEGNGSSLLTKLEASGLPGNIELNVGSAMACFLALSGADINYANHR------GKSPLDLIADG----RITHLVKNFAQKFREQVELDSPTVSCSLRRVHTTPNTMTNLSPCSAASPAECLVCSELAVLVSFFPCQHSIVCEECSRRMKKCIKCQVCIARK---------LRQDSTEVECSPSLEVSDQKKVMEELQNRYRQMEERITCPICIDNHIKLVFQCGHGSCTECSTSLTACPIC 939          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 100.138 bits (248), Expect = 8.277e-21
Identity = 92/336 (27.38%), Postives = 149/336 (44.35%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFND----LLGTVNKINNLN-----DLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSF------YPKRTGKVDSFTN----KSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFEL-DMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYK 960
            +G+RV  G  W +   D     +GTV +I         D  V V+WD+G    Y  G +  +DLL+YD+AQ G++H    C+ C +  I G +W C  C  + LCT+CYM + H   SH F R ++A+     +  R    +   KGIF  ++V               GKV    +      +T RS A V  +        +G+ G+V++K +      +    YR+ L  LG+ A    E  +   +E   F+  D  K ++D E+             L++ Q  +G  N K+ + IG+ G V ++ E   ++V + N    + F+   L K
Sbjct:   28 VGMRVVRGIDWKWSNQDNGEGSMGTVVEIGRQGSPTTPDKTVVVQWDHGTRTNYRTGFQGAYDLLLYDNAQTGVRHPNIICDCCKKHGIRGMRWKCKVCFDYDLCTQCYMNNKHDL-SHIFERYETADSRPVILSTRQGLPRVVLKGIFQGAKVVRGPDWEWGNQDGGEGKVGRVVDIRGWDVETGRSVASVTWADGTTNVYRVGHKGKVDLKCITDAPGGH---YYRDHLPKLGKPA----ELQRKESSERHPFQHGDKVKCLLDVEI-------------LREMQEGHGGWNPKMAEFIGQTGTVHRITERGDVRVQY-NSETRWTFHPGALTK 341          

HSP 2 Score: 59.3066 bits (142), Expect = 3.360e-8
Identity = 76/339 (22.42%), Postives = 124/339 (36.58%), Query Frame = 1
Query: 1729 YSALHYAVENNNCEIIKILMRYN-CDIYLLEKFDKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNNCIFHLSASLNGEECYKKWKNIVADKKIDLVENMIKKFNQFKDTSKSKYLDNFSIEEMPF-------AVISC-LILSKSENALQTWRVKLDKTGKTPEDLFVES-VKKLKLSYININKYFIRFYRYLENKYDNEV------------CKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKVFDGDKNHLITYDNWEELSKSVKDNECPVTMADWYLYISKTIRRLECTVCKSRNWDIVFKCGHQLCDDCFKNSKKCVLC 2679
            ++ALH A  NN+ E+++IL++   CD+ L    ++ T LHLA+      SL  +L  +T   +    D+  +   H                      I  V   +K  +  ++ + S  L       +P        + ++C L LS ++      R      GK+P DL  +  +  L  ++    +Y      Y+    +               C  C    V V + PC H I CE CS    KC +C   I  K+  G           EEL    +  E                 R+ C +C   +  +VF+CGH  C +C  +   C +C
Sbjct:  650 FTALHLATLNNHQEVVEILIKEGRCDVNLRNNRNQ-TPLHLAVAQGHI-SLVHLL--VTEGADVNAEDEDGDTPMH----------------------IVFVRQHLKSIDSQQEGNGSSLLTKLEASGLPGNIELNVGSAMACFLALSGADINYANHR------GKSPLDLIADGRITHLVKNFAQKFRYQRAILPYIHTTPNTMTNLSPCSAASPAECLVCSELAVLVSFFPCQHSIVCEECSRRMKKCIKCQVCIARKLRQGGLEVSDQKKVMEELQNRYRQME----------------ERITCPICIDNHIKLVFQCGHGSCTECSTSLTACPIC 940          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Mouse
Match: Mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:MGI Symbol;Acc:MGI:2443157])

HSP 1 Score: 124.405 bits (311), Expect = 2.065e-28
Identity = 208/984 (21.14%), Postives = 367/984 (37.30%), Query Frame = 1
Query:    7 MNSYLGLRVFPGPSWSYKFNDL----LGTVNKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSF---------YPKRTGKVDSFTNKSDTYRSYAIVKLSTNKLERC-LLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYK--IHNEMRMVQVTNKST----LTELIKEWKDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVT----NTLPGDFVGVRFNLYPHRICMLLPRKACVDLDQRPDNSEILLPRKQIILKTNDSFD--EEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAV-SVIESKNIRIIKSILNE---FSISCKINWNTLLY-------SFVDLIYTYSAI-----DRSPEMLEVIINHTEFNY-----------QFTDENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLE--KFDKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNN--CIFHLSASLNGEECYK-----KWKNIVADKKID------LVENMIKKFNQFKDTSKSKYLDNF---------------SIEEMPFAVISCLILSKSENALQTWRVKLDKTGKTPEDL-----FVESVKKLKLSYININKYFIRFYRYLENKYDN-EVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKVFDGDKNHLITYDNWEELSKSVKDNECPVTMADWYLYISKTIRRLECTVCKSRNWDIVFK-CGHQ-LCDDCFKNSKKCVLC 2679
            M   +G RV  GP W +   D     +GTV    +  ++ V   WDNG    Y       +DL I DSA  GIKH G  C+ C ++ I+G +W C EC  + LCT CY GD H    H FYRI +       +  R +  K   +GIF  + V                R GKV    + S +    A   L  N  +    +G+ G  ++K +    +    + YR+   +LG                    E +  ++    ++ D V +D  ++  ++  Q+ +G     + + +   G V  + E + I V + + N  + FN  +L K  I       Q     T    + +L++   D  + K+ +     W    E +     K+G +      + L  +  G  +   P  +  + P  + +        S++L    + + +T +S D  EE +K A    N DV +    L     ++  Q     A+ +  ++ ++ I+K +L +        K     + +       + +++++  SA       R    L + +N                    D  GD  LH A  K   D++ +LL++   +  ++  +  ++ALH+A    N   +++L+      ++++  K D  TALHLA  NN  E    + + L +  N  L  Q+ N     HL+      +  +       K  + DK  D      L  + + +  Q +D      +D                   E+   A I+C + +   +   + R   +K G++P DL       +++ K     ++  +   R    + N  +  E C  C       ++ PCGH   C  CS    KC  C E ++ +                                          +  EC VC  +   ++F+ CGH   C++C    KKCV C
Sbjct:   10 MVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVV--WDNGTAANYRCSGA--YDLRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKCAECTNYDLCTVCYHGDKHHLR-HRFYRITTPGSERVLLESRRKSKKITARGIFAGARVVRGVDWQWEDQDGGNGRRGKVTEIQDWSASSPHSAAYVLWDNGAKNLYRVGFEGMSDLKCVQ---DAKGGSFYRDHCPVLG--------------------EQNGNRNPGGLQIGDLVNID-LDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN-RWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWA---EAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKVAPAGSAISNASGERLSQLL----KKLFETQESGDLNEELVKAAA---NGDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADV--TITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVE----VAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADL--SIR---NKKGQSPLDLCPDPSLCKALAKCHKEKVS-GQVGSRSPSMISNDSETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRT-----------------------------------------KIEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQC 900          

HSP 2 Score: 85.5001 bits (210), Expect = 2.359e-16
Identity = 138/692 (19.94%), Postives = 270/692 (39.02%), Query Frame = 1
Query:  754 FEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCVKLVEGN---RIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKSTLTELIKEWKDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVTNTLPGDFVGVRFNLYPHRICMLLPRKACVDLDQRPDNSEILLPRKQIILKTNDSFDEEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAVSVIESKNIRIIKSILN----------------EFSISCKIN--WNTLLYSFVDLIYT---------YSAIDRSPEMLEVIINHTEFNYQFTDENGDN---MLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLEKFDKSTALHLALKNNCFESLCSILDSL-TNSLNPTLVDQHNNCIFHLSASLNGEECYKKWKNIVADKKIDLVENMIKKFNQF---KDTSKSKYLDNFSIEEMPFAVIS--CLILSKSENALQTWRVKLDKTGKTPEDLFVE--SVKKLKLSYININKYFIRFYRYLENKYDNEVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKV---------FDGDKNHLITYDNWEELSKSVKDNECPVTMADWYLYISKTIRRLECTVCKSRNWDIVFKCGHQLCDDCFKNSKKCVLC 2679
            F+V D V V C+++  +K  Q  +GE    +   +GK G V+ +  +   +++VC       + +N   + K+      +   +   L++L+K+      ++  +  D+    + E+++         V + L    V V      H       +   VD+ +       LL ++ + ++  D   +  +  A       V E      A+ +    +    L ++V    +++++K++L+                  +IS K +     LL +  D+  T         ++A+  +P  + V+++     +   DE  D+    LH+A   N+V++ ELL+   +  ++  N++ + +ALH AVE  + +I+++L+R    + + +K D  T LH AL+++    L  + D      ++       N  I  L      ++        +A    DL     K  +      D S  K L     E++   V S    ++S     L+   V  D    T   LF     +    L    + K  I     ++++   E C  C     +V+++PCGH   CE C+ +  KC +C   +E +V            D +  I+  N   L K   +      +      +     +  C VC  R  +++F CGH  C  C     +C +C
Sbjct:  333 FQVGDLVQV-CYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVC----GTSWTYNPAAVSKVAPAGSAISNASGERLSQLLKKL-----FETQESGDL----NEELVKAAANGDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILK-------LLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAV-NKGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPW-IVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVN-QQTALHLAVERQHTQIVRLLVRAGAKLDIQDK-DGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPSLCKALAKCHKEKVSGQVGSRSPSMISNDSETLEECMVCSDMKRDT---LFGPCGHIATCSLCSPRVKKCLI-CKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQCRAVVERRVPFITCCGGKSSEDPSDEISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPIC 995          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Mouse
Match: Mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:MGI Symbol;Acc:MGI:2443157])

HSP 1 Score: 124.405 bits (311), Expect = 2.065e-28
Identity = 208/984 (21.14%), Postives = 367/984 (37.30%), Query Frame = 1
Query:    7 MNSYLGLRVFPGPSWSYKFNDL----LGTVNKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSF---------YPKRTGKVDSFTNKSDTYRSYAIVKLSTNKLERC-LLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYK--IHNEMRMVQVTNKST----LTELIKEWKDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVT----NTLPGDFVGVRFNLYPHRICMLLPRKACVDLDQRPDNSEILLPRKQIILKTNDSFD--EEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAV-SVIESKNIRIIKSILNE---FSISCKINWNTLLY-------SFVDLIYTYSAI-----DRSPEMLEVIINHTEFNY-----------QFTDENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLE--KFDKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNN--CIFHLSASLNGEECYK-----KWKNIVADKKID------LVENMIKKFNQFKDTSKSKYLDNF---------------SIEEMPFAVISCLILSKSENALQTWRVKLDKTGKTPEDL-----FVESVKKLKLSYININKYFIRFYRYLENKYDN-EVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKVFDGDKNHLITYDNWEELSKSVKDNECPVTMADWYLYISKTIRRLECTVCKSRNWDIVFK-CGHQ-LCDDCFKNSKKCVLC 2679
            M   +G RV  GP W +   D     +GTV    +  ++ V   WDNG    Y       +DL I DSA  GIKH G  C+ C ++ I+G +W C EC  + LCT CY GD H    H FYRI +       +  R +  K   +GIF  + V                R GKV    + S +    A   L  N  +    +G+ G  ++K +    +    + YR+   +LG                    E +  ++    ++ D V +D  ++  ++  Q+ +G     + + +   G V  + E + I V + + N  + FN  +L K  I       Q     T    + +L++   D  + K+ +     W    E +     K+G +      + L  +  G  +   P  +  + P  + +        S++L    + + +T +S D  EE +K A    N DV +    L     ++  Q     A+ +  ++ ++ I+K +L +        K     + +       + +++++  SA       R    L + +N                    D  GD  LH A  K   D++ +LL++   +  ++  +  ++ALH+A    N   +++L+      ++++  K D  TALHLA  NN  E    + + L +  N  L  Q+ N     HL+      +  +       K  + DK  D      L  + + +  Q +D      +D                   E+   A I+C + +   +   + R   +K G++P DL       +++ K     ++  +   R    + N  +  E C  C       ++ PCGH   C  CS    KC  C E ++ +                                          +  EC VC  +   ++F+ CGH   C++C    KKCV C
Sbjct:   10 MVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVV--WDNGTAANYRCSGA--YDLRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKCAECTNYDLCTVCYHGDKHHLR-HRFYRITTPGSERVLLESRRKSKKITARGIFAGARVVRGVDWQWEDQDGGNGRRGKVTEIQDWSASSPHSAAYVLWDNGAKNLYRVGFEGMSDLKCVQ---DAKGGSFYRDHCPVLG--------------------EQNGNRNPGGLQIGDLVNID-LDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN-RWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWA---EAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKVAPAGSAISNASGERLSQLL----KKLFETQESGDLNEELVKAAA---NGDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADV--TITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVE----VAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADL--SIR---NKKGQSPLDLCPDPSLCKALAKCHKEKVS-GQVGSRSPSMISNDSETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRT-----------------------------------------KIEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQC 900          

