SCO-spondin

Overview
NameSCO-spondin
Smed IDSMED30008350
Length (bp)5142
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SCO-spondin (SMED30008350) t-SNE clustered cells

Violin plots show distribution of expression levels for SCO-spondin (SMED30008350) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SCO-spondin (SMED30008350) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SCO-spondin (SMED30008350) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008350

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30008350SMESG000042718.1 Contig6471uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008350SMESG000042718.1 Contig6471newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
cephalic gangliaSMED30008350SMESG000042718.1 dd_Smed_v4_9342_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30008350SMESG000042718.1 dd_Smed_v4_9342_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
prepharyngeal regionSMED30008350SMESG000042718.1 dd_Smed_v6_9342_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30008350SMESG000042718.1 OX_Smed_1.0.01620ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30008350SMESG000042718.1 OX_Smed_1.0.14308ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SCO-spondin vs. Ensembl Human
Match: MUC5AC (mucin 5AC, oligomeric mucus/gel-forming [Source:HGNC Symbol;Acc:HGNC:7515])

HSP 1 Score: 386.726 bits (992), Expect = 3.548e-108
Identity = 344/1299 (26.48%), Postives = 543/1299 (41.80%), Query Frame = 3
Query:  756 ENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMY--VLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCG----XXXXXXXXXXXXXXXVASFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRLK--FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQ-WRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEV--EYGYT-CIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHT------TKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYIT-GSCDNTPQSIVDP-------PAGDNDICSTI--LNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFP--GCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMD--------SVSGC-NSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTP-GDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDI--VIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKY-EDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMC-----EGG--KHYDACASPCPQTCDTIGSNAPSHC-STTHCVEGC--SCPNGMIDLNG---ECV-----PPTTCPCFYNGQSYVNGAIIKME-NCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCDD 4463
             N   C ++G  +Y+TFD  ++ + G C+Y+ +     +   ++I +     ++     +V++   G V+  + G+ ++   + +  L P S     S ++I  +  Y  V  +   +L+     ++ L+ D                   GLCG        +     +       FGN  K     D         P +       C ++     F GC  LV+  +Y   C Q++C              +   +C  L+ YS  C+  G   Q WR    C  +CP N  + +C S C  TC N  Q  S  C++  V  C C  G V  + G T C+    C C+Y+G  + PG     DC  CTC+   W C E  CP TC ++G   F TFDG ++  +   C YV  +P                           +SA+    ++    +  S+  LK+ +  L  +QT V I            T+LP +  +  I       I  +  +     L    +  ++++++  L+    GLCG F+    +DF      +  +      ++ T  +C N   S  DP              CS +   +GP F  C  + K    +Y+       +  + +   C+A+ +   AC   G+Q    +   +    +  C    T +     TCQ TCR L+E   + C     P  GC CP   +   TG+CV  S C C++    +   IP G ++  +   C C +G+L+C        PVC    V+ D        + +GC  SC   D    +      C CP+  V+  +G C+   DCPC++    Y     I + C    C +RMW    +    C A C  YGD HY T DGQ +SF G C YTL+    G   +      +   N+ CG +  TC+K ++I +GG    LS G  + I      ++   I Q+  +  + +D IGL +LWD+ T +++ L P F+G V GLCGN+D    N++   +     D ++F  S+  +   CP  ++P         +D C ANP RKSWA++ C ++      FA+C    H +  RYY  C+ DAC C+ GGDCEC CT++A +A  C  +G+ V WRT ++CP+ C     EG    HY  C  PC +TC     N    C      +EGC   CP      +    +CV     PP    C  +G+SY  GA++  + NC+ C C +    CT     C+ T    +F   D
Sbjct:   76 HNGRVCSTWGSFHYKTFDGDVFRFPGLCNYVFSEHCGAAYEDFNIQLRRSQESAAPTLSRVLMKVDGVVIQLTKGSVLV---NGHPVLLPFS----QSGVLIQQSSSYTKVEARLGLVLMWNHDDSLLLELDTKYA-----------NKTCGLCGDFNGMPVVSELLSHNTKLTPMEFGNLQKMDDPTDQCQDPVPEPPRNCSTGFGICEELLHGQLFSGCVALVDVGSYLEACRQDLCFCEDTD--------LLSCVCHTLAEYSRQCTHAGGLPQDWRGPDFCPQKCPNNMQYHECRSPCADTCSN--QEHSRACEDHCVAGCFCPEGTVLDDIGQTGCVPVSKCACVYNGAAYAPGATYSTDCTNCTCSGGRWSCQEVPCPGTCSVLGGAHFSTFDGKQYTVHG-DCSYVLTKPC-------------------------DSSAFTVLAELRRCGLTDSETCLKSVTLSLDGAQTVVVIKASGEVFLNQIYTQLPISAANVTIFRPSTFFIIAQTSLGLQLNLQLVPTMQLFMQLAPKLRGQTCGLCGNFNSIQADDFRTLSGVVEATAAAFFNTFKTQAACPNIRNSFEDPCSLSVENEKYAQHWCSQLTDADGP-FGRCHAAVK-PGTYYSNCMFDTCNCERSEDCLCAALSSYVHACAAKGVQLGG-WRDGVCTKPMTTCPKSMT-YHYHVSTCQPTCRSLSEGDIT-CSVGFIPVDGCICPKGTFLDDTGKCVQASNCPCYH----RGSMIPNGESVHDSGAICTCTHGKLSC-IGGQAPAPVCAAPMVFFDCRNATPGDTGAGCQKSCHTLDMTCYSPQCVPGCVCPDGLVADGEGGCITAEDCPCVHNEASYRAGQTIRVGCNTCTCDSRMWRCTDDP---CLATCAVYGDGHYLTFDGQSYSFNGDCEYTLVQNHCGGKDSTQDSFRVVTENVPCGTTGTTCSKAIKIFLGGFELKLSHGKVEVIGTDESQEVPYTIRQMGIYLVVDTD-IGLVLLWDKKTSIFINLSPEFKGRVCGLCGNFDDIAVNDFATRSRSVVGDVLEFGNSWKLSPS-CPDALAP---------KDPCTANPFRKSWAQKQCSILH--GPTFAAC--HAHVEPARYYEACVNDACACDSGGDCECFCTAVAAYAQACHEVGLCVSWRTPSICPLFCDYYNPEGQCEWHYQPCGVPCLRTC----RNPRGDCLRDVRGLEGCYPKCPPEAPIFDEDKMQCVATCPTPPLPPRCHVHGKSYRPGAVVPSDKNCQSCLCTERGVECTYKAEACVCTYNGQRFHPGD 1288          