HSP 2 Score: 85.5001 bits (210), Expect = 2.359e-16
Identity = 138/692 (19.94%), Postives = 270/692 (39.02%), Query Frame = 1
Query:  754 FEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCVKLVEGN---RIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKSTLTELIKEWKDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVTNTLPGDFVGVRFNLYPHRICMLLPRKACVDLDQRPDNSEILLPRKQIILKTNDSFDEEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAVSVIESKNIRIIKSILN----------------EFSISCKIN--WNTLLYSFVDLIYT---------YSAIDRSPEMLEVIINHTEFNYQFTDENGDN---MLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLEKFDKSTALHLALKNNCFESLCSILDSL-TNSLNPTLVDQHNNCIFHLSASLNGEECYKKWKNIVADKKIDLVENMIKKFNQF---KDTSKSKYLDNFSIEEMPFAVIS--CLILSKSENALQTWRVKLDKTGKTPEDLFVE--SVKKLKLSYININKYFIRFYRYLENKYDNEVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKV---------FDGDKNHLITYDNWEELSKSVKDNECPVTMADWYLYISKTIRRLECTVCKSRNWDIVFKCGHQLCDDCFKNSKKCVLC 2679
            F+V D V V C+++  +K  Q  +GE    +   +GK G V+ +  +   +++VC       + +N   + K+      +   +   L++L+K+      ++  +  D+    + E+++         V + L    V V      H       +   VD+ +       LL ++ + ++  D   +  +  A       V E      A+ +    +    L ++V    +++++K++L+                  +IS K +     LL +  D+  T         ++A+  +P  + V+++     +   DE  D+    LH+A   N+V++ ELL+   +  ++  N++ + +ALH AVE  + +I+++L+R    + + +K D  T LH AL+++    L  + D      ++       N  I  L      ++        +A    DL     K  +      D S  K L     E++   V S    ++S     L+   V  D    T   LF     +    L    + K  I     ++++   E C  C     +V+++PCGH   CE C+ +  KC +C   +E +V            D +  I+  N   L K   +      +      +     +  C VC  R  +++F CGH  C  C     +C +C
Sbjct:  333 FQVGDLVQV-CYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVC----GTSWTYNPAAVSKVAPAGSAISNASGERLSQLLKKL-----FETQESGDL----NEELVKAAANGDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILK-------LLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAV-NKGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPW-IVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVN-QQTALHLAVERQHTQIVRLLVRAGAKLDIQDK-DGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPSLCKALAKCHKEKVSGQVGSRSPSMISNDSETLEECMVCSDMKRDT---LFGPCGHIATCSLCSPRVKKCLI-CKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQCRAVVERRVPFITCCGGKSSEDPSDEISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPIC 995          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Mouse
Match: Mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:MGI Symbol;Acc:MGI:2679684])

HSP 1 Score: 81.2629 bits (199), Expect = 3.943e-15
Identity = 90/394 (22.84%), Postives = 159/394 (40.36%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFNDL----------LGTVNKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEV---------CHSFYPKRTGKVDSFTN-KSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFEL-DMAKSVID-----------------------FEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCG-CVKLVEGNRIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKSTLTELIKEWKDSIKWKMTKI 1062
            +G+RV  G  W +   D           LG  +   +  D  V V+WD G    Y  G +   DLL+YD+AQIGI+H    C+ C +  + G +W C  C  + LCT+CYM + H   +H F R ++++     +  R    +   +GIF  ++V                +TG+V        +T RS A V  +        +G+ G+V+++ +    E      Y+  L  LG+ A    E  +    + + F+  D  K ++D                       F V D V V   ++ ++K+ Q  +GE    +   +G+ G  VK+     ++V        +  +  + Y+   +  +        + E  +E K S+   + K+
Sbjct:   11 VGMRVVRGMDWKWGQQDGGEGGVGTVVELGR-HGSPSTPDRTVVVQWDQGTRTNYRAGYQGAHDLLLYDNAQIGIRHPNIICDCCKKHGLRGMRWKCRVCFDYDLCTQCYMHNKHDL-THAFERYETSHSRPVTLSPRQGLPRIPLRGIFQGAKVVRGPDWEWGSQDGGEGKTGRVVDIRGWDVETGRSVASVTWADGTTNVYRVGHKGKVDLRCVG---EAAGGFYYKEHLPKLGKPA----ELQRRVSADGQPFQRGDKVKCLLDTDVLRDMQEGHGGWNPRMAEHNSFWVGDVVRV-IGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVGGQRWTFSPSCLVAYRPEEDANL-------DVAERARENKSSLSVALDKL 387          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Mouse
Match: Mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:MGI Symbol;Acc:MGI:2443157])

HSP 1 Score: 77.0258 bits (188), Expect = 6.148e-14
Identity = 93/407 (22.85%), Postives = 168/407 (41.28%), Query Frame = 1
Query: 1537 YSAIDRSPEMLEVIINHTEFNYQFTDENGDN---MLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLEKFDKSTALHLALKNNCFESLCSILDSL-TNSLNPTLVDQHNNCIFHLSASLNGEECYKKWKNIVADKKIDLVENMIKKFNQF---KDTSKSKYLDNFSIEEMPFAVIS--CLILSKSENALQTWRVKLDKTGKTPEDLF--VESVKKLKLSYININKYFIRFYRYLENKYDNEVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKVFDGDKNHLIT---YDNWEELSKSVKDNECPVTMADW-YLYISKTIRRLE-----------CTVCKSRNWDIVFKCGHQLCDDCFKNSKKCVLC 2679
            ++A+  +P  + V+++     +   DE  D+    LH+A   N+V++ ELL+   +  ++  N++ + +ALH AVE  + +I+++L+R    + + +K D  T LH AL+++    L  + D      ++       N  I  L      ++        +A    DL     K  +      D S  K L     E++   V S    ++S     L+   V  D    T   LF     +    L    + K  I     ++++   E C  C     +V+++PCGH   CE C+ +  KC +C   +E +V        IT     + E+ S  +     PV   D     ++  +++L+           C VC  R  +++F CGH  C  C     +C +C
Sbjct:  237 HAALRGNPSAMRVLLSKLPRPW-IVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVN-QQTALHLAVERQHTQIVRLLVRAGAKLDIQDK-DGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPSLCKALAKCHKEKVSGQVGSRSPSMISNDSETLEECMVCSDMKRDT---LFGPCGHIATCSLCSPRVKKCLI-CKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQCRAVVERRVP------FITCCGGKSSEDPSDEISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPIC 630          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Mouse
Match: Gabpb2 (GA repeat binding protein, beta 2 [Source:MGI Symbol;Acc:MGI:95612])

HSP 1 Score: 64.6994 bits (156), Expect = 2.630e-10
Identity = 33/94 (35.11%), Postives = 62/94 (65.96%), Query Frame = 1
Query: 1633 LHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLEKFDKSTALHLALKNNCFESLCSILDSLTNSLN 1914
            LH+A    +V +VELL++S    VN+ +M  + +ALH+A E+++ +++++L++Y  D+Y   KFDKS A  +A++ N  E L  + +++ N +N
Sbjct:   75 LHMAAADGHVHIVELLVRS-GADVNAKDM-LQMTALHWATEHHHRDVVELLIKYGADVYAFSKFDKS-AFDIAMEKNNTEILVMLQEAMQNQVN 165          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. UniProt/SwissProt
Match: sp|Q9VUX2|MIB_DROME (E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster OX=7227 GN=mib1 PE=1 SV=3)

HSP 1 Score: 112.849 bits (281), Expect = 6.441e-24
Identity = 100/382 (26.18%), Postives = 158/382 (41.36%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFNDL----LGTVNKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSF---------YPKRTGKVDSFTN-KSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCVKLVEGNRIKVCFENHNEEYYFNSKILYKIHN------EMRMVQVTNKSTLTELIK-------EWKDSIKWKMTKIDDIYWV 1080
            +G RV  GP W +   D     +GTV    +  +  V V WDNG    Y       +DL I DSA  G+KH G  C+ C ++ I G +W C EC  + LC+ CY GD H    H FYRI +     T +  R +  K   +GIF  + V                R GKV+   +  S + RS A V           +G+ G  ++K++N    +NV   YR+ L +LG +                       K    F++ D V VD  ++  ++  Q+ +G     + + +   G V  ++ +   V   N    + FN  +L K+ +      E ++  +    +  E IK       EW D+++  + KI  +  V
Sbjct:  108 VGARVIRGPDWKWNKQDGGEGHVGTVRNFESAEE--VVVVWDNGTAANYRCAGA--YDLRILDSAPTGVKHEGTMCDTCRQQPIFGIRWKCAECINYDLCSICYHGDKHHLR-HRFYRITTPGGERTMLEPRRKSKKVLARGIFPGARVVRGVDWQWEDQDGGVGRRGKVNEIQDWSSASPRSAAYVIWDNGSKNLYRVGFEGMADLKVVNDAKGSNV---YRDHLPLLGENG--------------------PGKGPHGFQIGDKVTVD-LDLEIVQSLQHGHGGWTDGMFECLSNAGMVVGIDEDHDIVVAYNSGNRWTFNPAVLTKVSSPTTAPPEFQVGDIVKICSDVESIKILQRGHGEWADAMQLTLGKIGRVQQV 460          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. UniProt/SwissProt
Match: sp|Q5ZIJ9|MIB2_CHICK (E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus OX=9031 GN=MIB2 PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 1.419e-20
Identity = 91/337 (27.00%), Postives = 148/337 (43.92%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFNDL----LGTVNKINNLN-----DLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHS---------FYPKRTGKVDSFTN-KSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFEL-DMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKI 963
            +G+RV  G  W +   D     +GTV +I         D  V V+WD G    Y  G +  +DLL+YD+AQIG++H    C+ C +  I G +W C  C  + LCT+CYM + H   SH F R ++A+     +  R    +   KG F  ++V                +TG+V        +T RS A V  S        +G+ G+V++K      E +    Y+  L  LG+ A    E  +    +   F+  D  K ++D ++             L++ Q  +G  N K+ + IG+ G V ++ +   ++V F N    + F+   L K+
Sbjct:   11 VGMRVVRGVDWKWGSQDSGEGNVGTVVEIGRTGSPTTPDKTVVVQWDQGNRTNYRTGFQGAYDLLLYDNAQIGVRHPNIICDCCKKHGIRGMRWKCKMCFDYDLCTQCYMNNKHDL-SHAFERYETAHSQPVLVSPRQNLTRITLKGTFQGAKVVRGPDWEWGNQDGGEGKTGRVVDIRGWDVETGRSVASVTWSDGTTNVYRVGHKGKVDLKCTV---EASGGFYYKEHLPKLGKPA----ELQRKESTDRHPFQHGDKVKCLLDIDI-------------LREMQEGHGGWNPKMAEFIGQTGTVHRITDRGDVRVQF-NSETRWTFHPGALTKL 325          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. UniProt/SwissProt
Match: sp|Q96AX9|MIB2_HUMAN (E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens OX=9606 GN=MIB2 PE=1 SV=3)

HSP 1 Score: 97.8265 bits (242), Expect = 2.768e-19
Identity = 89/342 (26.02%), Postives = 150/342 (43.86%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFNDL----------LGTVNKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHS------------FYPKRTGKVDSFTNKSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFEL-DMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIHN 969
            +G+RV  G  W +   D           LG  +   +  D  V V+WD G    Y  G +   DLL+YD+AQIG++H    C+ C +  + G +W C  C  + LCT+CYM + H+  +H F R ++A+     +  R    +   +GIF  ++V                 P R   VD      +T RS A V  +        +G+ G+V++K +    E      Y++ L  LG+ A    E  +    + + F+  D  K ++D +V             L++ Q  +G  N ++ + IG+ G V ++ +   ++V F NH   + F+   L K H+
Sbjct:   69 VGMRVVRGVDWKWGQQDGGEGGVGTVVELGR-HGSPSTPDRTVVVQWDQGTRTNYRAGYQGAHDLLLYDNAQIGVRHPNIICDCCKKHGLRGMRWKCRVCLDYDLCTQCYMHNKHEL-AHAFDRYETAHSRPVTLSPRQGLPRIPLRGIFQGAKVVRGPDWEWGSQDGGEGKPGRV--VDIRGWDVETGRSVASVTWADGTTNVYRVGHKGKVDLKCVG---EAAGGFYYKDHLPRLGKPA----ELQRRVSADSQPFQHGDKVKCLLDTDV-------------LREMQEGHGGWNPRMAEFIGQTGTVHRITDRGDVRVQF-NHETRWTFHPGALTKHHS 385          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. UniProt/SwissProt
Match: sp|Q68LP1|MIB2_RAT (E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus OX=10116 GN=Mib2 PE=1 SV=2)

HSP 1 Score: 94.3597 bits (233), Expect = 3.042e-18
Identity = 95/384 (24.74%), Postives = 162/384 (42.19%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFNDL----------LGTVNKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHS---------FYPKRTGKVDSFTN-KSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFEL-DMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKSTLTELIK-------EWKDSIKWKMTKIDDIYWV 1080
            +G+RV  G  W +   D           LG  +   +  D  V V+WD G    Y  G +   DLL+YD+AQIGI+H    C+ C +  + G +W C  C  + LCT+CYM + H   +H F R ++++     +  R    +   +GIF  ++V                +TG+V        +T RS A V  +        +G+ G+V++K +    E      Y+  L  LG+ A    E  +    + + F+  D  K ++D +V             L+  Q  +G  N ++ + IG+ G V ++ +   ++V F NH   + F+   L K HN   +  V       + +K       EW D +   + ++  +  V
Sbjct:   11 VGMRVVRGMDWKWGQQDGGEGGVGTVVELGR-HGSPSTPDRTVVVQWDQGTRTNYRAGYQGAHDLLLYDNAQIGIRHPNIICDCCKKHGLRGMRWKCRVCFDYDLCTQCYMHNKHDL-THAFERYETSHSRPVTLSPRQGLPRIPLRGIFQGAKVVRGPDWEWGSQDGGEGKTGRVVDIRGWDVETGRSVASVTWADGTTNVYRVGHKGKVDLKCVG---EAAGGFYYKEHLPKLGKPA----ELQRRVSADGQPFQRGDKVKCLLDTDV-------------LRDMQEGHGGWNPRMAEFIGQMGTVHRITDRGDVRVQF-NHETRWTFHPGALTK-HNSFWVGDVVRVIDDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKV 370          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. UniProt/SwissProt
Match: sp|Q8R516|MIB2_MOUSE (E3 ubiquitin-protein ligase MIB2 OS=Mus musculus OX=10090 GN=Mib2 PE=1 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 3.970e-18
Identity = 94/384 (24.48%), Postives = 162/384 (42.19%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFNDL----------LGTVNKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHS---------FYPKRTGKVDSFTN-KSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFEL-DMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKSTLTELIK-------EWKDSIKWKMTKIDDIYWV 1080
            +G+RV  G  W +   D           LG  +   +  D  V V+WD G    Y  G +   DLL+YD+AQIGI+H    C+ C +  + G +W C  C  + LCT+CYM + H   +H F R ++++     +  R    +   +GIF  ++V                +TG+V        +T RS A V  +        +G+ G+V+++ +    E      Y+  L  LG+ A    E  +    + + F+  D  K ++D +V             L+  Q  +G  N ++ + IG+ G V ++ +   ++V F NH   + F+   L K HN   +  V       + +K       EW D +   + ++  +  V
Sbjct:   11 VGMRVVRGMDWKWGQQDGGEGGVGTVVELGR-HGSPSTPDRTVVVQWDQGTRTNYRAGYQGAHDLLLYDNAQIGIRHPNIICDCCKKHGLRGMRWKCRVCFDYDLCTQCYMHNKHDL-THAFERYETSHSRPVTLSPRQGLPRIPLRGIFQGAKVVRGPDWEWGSQDGGEGKTGRVVDIRGWDVETGRSVASVTWADGTTNVYRVGHKGKVDLRCVG---EAAGGFYYKEHLPKLGKPA----ELQRRVSADGQPFQRGDKVKCLLDTDV-------------LRDMQEGHGGWNPRMAEFIGQMGTVHRITDRGDVRVQF-NHETRWTFHPGALTK-HNSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKV 370          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. TrEMBL
Match: T1JDF9 (Uncharacterized protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 2.153e-45
Identity = 232/996 (23.29%), Postives = 403/996 (40.46%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFND----LLGTVNKINNLN-----DLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHS---------FYPKRTGKVDSFTN-KSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSV----IDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKSTLTELIKEWKDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVTNTLPGDFV----GVRFNLYPHRICMLLPRKAC-----VDLDQRPDNSEILLP------RKQIILKTNDSFDEEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAVSVIESK-NIRIIKSILNEFSISCKINWNTLLYSFVDLIYTYSAIDRSPEMLEVIINHTEFNYQFTDENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILM-RYNCDIYLLEKFDKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNN-CIFHLSASLNGE-----------ECYKKWKN---------IVADKKIDLVENMIK---------------------KFNQFKDTSKSKY-----------LDNFSIEEMPFAVISCLILSKSENALQTWRVKLDKTGKTPEDLFVESVKKLKLSYINI----------NKYFIRFYRYLENKYDNEVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKVFDGDKNHLITYDNWEELSKSVKDNECPVTMADWYLYISKTIRRLE----CTVCKSRNWDIVFKCGHQLCDDCFKNSKKCVLC 2679
            +GLRV  G  W +   D     +GTV +I         D  V V+WD+G    Y +G +  +DL I D+A IG+KH    C+ C +  I G +W C  C  F LCT CYM D H   +H F RI++A+ +G  +  R   LK + KGIF+ ++V                +TG+V       +++ RS A V  ++       LG+ G+V++K      E +    YR+ L  LG                    E   A+S+      F V D V V   ++  LK  Q  +G  N ++ + +GK G V ++ E   I+V +E  N  + F+   L KI          N   + ++++   D+ K K  +     W+   +I++ +  K G ++     GD      G  +   P  + + +P  A      +  ++R +++            + +   T D    E  +  I ++ + + +F + +D + S  T       A+ V   + +I I+  +L     +C  N   +     D    YSA    PE++++++     N    ++   + LH+A  K +++ V +LL+ Q+C +N +  S   +ALH A+  +N EII +L+     D  L  K   +   H +LK N + + C     LT S     V + +     HL A+LNG            +C    +N          ++   + LVE ++                      + +Q     K+             + N  +E   F  I+C ++ ++ +         +  GKTP DL   S  K  ++Y +           +   +     LE+    + C  C     ++I++PCGH++ CE C     KC  C   I +KV  G           +  S+ ++             Y+   I+ +E    C++C  R  ++ F CGH  C  C +  + C +C
Sbjct:    9 VGLRVVRGSDWKWGNQDDGEGHVGTVVEIGKPGSSTSPDKTVVVQWDSGSRTNYRVGYQGAYDLRILDNAPIGVKHPNIICDACRKHGIPGIRWKCSRCYDFDLCTHCYMADKHDL-THPFVRIETASSVGVDMIIRAGALKIQAKGIFVGAKVMRGPDWDWGNQDGGDNKTGRVIDIRGWDNESGRSVANVTWTSGSTNVYRLGHKGKVDLKYTQ---EASGGFYYRDHLPTLG-----------------DIVEQQAARSITYKYTSFNVGDKVKV-LLDVDMLKGMQEGHGGWNPRMAEYVGKIGTVHRVTERGDIRVQYEGCNNRWTFHPAALAKI----------NTFVIGDIVRILDDTAKVKELQKGHGEWI---DIMKNVLGKTGKVIKVYSDGDLRVNVEGQTWTFNPLTV-IAIPGSAAELSNTMTANEREEHTNPFTSLISQFLEQHLESTTVDRLVREAAQGHIEVIKDLLQKFPEKVDTKSSGKT-------ALQVASHQGHIEIVGLLL-----ACNANLE-IQDDDGDTALHYSAFGNQPEVMKLLLLKGA-NIDAVNKGHCSTLHVAVNKQHIECVRVLLR-QNCNIN-IQDSYGDTALHDAIGKDNLEIIDLLVDEPRIDFSLRNKRGFNVLHHASLKGNNYAAEC----LLTRSRQIVDVKKDDGFAALHL-AALNGHRLVAETLLTQGQCEIDIRNNRKQTPLLLAISQGHMSLVELLVTMGAHVNAEDEDGDNGLHIALMRLSQGTTAEKADGEAPAIQAILTDIVNRGVEANAFLAIACFLIQENTDLSHH-----NHKGKTPLDLVAISEVKDVINYHSSLQAAQAESVEDTTVVSESSPLEHIPVEQECYICSEVPANIIFEPCGHQVTCEDCCVRMKKCISCQSTILQKVSAGIGGRAAPLKTRQASSERLR-------------YLESKIQEIEEAHSCSICMERRRNVAFLCGHGACVICAQTLRTCHMC 929          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. TrEMBL
Match: A0A1B6KVX4 (Uncharacterized protein OS=Graphocephala atropunctata OX=36148 GN=g.3840 PE=4 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.484e-43
Identity = 228/993 (22.96%), Postives = 404/993 (40.68%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFNDL----LGTVNKINNLNDLFVE---VRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSF---------YPKRTGKVDSFTN-KSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKSTLTELIKEWKDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVTNTLPGDFVGVRFNLYPHR-----ICMLLPRKACVDLDQRPDN-SEILLP------------RKQIILKTNDSFDEEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAVSVIESKNIRIIKSILNEFSISCKINWNTLLYSFVDLIYTYSAIDRSPEMLEVIIN----------------HTEFNYQFT----------------DENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTK----YSALHYA-VENNNCEIIKIL--MRYNCDIYLLEKFDKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNNCIFHLSASLNGEECYKKWKNIVADKKIDLVEN-----------MIKKFNQFKDTSKSKYLDNFSI-------EEMPFAV-ISCLILSKSENALQTWRVKLDKTGKTPEDLFVESVKKLKLSYININKYFIRFYRY------LENKYDNEVCKFCY-INGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKVFDGDKNHLITYDNWEELSKSVKDNECPVTMADWYLYISKTIRRLE----CTVCKSRNWDIVFKCGHQLCDDCFKNSKKCVLC 2679
            +GLRV  GP W++   D     +GTV ++        +   V+WDNG+   Y  G +  +DL + D+A  G+KH    C+GC  + I G ++ C  C  + LC  CY GD H   +H F R ++AN +G  +  R    K + KGIFI ++V              P  TG+V       ++T RS A +  ++       LG+NGRV++K +   +E      Y + L +LG   +  F  +Q       +   DM    + F+V D V V    + +LK  Q ++G  N K+ + IG+ G V ++ +   I+V ++  N  + FN  +L KI          +   + + +K   D IK K  +     W+   E+++    K+G ++     GD    R ++  H      +C+    ++ V +    D  ++   P              Q+ + + D    E  +     + E V +    +DA+         N L V+  +     ++  + N+ SI+       L     D    Y+A    P ++EV++                 H   N QF                 D  GD  LH A  K  +D+V++L     C V+ V+ + +    ++ LH+A ++ NN    +IL   R+  D+   +K D   ALHLA    C     +++++L       +   +N     L  +++   C    + +V   K+D+              + K+ +   + ++++    + I        + P A+ ++C ++ +          K +   +TP DL  + V+++   YI  N       R         ++     C  C  +   +V+ +PC H++ CE CS    KC +C   I ++V         T D      KS + +      A+   Y+   I  +E    C++C  R  ++ F CGH  CD C    + C +C
Sbjct:    4 VGLRVVRGPDWAWDDQDRGEGHVGTVVEVGKAGTKVSQTVFVQWDNGDKTNYRAGYKGSYDLRVLDNAPAGVKHASIICDGCKAQGIAGIRYKCTRCYDYDLCGPCYHGDKHDP-NHVFQRFETANAVGVEMTPRKGSTKIQSKGIFIGAKVVRGTDWEWGDQDGGPGHTGRVVDIKGWDNETSRSVAKITWTSGNNNVYRLGHNGRVDLKYI---EEAVGGFYYPDHLSVLGH-IVEVFRVTQ-------SVCGDMPPRHLTFKVGDRVKV-VMEVDTLKVMQKDHGGWNDKMAEFIGQVGVVHRVTDRGDIRVTYDGCNNRWTFNPAVLTKI----------DAFAVGDFVKVISDPIKVKDYQKGHGEWI---EVMKSALGKVGTVIKIYSDGDL---RVSVSDHTWTLNPLCVQPQPQSTVAVGSSGDTVADTTAPAGDQDNVLANLLETQLEISSIDQLVREAAQGHFDTIREFVTKNPDQVDAQS-----HGKNFLLVACHQGHMELVMFLLNNKASIN-------LTDEEGDTALHYAAFGNQPNIMEVLLERGADMNAVNKSSCSPLHVAANKQFVHCVRVLIKHKANINIQDSYGDTALHDAIGKESLDIVDML-----CSVHGVDFTIRNKRGFNILHHAALKGNNIATERILSKARHLVDV---KKDDGFAALHLA----CLNGHRAVVETLALQGQADINLPNNKRQTPLLLAVSQGHC-SVVEILVGQLKVDMNATDEEDDTALHVVLHKRASIHTEINENEAPSIYGIWAELATQTDHPVAIAVACYLVQEG-----CCTDKTNSKKQTPFDLISQPVQEIIRQYIPSNMSGSVAERVGEEEEEERSRSTPVECGVCSELADSNVLLEPCHHRVACEECSAFMKKCIQCGSQINKRV---------TQDGRLIACKSRQPS------AERLRYLESKIAEIEEAHCCSICMERRRNVAFLCGHGACDKCSLTLRICHMC 922          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. TrEMBL
Match: A0A0B7A885 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF102307 PE=4 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 7.873e-39
Identity = 234/985 (23.76%), Postives = 396/985 (40.20%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFNDL----LGTVNKINNLN-----DLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCK--GIFINSEVCHS---------FYPKRTGKVDSFTN-KSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKSTLTE---LIKEWKDS-IKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVTNTLPGDFVGVRFN---LYPHRICMLLPRKA-------CVDLDQR---PDNSEILLPRKQIILKTNDSFDEEQIKKAIIMLNEDV--DEFTKWLDAEKSNLTIQAWNQLAVSVIESKNIRIIKSILNEFSISCKI---NWNTLLYSFVDLIYTYSAIDRSPE-MLEVIINHTEFNYQFTDENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNC-DIYLLEKFDKSTALHLALKNNCFES-----LCSIL-----DSLTNSLNPTLVDQHNNC---IFHLSASLNGEECYKKWKNIVADKK-----IDLVEN--------------------MIKKFNQFKDTSK-----SKYLDNFSIEEMPFAVISCLILSKSENALQTWRVKLDKTGKTPEDLF----VESVKKLKLSYININKYFIRFYRYLENKYDNEVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKVFDGDKNHLITYDNWEELSKSVKDNECPVTMADWYLYISKTIRRLE----CTVCKSRNWDIVFKCGHQLCDDCFKNSKKCVLC 2679
            LG+RV  GP+W +   D     +GTV +I         D  V V+WD+G    Y +G +  +DL  +D+A +GIKH    C+ C  + + G +W C +C  F LCT CYM D H   +H F R D+ +  G  + KR      KC+  GIF  + V                + GKV       S++ RS A V  S+       +G+ G+V++K ++          YR+ L +LG       E++          E +   +   F+V D V  D   +  LK+ Q  +G  N ++ + + K G V ++ +   ++V +E     + F+   L K+    R   V +   ++E    +KEW+    +W             T++++    K GV+      GD   +  N    +    C L+P  A           DQR   P  + IL    ++          +++ +     + +V  D   K+ D     +  Q+  + A+ V   +  + I  +L     S ++   + +T L+        YSA    PE M ++++   + +    +  G + LH+A  K + + V++LL S  C VN +  +   +ALH A+   N  II++L+ YN  D     K   +   H ALK N F +      C  +     D   ++L+   ++ H +    + H  A +      ++    +A  +     I+L+                      M +     KDTS      S  L     EE   AVI+C ++ +  +       K +  GK P D+     VE + K   +   + +  I+    +  K   E C+ C      + + PCGH++ C  C     KC EC   I         NH  T D        V  N+ P +     + + K ++ LE    C +C  R  + VF+CGH  C  C  + + C +C
Sbjct:    3 LGVRVVRGPAWKWGNQDSGEGHVGTVVEIGRPGSQTSPDKTVVVQWDSGARTNYRVGYQGAYDLRTFDNATVGIKHTNIICDACRTQGVQGIRWKCTKCHDFDLCTLCYMNDKHDA-NHSFLRFDTPSSKGVKVPKRVNSQGQKCQAVGIFSGARVTRGPDWDWGNQDGGEGKVGKVSDIRGWDSESGRSVAHVTWSSGSTNVYRMGHKGKVDLKYIHATSGG---PYYRDHLSVLG-------EFT----------ETEGPGTPCQFKVGDKVRCD-LEVEILKQMQEGHGGWNPRMSEYLKKIGSVHRITDRGDVRVQYEGCVNRWTFHPDALTKV----RTFHVEDFVRISENLMQVKEWQAGHGEW-------------TDVMKNTLGKTGVVKKVYADGDLRVLVANQEWTFNPLCCTLVPHGAEDMNNTLGSTHDQRTAMPAFTSILEQLAELRSSHGQETGPDRLVREAAQGHIEVVKDILVKYPD----RVDQQSSGKTALQVSSHQGHKDIVQLLLSSGSSLEVKDEDGDTALH--------YSAFGNQPEVMHQLLLKGAKIDS--LNNGGCSTLHVAVNKQHQECVKVLL-SWGCNVN-IQDAYGDTALHDAIGKENHNIIELLVNYNSIDFTHKNKRGFNVLHHAALKGNVFATEKILQKCPQIVDLKKDDGFSALHLAALNGHKDVAAKLLHFGAEIEIRNNRQQTPLFLAVSQGHTSIIELLVTHKANVNVTDEDGDTCLHLALMKQTVAPEKDTSPITSSVSSKLGMGDREEKMGAVIACYLVQQGADLK-----KKNSQGKMPLDIISDPKVEELIKEFATSFTLKQESIKGQGLVPGK---EECELCCSAIDLIKFVPCGHQMVCADCCVKMKKCLECKTPI---------NHKKTQDG------HVIRNDDPTSSHSGDVDLKKRLQELEDTVNCPICMERQRNRVFQCGHATCSQCADSLRICPIC 909          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. TrEMBL
Match: A0A087ZYC2 (Uncharacterized protein OS=Apis mellifera OX=7460 GN=LOC409303 PE=4 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 4.423e-35
Identity = 176/735 (23.95%), Postives = 310/735 (42.18%), Query Frame = 1
Query:   19 LGLRVFPGPSWSY--------------------KFNDLLGTVNKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHS---------FYPKRTGKV-DSFTNKSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSV-IDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKSTLTELIKEWKDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVTNTLPGDFV----GVRFNLYPHRICMLLPRKACVDLDQRPD-----NSEILLPRKQIILKTNDSFDEEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAVSVIESKNIRIIKSILNEFSISCKINWNTLLYSFVDLIYTYSAIDRSPEMLEVIINHTEFNYQFTDENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLEKFDKSTALHLALKNNCFESLCSILDSLTN--SLNPTLVDQHNNCIFHLSASLNG-----EECYKKWKNIVADKKIDLVENM-IKKFNQFKDTS 2073
            +GLRV  G  W +                     F +   + N  +   D  V V+WD+G    Y IG +  +DLL++D+A IG+KH    C+GC    I+G +W C +C  + LCT+CYM D H   +H F R  +AN +G  +  R    K   KGIFI ++V                +TG+V D     +++ RS A V  S        LGY G V++  +   +E    T Y+  L +LG+  +          +    F L ++      F V D + V   ++ +LK+ Q  +G  N ++ + I K G V ++ +   I+V FE  N  + F+   L K+ ++       +  +L ++++   D    K+ +     W+   ++++    K G I+     GD      G  +   P  +  + P    V +   P+      +E +    + +L+     D  + +  +  + E + ++   +DA            L V+  + +                      L    +D   +  AID                     E+GD  LH A   N  +++ELLL S+   +N+VN + K SALH AV   + + +K+L+R++CD+ L + +   TALH A+  +  +    I+D+L +   ++ TL ++    + H  A+L G     E+   + +++V  KK D    + +   N  KD +
Sbjct:    4 VGLRVVRGQDWKWDDQDGGEGHAGTIVEIGKPPSFGNSASSPNPSDRTPDKTVIVQWDHGSRSNYRIGYQGAYDLLVFDNAAIGVKHANIICDGCKRHGIIGIRWKCIQCCDYDLCTQCYMADVHDL-NHCFERFQTANSVGIQLTPREGCTKISLKGIFIGAKVIRGPDWEWGNQDGGRGKTGRVIDIRGWDNESSRSVATVSWSKGSTNVYRLGYKGCVDLCYV---EEAIAGTYYKEHLPLLGQSIMAVSNNGTNITSIKSGFPLSVSSPRHSTFNVGDKIKV-LVDVETLKEMQEGHGGWNPRMAEYIDKIGRVHRITDKGDIRVQFEGCNNRWTFHPGTLTKVISK-------DTFSLGDIVRVKTDLCAVKLYQQGHGEWI---DVMKNALGKTGKIIKIYSDGDLRVALDGHTWTFNPLSVSPVPPGVETVTIQDEPNRNQDWTAEGVDTEVEKLLR-----DAARGEAGVSAVQEFLKKYPGRVDARAGGPGGGKKTCLQVAAHQGQ--------------------KDLCILLLDAGASLRAID---------------------EDGDTPLHYAAFGNQPEIMELLL-SRGAAINAVN-NGKCSALHVAVNKQHAQCVKVLLRHHCDVNLQDSYG-DTALHDAIGKDALD----IIDALCSCERVDFTLRNKRGFNVLH-HAALKGNAYATEKLMARARHLVDVKKEDGFAALHLAALNGHKDVA 669          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. TrEMBL
Match: A0A3L8D5M7 (Uncharacterized protein OS=Ooceraea biroi OX=2015173 GN=DMN91_012455 PE=4 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 4.579e-35
Identity = 161/670 (24.03%), Postives = 284/670 (42.39%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFNDL----LGTV----------------NKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHS---------FYPKRTGKVDSFTN-KSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALY---NFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKSTLTELIKEWKDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVTNTLPGDF-VGVRFNLYPHRICMLLPRKACVDLDQ-RPDNSEILLPRKQIILKTNDSF-----DEEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAVSVIESKNIRIIKSILNEFSISCKI---NWNTLLYSFVDLIYTYSAIDRSPEMLEVIINHTEFNYQFTDENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLEKFDKSTALHLALKNNCF---ESLCS 1884
            +GLRV  G  W +   D      GTV                N  +   D  V V+WD+G    Y IG +  +DLL++D+A  G+KH    C+GC    IVG +W C +C  + LCT+CYM + H+  SH F R  +AN +G  +G R +  K   KGIF+ ++V                +TG+V       +++ RS A V  ST       LGY G V++  +   +E    T Y++ L +LG+  L    N   S    N + +  +  +   + F V D V V    I +LK+ Q+ +G  N ++   IGK G V ++ +   ++V +E  N  + F+   L K       V   +  +L ++++   D    K  +     W+   ++++    K G ++     GD  V +  + +      ++P  A  +      DN      R + +  T+        D  + +  +  + E + ++   +DA           +  + V   +  R + ++L +   S +    + +T L+        Y+A    PE++E+++                                   SQ   +N+VN + + SALH AV   + + +K+L+RY+CD+ L + +   TALH A+  +     ++LC+
Sbjct:    4 VGLRVVRGQDWKWDDQDGGEGHAGTVVEIGKPPSTGNSASSPNPADRTPDKTVIVQWDHGARSNYRIGYQGAYDLLVFDNAAAGVKHTNIICDGCKRHGIVGIRWKCSQCFDYDLCTQCYMANVHEL-SHTFLRFQTANSVGVQLGPREDCSKIPLKGIFVGAKVVRGPDWEWGNQDGGRGKTGRVMDIRGWDNESSRSVATVTWSTGSTNVYRLGYKGCVDLCYV---EEAKAGTYYKDHLPLLGQPVLTVPDNGNSSTPTGNGVSS--VTSSPHHLTFNVGDKVKV-LIEIDTLKEMQDGHGGWNPRMADYIGKIGTVHRITDKGDVRVQYEGCNNRWTFHPGALTK-------VTAKDAFSLGDIVRVKSDLSAVKHYQRGHGEWI---DVMKNALGKTGKVIKIYSDGDLRVALDGHTWTFNPLSVVPVSAGANAAAVTHDNGN----RDRTVDGTDSEVEKLLRDAARGEAGVAAVREFLKKYPGRVDARAPG----GGRKTCLQVAAHQGQRELCTLLLDAGASLRAVDEDGDTPLH--------YAAFGNQPEIMELLL-----------------------------------SQGAAINAVN-NGRCSALHVAVNKQHAQCVKVLLRYHCDVNLQDSY-GDTALHDAIGKDALDVIDALCA 603          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Cavefish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 127.487 bits (319), Expect = 2.059e-29
Identity = 206/984 (20.93%), Postives = 368/984 (37.40%), Query Frame = 1
Query:    7 MNSYLGLRVFPGPSWSYKFNDL----LGTVNKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSF---------YPKRTGKV---DSFTNKSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKS-------TLTELIKEWKDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVT----NTLPGDFVGVRFNLYPHRICMLLPRKACVDLDQRPDNSEILLPRKQIILKTNDSFD--EEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAV-SVIESKNIRIIKSILN---EFSISCKINWNTLLY-------SFVDLIYTYSAI-----DRSPEMLEVIINHTEFNY-----------QFTDENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLE--KFDKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNNCIFHLSASLNGEECYKKWKNIVADKKIDLVE----------------NMIKKFNQFKDTSKSKY-----------LDNFSIEEMPFAVISCLILSKSENALQTWRVKLDKTGKTPEDLFVESVKKLKLSYININK----YFIRFYRYLENKYDNEVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKVFDGDKNHLITYDNWEELSKSVKDNECPVTMADWYLYISKTIRRLECTVCKSRNWDIVFK-CGHQ-LCDDCFKNSKKCVLC 2679
            M   +G RV  GP W +   D     +GTV    +  ++ V   WDNG    Y       +D+ I DSA  GIKH G  C+ C ++ I+G +W C EC  + LCT CY GD H    H FYRI +       +  R +  K   +GIF    V                R GKV     ++  S    +Y +       L R  +G+ G  ++K +    +    T YR+   +LG                    E +  ++    ++ D V +D  ++  ++  Q+ +G     + + +   G V  + E + I V + + N  + FN  +L K  N  R  +V   +        + +L++   D  + K+ +     W    E +     K+G +      + L  +  G  +   P  +  + P  + V        S++L    + + +T +S D  EE +K A    N D+ +    L     ++  Q     A+ +  ++ ++ ++K +L    +     K     + +       S +++++   A       R    L + +N                    D  GD  LH A  K   D++ +LL++   +  ++  +  ++ALH+A    N   +++L+      ++++  K D  TALHLA  NN  E    ++   + SL+   V+Q      HL+      +  +    + A+ K+D+ +                + +++    +D SK +            L     E+   A I+C + +   +   T R   +K G++P DL  +      L+  +  K       R      N    E C  C       ++ PCGH   C  CS    KC  C + ++ +                                          +  EC VC  +   ++F+ CGH   C++C    KKCV C
Sbjct:   10 MMEGVGARVIRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVV--WDNGTAANYRCSGA--YDVRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKCAECTNYDLCTTCYHGDKHHLR-HRFYRITTPGSERVLLESRRKSKKITARGIFAGGRVVRGVDWQWEDQDGGNGRRGKVTEIQDWSAASPHSAAYVLWDNGAKNLYR--VGFEGMSDLKCVQ---DAKGGTFYRDHCPVLG--------------------EQNGNRNPGGLQIGDLVNID-LDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN-RWTFNPAVLTKA-NVARSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWA---EAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGERLSQLL----KKLFETQESGDINEELVKAAA---NGDLAKVEDILKRPDVDVNGQCAGHTAMQAASQNGHVDVLKLLLKHNVDLEAEDKDGDRAVHHAAFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADV--TITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGSASLDIQNVNQQT--ALHLAVERQHTQIVRLL--VRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADL--TIR---NKKGQSPLDLCPDPSLCKALAKCHKEKTSGQVGSRSPSLNSNNETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKDQVQSRT-----------------------------------------KIEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQC 898          