HSP 2 Score: 83.9593 bits (206), Expect = 2.795e-15
Identity = 113/430 (26.28%), Postives = 161/430 (37.44%), Query Frame = 3
Query:  762 FTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAP--SDVSAVTWSINIVYENC---TSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCG-----XXXXXXXXXXXXXXXVASFGNSFK-GFGCPDIANTLSTCK--PDDQILANQQCSKIR-LKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLC---------ETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVG------RC-----ICGSGEVEYGYTCIKPESCP-CLYDGQEHPPGTVRQFD--CNTCTCNSSLWHCTEKICPSTCGIMGTQFDTFDGAKFAFNDV 1940
              TC  YG  +Y TFD Q Y++ G C Y L         +   S  +V EN    T+ T C K I I  G   +K S   +              V  TD +  +P    Y +RQ    L+      + L WD          +  + G V GLCG       ++  +   S   +V  FGNS+K    CPD       C   P  +  A +QCS +    F  C   V    Y+  CV + C      +         +  CT ++AY+ +C + G C+ WR+ ++C         E QC  +  +  C   C  TCRN    P   C     G      +C     I    +++   TC  P   P C   G+ + PG V   D  C +C C      CT K     C        T++G +F   DV
Sbjct:  900 LATCAVYGDGHYLTFDGQSYSFNGDCEYTLVQNHCGGKDSTQDSFRVVTENVPCGTTGTTCSKAIKIFLGGFELKLSHGKV-------------EVIGTDESQEVP----YTIRQMGIYLVVDTDIGLVLLWD-KKTSIFINLSPEFKGRVCGLCGNFDDIAVNDFATRSRSVVGDVLEFGNSWKLSPSCPDALAPKDPCTANPFRKSWAQKQCSILHGPTFAACHAHVEPARYYEACVNDACACDSGGD--------CECFCTAVAAYAQACHEVGLCVSWRTPSICPLFCDYYNPEGQCEWH--YQPCGVPCLRTCRN----PRGDCLRDVRGLEGCYPKCPPEAPIFDEDKMQCVATCPTPPLPPRCHVHGKSYRPGAVVPSDKNCQSCLCTERGVECTYKAEACVC--------TYNGQRFHPGDV 1289          