HSP 2 Score: 86.2705 bits (212), Expect = 1.159e-16
Identity = 136/713 (19.07%), Postives = 262/713 (36.75%), Query Frame = 1
Query:  754 FEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCVKLVEGN---RIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKSTLTELIKEW--------------KDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVTNTLPGDFVGVRFNLYPHRICMLLPRKACVDLDQRPDNSEILLPRKQIILKTNDSFDEEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAVSVIESKNIRIIKSILN----------------EFSISCKIN--WNTLLYSFVDLIYT---------YSAIDRSPEMLEVIINHTEFNYQFTDENGDN---MLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLEKFDKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNNCIFHLSASLNGEECYKKWKNIVADKKIDLVENMIKKFNQFKDTSKSKYLDNFSIEEMPFAVISCLILSKSENALQTWRVKLDKTGKTPEDLFVES-------------VKKLKLSYININKYFIRFYRYLENKYDNEVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKVF-----------DGDKNHLITYDNWEELSKSVKDNECPVTMADWYLYISKTIRRLECTVCKSRNWDIVFKCGHQLCDDCFKNSKKCVLC 2679
            F V D V + C++I  +K  Q  +GE    +   +GK G V+ +  +   +++VC       + +N   + K+      V   +   L++L+K+               K +    + K++DI   PD                       V V      H       +   VD+ +       LL +  + L+  D   +  +  A       V E      A+ +    +    L ++V    +++++K++L+                  +IS K +   + LL +  D+  T         ++A+  +P  + V+++     +   DE  D+    LH+A   N+V++ ELL+      ++  N++ + +ALH AVE  + +I+++L+R    + + +K D  T LH AL+++    L  + D    S         N  I  L      ++        +A    DL           ++      LD      +  A+  C    K+   + +    L+   +T E+  V S             +    L    + K  I     ++++   E C  C     +V+++PCGH   CE C+ +  KC +C   +E +             D   +  +T  N   L +   +      +      +     +  C VC  R  +++F CGH  C  C     +C +C
Sbjct:  333 FMVGDLVQI-CYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVC----GTSWTYNPAAVTKVAPAGSAVTNASGERLSQLLKKLFETQESGDINEELVKAAANGDLAKVEDILKRPD-----------------------VDVNGQCAGHTAMQAASQNGHVDVLK-------LLLKHNVDLEAEDKDGDRAVHHAAFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAV-NKGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPW-IVDEKKDDGYTALHLAALNNHVEVAELLVHQGSASLDIQNVN-QQTALHLAVERQHTQIVRLLVRAEAKLDVQDK-DGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLT---------IRNKKGQSPLDLCPDPSLCKALAKCH-KEKTSGQVGSRSPSLNSNNETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLI-CKDQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQCRAVVERRTPFVLCCGGKGMEDATDDEDLTSGNIPALQRDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPIC 995          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Cavefish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 121.709 bits (304), Expect = 1.396e-27
Identity = 191/904 (21.13%), Postives = 346/904 (38.27%), Query Frame = 1
Query:    7 MNSYLGLRVFPGPSWSYKFNDL----LGTVNKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSF---------YPKRTGKV---DSFTNKSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKS-------TLTELIKEWKDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVT----NTLPGDFVGVRFNLYPHRICMLLPRKACVDLDQRPDNSEILLPRKQIILKTNDSFD--EEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAV-SVIESKNIRIIKSILN---EFSISCKINWNTLLY-------SFVDLIYTYSAI-----DRSPEMLEVIINHTEFNY-----------QFTDENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLE--KFDKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNNCIFHLSASLNGEECYKKWKNIVADKKIDLVE----------------NMIKKFNQFKDTSKSKY-----------LDNFSIEEMPFAVISCLILSKSENALQTWRVKLDKTGKTPEDLFVESVKKLKLSYININK----YFIRFYRYLENKYDNEVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKV 2445
            M   +G RV  GP W +   D     +GTV    +  ++ V   WDNG    Y       +D+ I DSA  GIKH G  C+ C ++ I+G +W C EC  + LCT CY GD H    H FYRI +       +  R +  K   +GIF    V                R GKV     ++  S    +Y +       L R  +G+ G  ++K +    +    T YR+   +LG                    E +  ++    ++ D V +D  ++  ++  Q+ +G     + + +   G V  + E + I V + + N  + FN  +L K  N  R  +V   +        + +L++   D  + K+ +     W    E +     K+G +      + L  +  G  +   P  +  + P  + V        S++L    + + +T +S D  EE +K A    N D+ +    L     ++  Q     A+ +  ++ ++ ++K +L    +     K     + +       S +++++   A       R    L + +N                    D  GD  LH A  K   D++ +LL++   +  ++  +  ++ALH+A    N   +++L+      ++++  K D  TALHLA  NN  E    ++   + SL+   V+Q      HL+      +  +    + A+ K+D+ +                + +++    +D SK +            L     E+   A I+C + +   +   T R   +K G++P DL  +      L+  +  K       R      N    E C  C       ++ PCGH   C  CS    KC  C + ++ + 
Sbjct:    7 MMEGVGARVIRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVV--WDNGTAANYRCSGA--YDVRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKCAECTNYDLCTTCYHGDKHHLR-HRFYRITTPGSERVLLESRRKSKKITARGIFAGGRVVRGVDWQWEDQDGGNGRRGKVTEIQDWSAASPHSAAYVLWDNGAKNLYR--VGFEGMSDLKCVQ---DAKGGTFYRDHCPVLG--------------------EQNGNRNPGGLQIGDLVNID-LDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN-RWTFNPAVLTKA-NVARSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWA---EAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGERLSQLL----KKLFETQESGDINEELVKAAA---NGDLAKVEDILKRPDVDVNGQCAGHTAMQAASQNGHVDVLKLLLKHNVDLEAEDKDGDRAVHHAAFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADV--TITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGSASLDIQNVNQQT--ALHLAVERQHTQIVRLL--VRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADL--TIR---NKKGQSPLDLCPDPSLCKALAKCHKEKTSGQVGSRSPSLNSNNETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKDQVQSRT 856          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 97.4413 bits (241), Expect = 3.333e-20
Identity = 97/382 (25.39%), Postives = 166/382 (43.46%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFND----LLGTVNKINNLN-----DLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHS---------FYPKRTGKVDSFTN-KSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFEL-DMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIH----NEMRMV--QVTNKSTLTELIKEWKDSIKWKMTKIDDIYWV 1080
            +G+RV  G  W +   D     +GTV ++         D  V V+WD+G    Y  G +  FDLL+YD+AQIG++H    C+ C +  I+G +W C  C  + LCT CYM + H   SH F R ++A+     +  R    +   KGIF   +V                + GKV        ++ RS A V  S        +G+ G+V++K ++   +      Y+  L  LG  A    E  +    +  TF+  D  K +++ ++             L++ Q  +G  N K+ + I + G V ++ +   ++V + N N  + F+   L K++     E+  V   + +   L     EW DS+   + ++  +  V
Sbjct:   12 VGMRVVRGVDWKWGNQDDGEGHVGTVVEVGRQGSTTTPDKTVVVQWDSGTRTNYRTGYQGAFDLLLYDNAQIGVRHSNIICDSCKKHGIMGMRWKCKVCFDYDLCTHCYMNNKHDL-SHAFERYETAHSQPVSLAPRQNLSRIILKGIFQGVKVVRGPDWDWGNQDGGEGKIGKVVDIRGWDQESGRSVASVTWSNGTTNVYRMGHKGKVDLKYVS---DGQGGYYYKEHLPKLGEHA----ELQRQESADGHTFQQGDKVKCLLEVDI-------------LRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQYSN-NIRWTFHPGALTKVNTFAVGELVRVLDDIESVKRLQAGHGEWTDSMASALGQVGKVLKV 371          

HSP 2 Score: 54.6842 bits (130), Expect = 4.518e-7
Identity = 76/335 (22.69%), Postives = 132/335 (39.40%), Query Frame = 1
Query: 1729 YSALHYAVENNNCEIIKILMRYN-CDIYLLEKFDKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNNCIFHLSASLNGEECYKKWKNIVADKKIDLVENMIKKFNQFKDTSKSKYLDNFSIEEMPFAVISCLILSKSENALQTWRVKLDKTGKTPEDLFVESVK-KLKLSYININKYF------IRFYRYLENKYDNEV---------CKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKVFDGDKNHLITYDNWE-ELSKSVKDNECPVTMADWYLYISKTIRRLECTVCKSRNWDIVFKCGHQLCDDCFKNSKKCVLC 2679
            +SALH A  NN+ ++ +IL++   CD  +    ++ T L LA+      +L ++L S    +N    D+  +   H + S       ++  N+++  + +      +        S S  L N  +     A I+C +  +  +         +  GK+P DL  +S   +L  S+   ++Y       +R      N   N           C  C    + V++ PC H + CE C+    KC +C   I +K         I  D  E E S +  ++E    +        +   R+ C +C      +VF+CGH  C DC    K C +C
Sbjct:  634 FSALHLAALNNHRDVAEILVKEGRCDANIRNNRNQ-TPLQLAVTQGHV-ALVALLVSEGADVNAE--DEEGDTAMHTALS------RQQLTNMLSTSEREASALYCR-------LSSSGLLGNTELN--VGAAIACFLAQEGADINYA-----NHKGKSPLDLVTDSTTLQLIRSFSEKHRYVVSSSSSLRRVHTTPNTMTNLAMPSAPGPSECLICSELALLVLFSPCQHSVACEECAHRMKKCIKCQVTITKK---------IRQDQTEVECSPNSDNSEQHNLLEQLQSRYRQMEERITCPICIDNQIKLVFQCGHASCIDCSAALKTCPIC 935          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 97.4413 bits (241), Expect = 4.237e-20
Identity = 98/382 (25.65%), Postives = 167/382 (43.72%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFND----LLGTVNKINNLN-----DLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHS---------FYPKRTGKVDSFTN-KSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFEL-DMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIH----NEMRMV--QVTNKSTLTELIKEWKDSIKWKMTKIDDIYWV 1080
            +G+RV  G  W +   D     +GTV ++         D  V V+WD+G    Y  G +  FDLL+YD+AQIG++H    C+ C +  I+G +W C  C  + LCT CYM + H   SH F R ++A+     +  R    +   KGIF   +V                + GKV        ++ RS A V  S        +G+ G+V++K ++ D +      Y+  L  LG  A    E  +    +  TF+  D  K +++ ++             L++ Q  +G  N K+ + I + G V ++ +   ++V + N N  + F+   L K++     E+  V   + +   L     EW DS+   + ++  +  V
Sbjct:   73 VGMRVVRGVDWKWGNQDDGEGHVGTVVEVGRQGSTTTPDKTVVVQWDSGTRTNYRTGYQGAFDLLLYDNAQIGVRHSNIICDSCKKHGIMGMRWKCKVCFDYDLCTHCYMNNKHDL-SHAFERYETAHSQPVSLAPRQNLSRIILKGIFQGVKVVRGPDWDWGNQDGGEGKIGKVVDIRGWDQESGRSVASVTWSNGTTNVYRMGHKGKVDLKYVS-DGQGGY--YYKEHLPKLGEHA----ELQRQESADGHTFQQGDKVKCLLEVDI-------------LRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQYSN-NIRWTFHPGALTKVNTFAVGELVRVLDDIESVKRLQAGHGEWTDSMASALGQVGKVLKV 432          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 97.4413 bits (241), Expect = 4.293e-20
Identity = 98/382 (25.65%), Postives = 167/382 (43.72%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFND----LLGTVNKINNLN-----DLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHS---------FYPKRTGKVDSFTN-KSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFEL-DMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIH----NEMRMV--QVTNKSTLTELIKEWKDSIKWKMTKIDDIYWV 1080
            +G+RV  G  W +   D     +GTV ++         D  V V+WD+G    Y  G +  FDLL+YD+AQIG++H    C+ C +  I+G +W C  C  + LCT CYM + H   SH F R ++A+     +  R    +   KGIF   +V                + GKV        ++ RS A V  S        +G+ G+V++K ++ D +      Y+  L  LG  A    E  +    +  TF+  D  K +++ ++             L++ Q  +G  N K+ + I + G V ++ +   ++V + N N  + F+   L K++     E+  V   + +   L     EW DS+   + ++  +  V
Sbjct:   67 VGMRVVRGVDWKWGNQDDGEGHVGTVVEVGRQGSTTTPDKTVVVQWDSGTRTNYRTGYQGAFDLLLYDNAQIGVRHSNIICDSCKKHGIMGMRWKCKVCFDYDLCTHCYMNNKHDL-SHAFERYETAHSQPVSLAPRQNLSRIILKGIFQGVKVVRGPDWDWGNQDGGEGKIGKVVDIRGWDQESGRSVASVTWSNGTTNVYRMGHKGKVDLKYVS-DGQGGY--YYKEHLPKLGEHA----ELQRQESADGHTFQQGDKVKCLLEVDI-------------LRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQYSN-NIRWTFHPGALTKVNTFAVGELVRVLDDIESVKRLQAGHGEWTDSMASALGQVGKVLKV 426          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008505.1 (pep scaffold:Pmarinus_7.0:GL477211:28706:49738:-1 gene:ENSPMAG00000007672.1 transcript:ENSPMAT00000008505.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.138 bits (248), Expect = 9.712e-22
Identity = 99/333 (29.73%), Postives = 147/333 (44.14%), Query Frame = 1
Query:   22 GLRVFPGPSWSYKFNDL----LGTVNKINNLN---DLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSFYPK-------RTGKVDSFTNK---SDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCVK-LVEGNRIKVCFENHNEEYYFNSKILYKI 963
            G+RV  GP WS++  D     LGT+    N          V+WD G   KY +G    +DL +YD+AQ G +HLG  C+GC EK I G +W C  C  F LCT CYMGD H   SH F RI S       +  R    K   KGIF  + V      K         GK    T K   S + R+ A V+    ++    LG +G+++++L      ++ +  Y + L  LG             D+  +T       S + F + DTV     +  +L   Q ++G  +  +  +  + G V  L++   + V + N   +Y +N K L K+
Sbjct:    1 GVRVVRGPGWSWQQQDGGEGGLGTLVAEGNWGTERSCGAVVQWDCGGRYKYRLGVNGHYDLRLYDNAQTGTQHLGVICDGCGEKWIWGIRWKCRGCPDFDLCTSCYMGDKHSL-SHAFNRITSPGSPSVQVPVRYMARKVPLKGIFPEAVVIRGPDWKWGNQDGGEGGKGLVLTIKGWDSTSQRNAAQVRWR-GEINSYRLGASGKMDLQL--ASPTSSGRHYYPDHLSCLG-------------DSSNRT-------STMGFCLGDTVRCG-VDGQTLMVLQQDHGGFSVAMALIAARPGKVAGLIDNGDVLVVYSN-GGKYIYNPKCLIKV 307          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Sea Lamprey
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 90.5077 bits (223), Expect = 1.569e-19
Identity = 85/330 (25.76%), Postives = 136/330 (41.21%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFND----LLGTVNKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSF---------YPKRTGKVDSFTN-KSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYK 960
            +G R+  GP W +   D      GTV    +  ++ V   WDNG    Y       +DL I DSA  GIKH G  C+ C  + I+G +W C EC  + LCT CY GD H    H FYRI +       +  R +  K   +GIF  + V                R GKV    +  + + RS A V           +G+ G  ++K +    +    + YR+   +LG                    EL+ +++    +++D V +D   +  ++  Q+ +G     + + +   G V  + E + I V + + N  + FN  +L K
Sbjct:   14 VGARIVRGPDWKWGKQDGGEGHAGTVRSFESPEEVVVV--WDNGTAANYRCSGA--YDLRILDSAPTGIKHDGTMCDTCRLQPIIGIRWKCAECTNYDLCTACYHGDKHHLR-HRFYRITTPGSERVLLESRRKSKKITSRGIFPGARVVRGVDWQWEDQDGGNGRRGKVTEIQDWSAASPRSAAYVLWDNGAKNLYRVGFEGMSDLKCIQ---DAKGGSFYRDHCPVLG--------------------ELNGSRNPGGLQISDLVNID-LELEIVQSLQHGHGGWTDGMFETLSTTGTVCGIDEDHDIVVQYPSGN-RWTFNPAVLTK 313          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Sea Lamprey
Match: gabpb2b (GA binding protein transcription factor subunit beta 2b [Source:ZFIN;Acc:ZDB-GENE-050208-136])

HSP 1 Score: 57.7658 bits (138), Expect = 7.304e-9
Identity = 36/95 (37.89%), Postives = 61/95 (64.21%), Query Frame = 1
Query: 1633 LHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLEKFDKSTALHLALKNNCFESLCSIL-DSLTNSLN 1914
            LH+A  + +V++VELL+K+    VN+ +M  K +ALH+A E+ +  +++ L+R   D + L KFDK TAL +A  +    +L SIL +++ N +N
Sbjct:   75 LHMAASEGHVNIVELLIKN-GAEVNAKDM-LKMTALHWAAEHGHRAVVEALVRGAADTHTLSKFDK-TALDIA-ADRGHANLLSILQEAMANQVN 165          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Nematostella
Match: EDO37482 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFK5])

HSP 1 Score: 95.9005 bits (237), Expect = 1.037e-21
Identity = 66/216 (30.56%), Postives = 98/216 (45.37%), Query Frame = 1
Query:   22 GLRVFPGPSWSYKFNDLLGTVNKI---------NNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFEC-GIFLCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSF------YPKRTGKVDSFTN----KSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNV 609
            G+RV  GP W +   D                 +   D  V V+WD G    Y  G +  +DL +YD+ QIG++H   +C  C+++ I G +W C +C G  LCT CYMGD H+ + H FY  +S +     +GKR    K + +GIF  ++V               GKV   T       ++YRS   V  S        LG+ G+V++  +N 
Sbjct:    4 GIRVVRGPDWKWGNQDGGEGSVGTVVVVGHPGSSTSPDKTVIVQWDTGNRTNYRCGYQGVYDLYLYDNGQIGVEHSHISCSECHQQGIKGMRWQCADCEGYNLCTACYMGDKHELQ-HGFYLHESPDSSSVPVGKRYGMEKCQSRGIFKGAQVARGLDWDWGDQDGGIGKVGRVTGVKGWDKESYRSVVSVNWSLKGENVYRLGHKGKVDLTCVNA 218          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Nematostella
Match: EDO44606 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV97])

HSP 1 Score: 47.3654 bits (111), Expect = 6.125e-6
Identity = 32/136 (23.53%), Postives = 56/136 (41.18%), Query Frame = 1
Query: 2290 LENKYDNEVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKVFDGDKNHLITYDNWEELSKSVKDNECPVTMADWYLYISKTI-----RRLECTVCKSRNWDIVFKCGHQLCDDCFKNSKKCVLCN 2682
            ++++   E C  C      +++KPC H + CE C  +  KC +C E+I E +        I     +      +  EC   + +  L   +        +  C VC  R  +++F CGH  C  C    ++C +C 
Sbjct:   52 VQSRTKIEECMVCSEKKSQLLFKPCNHMVACEGCGSLMKKCIQCRENITETL------PFIVCCGGQAPPPLSERGECKQEITNQELSQLQQQLQDMKEQTMCPVCMDRRKNLIFLCGHGTCQLCGDRMQECPMCR 181          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Nematostella
Match: EDO37483 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFK6])

HSP 1 Score: 46.9802 bits (110), Expect = 8.014e-6
Identity = 31/127 (24.41%), Postives = 55/127 (43.31%), Query Frame = 1
Query: 2317 CKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKVFDG-DKNHLITYDNWEELSKS----VKDNECPVTMADWYLYISKTIRRLECTVCKSRNWDIVFKCGHQLCDDCFKNSKKCVLCN 2682
            C  C     SV ++PC HK+ C  C+    KC +C E I  K+    D  H +T  +   L  +    + D+    ++      + +   + +C +C  +   + F CGH  C +C ++ + C  C 
Sbjct:   49 CIVCSDVPASVTFEPCAHKLVCADCAVRMKKCIKCQEHITCKIGPACDFAHSLTMQHCFTLDGADLSLLTDSSSENSLTSLQAKLQELEDKSQCPICMDKPRTVAFLCGHGTCSECCQSLRNCPFCR 175          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Medaka
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:101158637])

HSP 1 Score: 120.553 bits (301), Expect = 2.762e-27
Identity = 191/904 (21.13%), Postives = 346/904 (38.27%), Query Frame = 1
Query:    7 MNSYLGLRVFPGPSWSYKFNDL----LGTVNKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSF---------YPKRTGKV---DSFTNKSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKST-------LTELIKEWKDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVT----NTLPGDFVGVRFNLYPHRICMLLPRKACVDLDQRPDNSEILLPRKQIILKTNDSFD--EEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAV-SVIESKNIRIIKSILN---EFSISCKINWNTLLY-------SFVDLIYTYSAI-----DRSPEMLEVIINHTEFNY-----------QFTDENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLE--KFDKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNNCIFHLSASLNGEECYKKWKNIVADKKIDLVE----------------NMIKKFNQFKDTSKSKY-----------LDNFSIEEMPFAVISCLILSKSENALQTWRVKLDKTGKTPEDLFVES--VKKLKLSY--ININKYFIRFYRYLENKYDNEVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKV 2445
            M   +G RV  GP W +   D     +GTV    +  ++ V   WDNG    Y       +D+ I DSA  GIKH G  C+ C ++ I+G +W C EC  + LCT CY GD H    H FYRI +       +  R +  K   +GIF    V                R GKV     ++  S    +Y +       L R  +G+ G  ++K +    +    + YR+   +LG                    E +  ++    ++ D V +D  ++  ++  Q+ +G     + + +   G V  + E + I V + + N  + FN  +L K  N +R  +V   +        + +L++   D  + K+ +     W    E +     K+G +      + L  +  G  +   P  +  + P  + V        S++L    + + +T +S D  EE +K A    N D+ +    L     ++  Q     A+ +  ++ ++ ++K +L    +     K     + +       S ++++    A       R    L + +N                    D  GD  LH A  K   D++ +LL++   +  ++  +  ++ALH+A    N   +++L+      ++++  K D  TALHLA  NN  E    ++     SL+   V+Q      HL+      +  +    + A+ K+D+ +                + +++    +D SK +            L     E+   A I+C + +   +   T R   +K G++P DL  +    K L   +   +  +   R      N    E C  C       ++ PCGH   C  CS    KC  C E ++ + 
Sbjct:   11 MMEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVV--WDNGTAANYRCSGA--YDVRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKCAECSNYDLCTTCYHGDKHHLR-HRFYRITTPGSERVLLESRRKSKKITARGIFPGGRVVRGVDWQWEDQDGGNGRRGKVTEIQDWSAASPHSAAYVLWDNGAKNLYR--VGFEGMSDLKCVQ---DAKGGSFYRDHCPVLG--------------------EQNGNRNPGGLQIGDLVNID-LDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN-RWTFNPAVLTKA-NVVRSGEVAAGAEGGSSQFHVGDLVQICYDIDRIKLLQRGHGEWA---EAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKIAPSGSAVSNASGERLSQLL----KKLFETQESGDINEELVKAAA---NGDLAKVEDILKRPDVDVNGQCAGHTAMQAASQNGHVDVLKLLLKHNVDLEAEDKDGDRAVHHAAFGDEGSVIEVLQRGGADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADV--TITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNASLDIQNVNQQT--ALHLAVERQHTQIVRLL--VRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADL--TIR---NKKGQSPLDLCPDPNLCKALAKCHKEKSSGQVGTRSPSLNSNMESLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRT 860          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Medaka
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:101158637])

HSP 1 Score: 110.538 bits (275), Expect = 3.855e-24
Identity = 190/912 (20.83%), Postives = 345/912 (37.83%), Query Frame = 1
Query:    7 MNSYLGLRVFPGPSWSYKFNDL----LGTVNKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSF---------YPKRTGKV---DSFTNKSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKST-------LTELIKEWKDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVT----NTLPGDFVGVRFNLYPHRICMLLPRKACVDLDQRPDNSEILLPRKQIILKTNDSFD--EEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAV-SVIESKNIRIIKSILNEFSISCKINWNTLLYSF---VDLIYTYSAIDRSPEMLEVIINHTEFNYQFTDENGDNMLHIATKKNYVDLVELLL--------------KSQHCIVN-----------------SVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLE--KFDKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNNCIFHLSASLNGEECYKKWKNIVADKKIDLVE----------------NMIKKFNQFKDTSKSKY-----------LDNFSIEEMPFAVISCLILSKSENALQTWRVKLDKTGKTPEDLFVES--VKKLKLSY--ININKYFIRFYRYLENKYDNEVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKV 2445
            M   +G RV  GP W +   D     +GTV    +  ++ V   WDNG    Y       +D+ I DSA  GIKH G  C+ C ++ I+G +W C EC  + LCT CY GD H    H FYRI +       +  R +  K   +GIF    V                R GKV     ++  S    +Y +       L R  +G+ G  ++K +    +    + YR+   +LG                    E +  ++    ++ D V +D  ++  ++  Q+ +G     + + +   G V  + E + I V + + N  + FN  +L K  N +R  +V   +        + +L++   D  + K+ +     W    E +     K+G +      + L  +  G  +   P  +  + P  + V        S++L    + + +T +S D  EE +K A    N D+ +    L     ++  Q     A+ +  ++ ++ ++K +L           N  L +     D    ++A      ++EV +     +    ++     LHIA  K ++ +V+ LL                 H  ++                 ++  +  ++ALH+A    N   +++L+      ++++  K D  TALHLA  NN  E    ++     SL+   V+Q      HL+      +  +    + A+ K+D+ +                + +++    +D SK +            L     E+   A I+C + +   +   T R   +K G++P DL  +    K L   +   +  +   R      N    E C  C       ++ PCGH   C  CS    KC  C E ++ + 
Sbjct:   11 MMEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVV--WDNGTAANYRCSGA--YDVRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKCAECSNYDLCTTCYHGDKHHLR-HRFYRITTPGSERVLLESRRKSKKITARGIFPGGRVVRGVDWQWEDQDGGNGRRGKVTEIQDWSAASPHSAAYVLWDNGAKNLYR--VGFEGMSDLKCVQ---DAKGGSFYRDHCPVLG--------------------EQNGNRNPGGLQIGDLVNID-LDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN-RWTFNPAVLTKA-NVVRSGEVAAGAEGGSSQFHVGDLVQICYDIDRIKLLQRGHGEWA---EAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKIAPSGSAVSNASGERLSQLL----KKLFETQESGDINEELVKAAA---NGDLAKVEDILKRPDVDVNGQCAGHTAMQAASQNGHVDVLKLLLKH---------NVDLEAEDKDGDRAVHHAAFGDEGSVIEV-LQRGGADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNASLDIQNVNQQT--ALHLAVERQHTQIVRLL--VRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADL--TIR---NKKGQSPLDLCPDPNLCKALAKCHKEKSSGQVGTRSPSLNSNMESLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRT 860          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 99.3673 bits (246), Expect = 9.573e-21
Identity = 100/381 (26.25%), Postives = 170/381 (44.62%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFND----LLGTVNKIN-----NLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHS---------FYPKRTGKVDSFTN-KSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIH--NEMRMVQVTNKSTLTELIK----EWKDSIKWKMTKIDDIYWV 1080
            +G+RV  G  W +   D     +GTV +I         D  V V+WD+G    Y  G +  FDLL+YD+AQIG++H    C+ C +  I+G +W C  C  + LCT+CYM + H   SH F R ++A+     +  R    +   KGIF   +V                + GKV       +++ RS A V  S        +G+ G+V++K ++ D +      Y++ L  LG  A            EL+  E     S   F+  D V      +  L++ Q  +G  N K+ + I + G V ++ +   ++V + N N  + F+   L K++      +V+V ++    + ++    EW DS+   + ++  +  V
Sbjct:  128 VGMRVVRGLDWKWGNQDDGEGHVGTVVEIGRQGSTTTPDKTVVVQWDSGTRTNYRTGYQGAFDLLLYDNAQIGVRHSNIICDSCKKHGIMGMRWKCKVCFDYDLCTQCYMNNKHDL-SHPFERYETAHSQPVSLTPRQNLPRIILKGIFQGVKVVRGPDWDWGNQDGGEGKVGKVVDIRGWDTESGRSVASVTWSNGTTNVYRMGHKGKVDLKYVS-DGQGGF--YYKDHLPKLGEHA------------ELQRQESADGHS---FQQGDKVKC-LLEVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQYSN-NIRWTFHPGALTKVNTFGVGELVRVLDEVETVKRLQAGHGEWTDSMTPVLGQVGKVLKV 487          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 98.9821 bits (245), Expect = 1.200e-20
Identity = 102/381 (26.77%), Postives = 167/381 (43.83%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFND----LLGTVNKINNLN-----DLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHS---------FYPKRTGKVDSFTN-KSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIH----NEMRMV--QVTNKSTLTELIKEWKDSIKWKMTKIDDIYWV 1080
            +G+RV  G  W +   D     +GTV +I         D  V V+WD+G    Y  G +  FDLL+YD+AQIG++H    C+ C +  I+G +W C  C  + LCT+CYM + H   SH F R ++A+     +  R    +   KGIF   +V                + GKV       +++ RS A V  S        +G+ G+V++K ++ D +      Y++ L  LG  A            EL+  E     S   F+  D V      +  L++ Q  +G  N K+ + I + G V ++ +   ++V + N N  + F+   L K++     E+  V  +V     L     EW DS+   + ++  +  V
Sbjct:   56 VGMRVVRGLDWKWGNQDDGEGHVGTVVEIGRQGSTTTPDKTVVVQWDSGTRTNYRTGYQGAFDLLLYDNAQIGVRHSNIICDSCKKHGIMGMRWKCKVCFDYDLCTQCYMNNKHDL-SHPFERYETAHSQPVSLTPRQNLPRIILKGIFQGVKVVRGPDWDWGNQDGGEGKVGKVVDIRGWDTESGRSVASVTWSNGTTNVYRMGHKGKVDLKYVS-DGQGGF--YYKDHLPKLGEHA------------ELQRQESADGHS---FQQGDKVKC-LLEVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQYSN-NIRWTFHPGALTKVNTFGVGELVRVLDEVETVKRLQAGHGEWTDSMTPVLGQVGKVLKV 415          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 98.9821 bits (245), Expect = 1.306e-20
Identity = 100/381 (26.25%), Postives = 170/381 (44.62%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFND----LLGTVNKINNLN-----DLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIF-LCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHS---------FYPKRTGKVDSFTN-KSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCV-KLVEGNRIKVCFENHNEEYYFNSKILYKIH--NEMRMVQVTNKSTLTELIK----EWKDSIKWKMTKIDDIYWV 1080
            +G+RV  G  W +   D     +GTV +I         D  V V+WD+G    Y  G +  FDLL+YD+AQIG++H    C+ C +  I+G +W C  C  + LCT+CYM + H   SH F R ++A+     +  R    +   KGIF   +V                + GKV       +++ RS A V  S        +G+ G+V++K ++ D +      Y++ L  LG  A            EL+  E     S   F+  D V      +  L++ Q  +G  N K+ + I + G V ++ +   ++V + N N  + F+   L K++      +V+V ++    + ++    EW DS+   + ++  +  V
Sbjct:    3 VGMRVVRGLDWKWGNQDDGEGHVGTVVEIGRQGSTTTPDKTVVVQWDSGTRTNYRTGYQGAFDLLLYDNAQIGVRHSNIICDSCKKHGIMGMRWKCKVCFDYDLCTQCYMNNKHDL-SHPFERYETAHSQPVSLTPRQNLPRIILKGIFQGVKVVRGPDWDWGNQDGGEGKVGKVVDIRGWDTESGRSVASVTWSNGTTNVYRMGHKGKVDLKYVS-DGQGGF--YYKDHLPKLGEHA------------ELQRQESADGHS---FQQGDKVKC-LLEVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQYSN-NIRWTFHPGALTKVNTFGVGELVRVLDEVETVKRLQAGHGEWTDSMTPVLGQVGKVLKV 362          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Planmine SMEST
Match: SMESG000042567.1 (SMESG000042567.1)

HSP 1 Score: 1808.11 bits (4682), Expect = 0.000e+0
Identity = 887/903 (98.23%), Postives = 888/903 (98.34%), Query Frame = 1
Query:   10 NSYLGLRVFPGPSWSYKFNDLLGTVNKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIFLCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSFYPKRTGKVDSFTNKSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCVKLVEGNRIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKSTLTELIKEWKDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVTNTLPGDFVGVRFNLYPHRICMLLPRKACVDLDQRPDNSEILLPRKQIILKTNDSFDEEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAVSVIESKNIRIIKSILNEFSISCKINWNTLLYSFVDLIYTYSAIDRSPEMLEVIINHTEFNYQFTDENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLEKFDKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNNCIFHLSASLNGEECYKKWKNIVADKKIDLVENMIKKFNQFKDTSKSKYLDNFSIEEMPFAVISCLILSKSENALQTWRVKLDKTGKTPEDLFVESVKKLKLSYININKYFIRFYRYLENKYDNEVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKVFDGDKNHLITYDNWEELSKSVKDNECPVTMADWYLYISKTIRRLECTVCKSRNWDIVFKCGHQLCDDCFKNSKKCVLCNLDQPEHFKVIGQ 2718
            NSYLGLRVFPGPSWSYKFNDLL               VRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIFLCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSFYPKRTGKVDSFTN+SDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCVKLVEGNRIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKSTLTELIKEWKDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVTNTLPGDFVGVRFNLYPHRICMLLPRKACVDLDQRPDNSEILLPRKQIILKTNDSFDEEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAVSVIESKNIRIIKSILNEFSISCKINWNTLLYSFVDLIYTYSAIDRSPEMLEVIINHTEFNYQFTDENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLEKFDKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNNCIFHLSASLNGEECYKKWKNIVADKKIDLVENMIKKFNQFKDTSKSKYLDNFSIEEMPFAVISCLILSKSENALQTWRVKLDKTGKTPEDLFVESVKKLKLSYININKYFIRFYRYLENKYDNEVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKVFDGDKNHLITYDNWEELSKSVKDNECPVTMADWYLYISKTIRRLECTVCKSRNWDIVFKCGHQLCDDCFKNSKKCVLCNLDQPEHFKVIGQ
Sbjct:   18 NSYLGLRVFPGPSWSYKFNDLL---------------VRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIFLCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSFYPKRTGKVDSFTNRSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCVKLVEGNRIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKSTLTELIKEWKDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVTNTLPGDFVGVRFNLYPHRICMLLPRKACVDLDQRPDNSEILLPRKQIILKTNDSFDEEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAVSVIESKNIRIIKSILNEFSISCKINWNTLLYSFVDLIYTYSAIDRSPEMLEVIINHTEFNYQFTDENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLEKFDKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNNCIFHLSASLNGEECYKKWKNIVADKKIDLVENMIKKFNQFKDTSKSKYLDNFSIEEMPFAVISCLILSKSENALQTWRVKLDKTGKTPEDLFVESVKKLKLSYININKYFIRFYRYLENKYDNEVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKVFDGDKNHLITYDNWEELSKSVKDNECPVTMADWYLYISKTIRRLECTVCKSRNWDIVFKCGHQLCDDCFKNSKKCVLCNLDQPEHFKVIGQ 905          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Planmine SMEST
Match: SMESG000042567.1 (SMESG000042567.1)

HSP 1 Score: 1631.31 bits (4223), Expect = 0.000e+0
Identity = 800/801 (99.88%), Postives = 801/801 (100.00%), Query Frame = 1
Query:  316 MGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSFYPKRTGKVDSFTNKSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCVKLVEGNRIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKSTLTELIKEWKDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVTNTLPGDFVGVRFNLYPHRICMLLPRKACVDLDQRPDNSEILLPRKQIILKTNDSFDEEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAVSVIESKNIRIIKSILNEFSISCKINWNTLLYSFVDLIYTYSAIDRSPEMLEVIINHTEFNYQFTDENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLEKFDKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNNCIFHLSASLNGEECYKKWKNIVADKKIDLVENMIKKFNQFKDTSKSKYLDNFSIEEMPFAVISCLILSKSENALQTWRVKLDKTGKTPEDLFVESVKKLKLSYININKYFIRFYRYLENKYDNEVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKVFDGDKNHLITYDNWEELSKSVKDNECPVTMADWYLYISKTIRRLECTVCKSRNWDIVFKCGHQLCDDCFKNSKKCVLCNLDQPEHFKVIGQ 2718
            MGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSFYPKRTGKVDSFTN+SDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCVKLVEGNRIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKSTLTELIKEWKDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVTNTLPGDFVGVRFNLYPHRICMLLPRKACVDLDQRPDNSEILLPRKQIILKTNDSFDEEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAVSVIESKNIRIIKSILNEFSISCKINWNTLLYSFVDLIYTYSAIDRSPEMLEVIINHTEFNYQFTDENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLEKFDKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNNCIFHLSASLNGEECYKKWKNIVADKKIDLVENMIKKFNQFKDTSKSKYLDNFSIEEMPFAVISCLILSKSENALQTWRVKLDKTGKTPEDLFVESVKKLKLSYININKYFIRFYRYLENKYDNEVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKVFDGDKNHLITYDNWEELSKSVKDNECPVTMADWYLYISKTIRRLECTVCKSRNWDIVFKCGHQLCDDCFKNSKKCVLCNLDQPEHFKVIGQ
Sbjct:    1 MGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCHSFYPKRTGKVDSFTNRSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDFEVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCVKLVEGNRIKVCFENHNEEYYFNSKILYKIHNEMRMVQVTNKSTLTELIKEWKDSIKWKMTKIDDIYWVPDTEIIEMIHEKIGVIVTNTLPGDFVGVRFNLYPHRICMLLPRKACVDLDQRPDNSEILLPRKQIILKTNDSFDEEQIKKAIIMLNEDVDEFTKWLDAEKSNLTIQAWNQLAVSVIESKNIRIIKSILNEFSISCKINWNTLLYSFVDLIYTYSAIDRSPEMLEVIINHTEFNYQFTDENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLEKFDKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNNCIFHLSASLNGEECYKKWKNIVADKKIDLVENMIKKFNQFKDTSKSKYLDNFSIEEMPFAVISCLILSKSENALQTWRVKLDKTGKTPEDLFVESVKKLKLSYININKYFIRFYRYLENKYDNEVCKFCYINGVSVIYKPCGHKIHCEYCSFMPHKCAECNEDIEEKVFDGDKNHLITYDNWEELSKSVKDNECPVTMADWYLYISKTIRRLECTVCKSRNWDIVFKCGHQLCDDCFKNSKKCVLCNLDQPEHFKVIGQ 801          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Planmine SMEST
Match: SMESG000030607.1 (SMESG000030607.1)

HSP 1 Score: 93.5893 bits (231), Expect = 4.620e-19
Identity = 69/234 (29.49%), Postives = 106/234 (45.30%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFND----LLGTVNKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFEC-GIFLCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLK-YKCKGIFINSEVCHSF------------YPKRTGKVDSFTNKSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGR 666
            +G RV  GP W +   D     LGTV    +  +  V V WDNG    Y  G    FDL + D+A  G++HL   CE C++  I G +W C EC    LC+ CY GD H    H F RI   N     + +   K K   C+G+F  + V                +  +  ++  + + S    +Y I +     L R  +G++G  ++K++    E+   T+YR+ L +LG+
Sbjct:   12 IGCRVMRGPDWKWNRQDGGEGHLGTVRSFESSEE--VVVVWDNGTAANYRCG--VNFDLRMVDNAPTGVRHLDVKCEYCHQSPITGIRWKCIECLNTDLCSLCYHGDRHNLR-HRFVRIIYPNNSSKMVLESRRKTKRILCRGLFPGARVVRGVDWQWSDQDGGAGHKGKVTEMQDWCSTSSRSAAYVIWECGGKNLYR--VGHDGMSDLKVVA---ESKGMTVYRDHLPLLGQ 235          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Planmine SMEST
Match: SMESG000030607.1 (SMESG000030607.1)

HSP 1 Score: 93.5893 bits (231), Expect = 4.622e-19
Identity = 69/234 (29.49%), Postives = 106/234 (45.30%), Query Frame = 1
Query:   19 LGLRVFPGPSWSYKFND----LLGTVNKINNLNDLFVEVRWDNGEFDKYGIGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFEC-GIFLCTRCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLK-YKCKGIFINSEVCHSF------------YPKRTGKVDSFTNKSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLNVDDENNVQTIYRNSLRILGR 666
            +G RV  GP W +   D     LGTV    +  +  V V WDNG    Y  G    FDL + D+A  G++HL   CE C++  I G +W C EC    LC+ CY GD H    H F RI   N     + +   K K   C+G+F  + V                +  +  ++  + + S    +Y I +     L R  +G++G  ++K++    E+   T+YR+ L +LG+
Sbjct:   12 IGCRVMRGPDWKWNRQDGGEGHLGTVRSFESSEE--VVVVWDNGTAANYRCG--VNFDLRMVDNAPTGVRHLDVKCEYCHQSPITGIRWKCIECLNTDLCSLCYHGDRHNLR-HRFVRIIYPNNSSKMVLESRRKTKRILCRGLFPGARVVRGVDWQWSDQDGGAGHKGKVTEMQDWCSTSSRSAAYVIWECGGKNLYR--VGHDGMSDLKVVA---ESKGMTVYRDHLPLLGQ 235          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Planmine SMEST
Match: SMESG000011193.1 (SMESG000011193.1)

HSP 1 Score: 57.3806 bits (137), Expect = 3.588e-8
Identity = 37/106 (34.91%), Postives = 64/106 (60.38%), Query Frame = 1
Query: 1561 EMLEVIINHTEFNYQFTDENGDNMLHIATKKNYVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDIYLLEKFDKSTALHLALKNNCFESL 1878
            E L+++ N+ + ++   D+NG  ++H A+K+N+  ++  L   +  I  +V   T  +ALHYA   N+C  I++L++ N DI  +E  + S+ LHLA K+N  ESL
Sbjct:  116 ECLKILKNY-DADFTVKDKNGMQLIHWASKRNHDKIIRYLYDLE--ININVQCDTGKTALHYAAITNSCSAIQMLVKCNADIS-IEDNEGSSPLHLAAKHNSLESL 217          
The following BLAST results are available for this feature:
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MIB11.695e-2320.95mindbomb E3 ubiquitin protein ligase 1 [Source:HGN... [more]
MIB22.816e-2026.02mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
MIB26.736e-2026.02mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
MIB29.236e-2026.02mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
MIB29.237e-2026.02mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mib-15.923e-822.17MIB (MIndBomb) ubiquitin ligase homolog [Source:U... [more]
F40G9.176.285e-630.49pep chromosome:WBcel235:III:194460:210063:1 gene:W... [more]
F40G9.176.285e-630.49pep chromosome:WBcel235:III:194462:200328:1 gene:W... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib28.247e-3124.43gene:FBgn0086442 transcript:FBtr0336840[more]
mib28.247e-3124.43gene:FBgn0086442 transcript:FBtr0081142[more]
mib28.247e-3124.43gene:FBgn0086442 transcript:FBtr0336841[more]
mib16.425e-2526.18gene:FBgn0263601 transcript:FBtr0075520[more]
mib17.049e-2225.83gene:FBgn0263601 transcript:FBtr0333578[more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib11.945e-2721.19mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib14.677e-2721.36mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib12.005e-2621.01mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib26.146e-1236.89mindbomb E3 ubiquitin protein ligase 2 [Source:ZFI... [more]
gabpb12.130e-1041.05GA binding protein transcription factor subunit be... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
coa75.249e-2723.51cytochrome c oxidase assembly factor 7 (putative) ... [more]
mib11.738e-2321.59mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
coa75.249e-2127.38cytochrome c oxidase assembly factor 7 (putative) ... [more]
coa76.182e-2127.38cytochrome c oxidase assembly factor 7 (putative) ... [more]
coa78.277e-2127.38cytochrome c oxidase assembly factor 7 (putative) ... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mib12.065e-2821.14mindbomb E3 ubiquitin protein ligase 1 [Source:MGI... [more]
Mib12.065e-2821.14mindbomb E3 ubiquitin protein ligase 1 [Source:MGI... [more]
Mib23.943e-1522.84mindbomb E3 ubiquitin protein ligase 2 [Source:MGI... [more]
Mib16.148e-1422.85mindbomb E3 ubiquitin protein ligase 1 [Source:MGI... [more]
Gabpb22.630e-1035.11GA repeat binding protein, beta 2 [Source:MGI Symb... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VUX2|MIB_DROME6.441e-2426.18E3 ubiquitin-protein ligase mind-bomb OS=Drosophil... [more]
sp|Q5ZIJ9|MIB2_CHICK1.419e-2027.00E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus ... [more]
sp|Q96AX9|MIB2_HUMAN2.768e-1926.02E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens O... [more]
sp|Q68LP1|MIB2_RAT3.042e-1824.74E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegi... [more]
sp|Q8R516|MIB2_MOUSE3.970e-1824.48E3 ubiquitin-protein ligase MIB2 OS=Mus musculus O... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1JDF92.153e-4523.29Uncharacterized protein OS=Strigamia maritima OX=1... [more]
A0A1B6KVX41.484e-4322.96Uncharacterized protein OS=Graphocephala atropunct... [more]
A0A0B7A8857.873e-3923.76Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A087ZYC24.423e-3523.95Uncharacterized protein OS=Apis mellifera OX=7460 ... [more]
A0A3L8D5M74.579e-3524.03Uncharacterized protein OS=Ooceraea biroi OX=20151... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib12.059e-2920.93mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib11.396e-2721.13mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib23.333e-2025.39mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib24.237e-2025.65mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib24.293e-2025.65mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000008505.19.712e-2229.73pep scaffold:Pmarinus_7.0:GL477211:28706:49738:-1 ... [more]
mib11.569e-1925.76mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
gabpb2b7.304e-937.89GA binding protein transcription factor subunit be... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO374821.037e-2130.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO446066.125e-623.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374838.014e-624.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib12.762e-2721.13mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib13.855e-2420.83mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib29.573e-2126.25mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib21.200e-2026.77mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib21.306e-2026.25mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042567.10.000e+098.23SMESG000042567.1[more]
SMESG000042567.10.000e+099.88SMESG000042567.1[more]
SMESG000030607.14.620e-1929.49SMESG000030607.1[more]
SMESG000030607.14.622e-1929.49SMESG000030607.1[more]
SMESG000011193.13.588e-834.91SMESG000011193.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008362 ID=SMED30008362|Name=E3 ubiquitin-protein ligase MIB2|organism=Schmidtea mediterranea sexual|type=transcript|length=2944bp
AATTGAATGAATAGTTATTTGGGATTAAGAGTTTTTCCAGGGCCTTCTTG
GAGTTATAAATTCAATGATCTTTTAGGTACTGTTAATAAAATTAATAATC
TTAACGATCTTTTTGTTGAAGTACGTTGGGATAATGGTGAATTCGATAAA
TATGGAATAGGAAATGAATGTCGATTTGATTTGTTAATTTATGATTCTGC
CCAAATCGGAATTAAACATCTAGGATATAATTGTGAAGGTTGTAATGAAA
AAGATATTGTTGGTAATAAATGGGGATGTTTTGAGTGTGGAATTTTTCTT
TGTACCCGTTGTTACATGGGTGATTGCCATCAAAAGGAGTCTCATCATTT
TTACAGGATTGATTCAGCAAATGAAATGGGAACCTTCATTGGAAAACGCA
ATGAGAAATTGAAATATAAATGTAAAGGCATATTTATAAACTCAGAAGTT
TGCCACTCATTTTATCCCAAAAGAACAGGGAAGGTTGACAGTTTCACTAA
CAAAAGTGATACTTATCGATCCTATGCAATTGTGAAGCTGTCAACAAATA
AATTAGAACGTTGTCTTCTTGGATATAATGGAAGAGTCGAAATAAAATTA
TTGAATGTTGATGATGAAAACAATGTTCAAACTATTTATCGAAACAGCCT
GAGAATACTGGGACGTGATGCACTTTACAACTTTGAATATAGTCAATTAT
ATGACAACGAATTAAAGACTTTTGAATTGGACATGGCTAAAAGTGTCATA
GATTTTGAAGTAAATGATACTGTTTACGTTGACTGTTTTAATATTTCCAG
TCTAAAAAAATATCAGAATAACTATGGGGAATCTAATTATAAAGTGGAAC
AGTTGATAGGAAAGTGTGGTTGTGTTAAATTAGTTGAAGGGAATCGTATC
AAAGTGTGTTTTGAGAATCATAATGAAGAATATTATTTCAATTCCAAAAT
TTTATATAAGATCCACAATGAAATGCGAATGGTTCAAGTAACGAATAAAT
CAACTTTGACAGAATTAATCAAGGAATGGAAAGATTCTATAAAATGGAAA
ATGACAAAAATAGATGATATATATTGGGTTCCAGATACTGAAATCATCGA
AATGATACATGAAAAAATTGGAGTAATTGTTACAAATACATTACCAGGAG
ATTTCGTAGGAGTTCGTTTTAATTTATATCCTCACAGAATTTGTATGTTA
CTCCCTCGAAAAGCATGCGTCGATCTTGATCAAAGACCGGACAATTCTGA
AATATTACTTCCGAGAAAACAGATAATTTTAAAAACTAACGATTCGTTTG
ACGAAGAACAAATCAAAAAAGCAATAATAATGCTAAATGAAGATGTTGAT
GAGTTTACTAAATGGTTGGATGCAGAAAAATCCAATTTGACAATTCAAGC
GTGGAATCAACTTGCCGTTTCGGTAATAGAATCTAAGAATATTCGCATAA
TTAAAAGCATATTGAATGAGTTTTCCATTTCATGCAAGATCAATTGGAAT
ACATTGCTTTATAGTTTTGTTGATTTAATTTATACTTATAGTGCAATCGA
TAGATCACCAGAAATGTTGGAAGTAATAATTAATCATACGGAGTTCAATT
ATCAATTCACTGATGAGAATGGTGACAATATGTTACACATAGCTACCAAG
AAAAACTACGTTGATTTAGTTGAGCTTTTATTAAAATCCCAACATTGTAT
TGTAAATTCTGTTAACATGTCAACCAAATATTCTGCTTTGCATTATGCCG
TGGAAAATAATAATTGTGAAATTATCAAAATTCTCATGAGATACAATTGT
GATATTTATTTGTTAGAAAAATTTGATAAGTCAACAGCTCTTCATTTGGC
ATTAAAAAATAATTGTTTTGAATCTTTATGCAGTATATTGGATTCGTTAA
CAAATAGTTTAAACCCAACACTAGTTGATCAACATAACAACTGTATTTTT
CATTTATCAGCTTCACTTAATGGTGAGGAATGTTATAAAAAATGGAAGAA
TATTGTCGCTGATAAAAAGATCGATCTTGTTGAAAATATGATTAAAAAAT
TCAACCAATTTAAAGATACATCAAAATCTAAGTATTTAGACAATTTTAGC
ATCGAAGAAATGCCATTTGCCGTAATTTCTTGTTTGATTTTATCAAAAAG
TGAAAATGCCTTGCAAACATGGAGAGTAAAGCTTGATAAAACCGGCAAAA
CACCCGAAGATTTATTTGTGGAATCGGTTAAAAAATTGAAGCTTTCATAT
ATAAACATAAACAAATATTTCATCCGATTCTATCGATATCTAGAAAATAA
ATATGATAATGAAGTTTGCAAGTTTTGCTATATAAATGGCGTGTCTGTGA
TTTATAAACCATGTGGACATAAAATACACTGTGAATACTGTTCTTTTATG
CCTCATAAATGCGCTGAATGCAATGAGGATATTGAGGAGAAAGTTTTTGA
TGGCGATAAAAATCATTTAATTACTTATGATAATTGGGAAGAATTATCAA
AATCAGTCAAAGATAACGAGTGTCCCGTAACGATGGCTGATTGGTATCTT
TATATTTCGAAAACTATTCGGCGTCTAGAGTGCACTGTTTGTAAATCAAG
AAATTGGGATATAGTATTCAAATGTGGGCATCAGCTATGTGATGATTGCT
TTAAAAATTCGAAAAAATGTGTACTATGCAATTTGGATCAACCTGAACAC
TTTAAAGTTATTGGACAATAAACTAATTGTACTGATTTTTATTCATCCAT
TTTTGAATTATTGACTAAATAATTTCATGATATTTTTTATTTAACTTTAA
AATAAATATTCTTTTTTGCTAGTAAACTGAGCCATTCCCGTTTACCGAAG
TTGAAATATTTAGTGATTTTTTTTAATCGCGTGAAATATTATTTCAGCTA
TACAAAATGTACTTGACAATCATATCCGACTCGCAAAATAACAC
back to top

protein sequence of SMED30008362-orf-1

>SMED30008362-orf-1 ID=SMED30008362-orf-1|Name=SMED30008362-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=905bp
MNSYLGLRVFPGPSWSYKFNDLLGTVNKINNLNDLFVEVRWDNGEFDKYG
IGNECRFDLLIYDSAQIGIKHLGYNCEGCNEKDIVGNKWGCFECGIFLCT
RCYMGDCHQKESHHFYRIDSANEMGTFIGKRNEKLKYKCKGIFINSEVCH
SFYPKRTGKVDSFTNKSDTYRSYAIVKLSTNKLERCLLGYNGRVEIKLLN
VDDENNVQTIYRNSLRILGRDALYNFEYSQLYDNELKTFELDMAKSVIDF
EVNDTVYVDCFNISSLKKYQNNYGESNYKVEQLIGKCGCVKLVEGNRIKV
CFENHNEEYYFNSKILYKIHNEMRMVQVTNKSTLTELIKEWKDSIKWKMT
KIDDIYWVPDTEIIEMIHEKIGVIVTNTLPGDFVGVRFNLYPHRICMLLP
RKACVDLDQRPDNSEILLPRKQIILKTNDSFDEEQIKKAIIMLNEDVDEF
TKWLDAEKSNLTIQAWNQLAVSVIESKNIRIIKSILNEFSISCKINWNTL
LYSFVDLIYTYSAIDRSPEMLEVIINHTEFNYQFTDENGDNMLHIATKKN
YVDLVELLLKSQHCIVNSVNMSTKYSALHYAVENNNCEIIKILMRYNCDI
YLLEKFDKSTALHLALKNNCFESLCSILDSLTNSLNPTLVDQHNNCIFHL
SASLNGEECYKKWKNIVADKKIDLVENMIKKFNQFKDTSKSKYLDNFSIE
EMPFAVISCLILSKSENALQTWRVKLDKTGKTPEDLFVESVKKLKLSYIN
INKYFIRFYRYLENKYDNEVCKFCYINGVSVIYKPCGHKIHCEYCSFMPH
KCAECNEDIEEKVFDGDKNHLITYDNWEELSKSVKDNECPVTMADWYLYI
SKTIRRLECTVCKSRNWDIVFKCGHQLCDDCFKNSKKCVLCNLDQPEHFK
VIGQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR037252Mib_Herc2_sf
IPR013083Znf_RING/FYVE/PHD
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR001841Znf_RING
IPR020683Ankyrin_rpt-contain_dom
IPR010606Mib_Herc2
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0016874ligase activity
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 606..638
e-value: 390.0
score: 8.0
coord: 537..567
e-value: 1.3
score: 18.1
coord: 572..601
e-value: 6.4E-4
score: 29.0
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 572..604
score: 9.591
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 537..559
score: 8.763
IPR001841Zinc finger, RING-typeSMARTSM00184ring_2coord: 858..890
e-value: 0.013
score: 24.7
coord: 770..804
e-value: 7.0
score: 4.0
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 858..891
score: 9.421
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 515..599
e-value: 1.2E-11
score: 45.0
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 537..651
score: 17.953
IPR037252Mib/herc2 domain superfamilyGENE3DG3DSA:2.30.30.920coord: 1..67
e-value: 1.6E-5
score: 26.4
IPR037252Mib/herc2 domain superfamilySUPERFAMILYSSF159034Mib/herc2 domain-likecoord: 3..63
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 848..901
e-value: 7.8E-7
score: 30.4
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 757..822
e-value: 1.5E-6
score: 29.4
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 470..685
e-value: 5.3E-21
score: 76.9
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 510..664
NoneNo IPR availablePANTHERPTHR24202FAMILY NOT NAMEDcoord: 4..616
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 54..129
IPR010606Mib-herc2PROSITEPS51416MIB_HERC2coord: 1..64
score: 13.957