HSP 3 Score: 74.7146 bits (182), Expect = 1.906e-12
Identity = 100/422 (23.70%), Postives = 164/422 (38.86%), Query Frame = 3
Query: 3303 NCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPI----TISVANIACGFSLA-TCAKFVQIIIGGQTYLLSRG------------NNDTI-PLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKP--SFQGNVQGLCGNYDGDLQNE-------------YMHGTMKYEDAIQFA------------ESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKW--RTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHC---VEGCSCPNGM--IDLNGECVPPTTCP-CF-YNGQSYVNGAIIKMENCKKCQCVQAKFNCT 4406
             C+ VC  +GDPHY T DG  ++F  +C Y L+         I P+     + V N  CG     +C + + +       +L+R             NN  + P F K  IV+ ++          +G++V++  S  ++    P   F  N +G CG    D ++E              M G        Q A             + + +  + P  +     V P+     C  +P        +C ++   + VF  C   +   +  +Y  C++D C      D + +C+SL  +A  CA   I + W  RT ++CP  C   K Y  C    P  C   G+++ S  +        EGC CP GM     + +   PT CP C   +G+    G  + M+ C++C C  A +  T
Sbjct: 4916 QCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLV-------QQIVPVYGHFRVLVDNYFCGAEDGLSCPRSIILEYHQDRVVLTRKPVHGVMTNEIIFNNKVVSPGFRKNGIVVSRIGVKMYATIPELGVQVMF--SGLIFSVEVPFSKFANNTEGQCGTCTNDRKDECRTPRGTVVASCSEMSGLWNVSIPDQPACHRPHPTPTTVGPTTVGSTTVGPTTVG-STTVGPTTPPAPCLPSP--------ICQLI--LSKVFEPCHTVIPPLL--FYEGCVFDRCHMT---DLDVVCSSLELYAALCASHDICIDWRGRTGHMCPFTCPADKVYQPCGPSNPSYC--YGNDSASLGALPEAGPITEGCFCPEGMTLFSTSAQVCVPTGCPRCLGPHGEPVKVGHTVGMD-CQECTCEAATWTLT 5309          
BLAST of SCO-spondin vs. Ensembl Human
Match: MUC5AC (mucin 5AC, oligomeric mucus/gel-forming [Source:HGNC Symbol;Acc:HGNC:7515])

HSP 1 Score: 386.726 bits (992), Expect = 3.548e-108
Identity = 344/1299 (26.48%), Postives = 543/1299 (41.80%), Query Frame = 3
Query:  756 ENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMY--VLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCG----XXXXXXXXXXXXXXXVASFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRLK--FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQ-WRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEV--EYGYT-CIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHT------TKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYIT-GSCDNTPQSIVDP-------PAGDNDICSTI--LNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFP--GCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMD--------SVSGC-NSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTP-GDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDI--VIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKY-EDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMC-----EGG--KHYDACASPCPQTCDTIGSNAPSHC-STTHCVEGC--SCPNGMIDLNG---ECV-----PPTTCPCFYNGQSYVNGAIIKME-NCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCDD 4463
             N   C ++G  +Y+TFD  ++ + G C+Y+ +     +   ++I +     ++     +V++   G V+  + G+ ++   + +  L P S     S ++I  +  Y  V  +   +L+     ++ L+ D                   GLCG        +     +       FGN  K     D         P +       C ++     F GC  LV+  +Y   C Q++C              +   +C  L+ YS  C+  G   Q WR    C  +CP N  + +C S C  TC N  Q  S  C++  V  C C  G V  + G T C+    C C+Y+G  + PG     DC  CTC+   W C E  CP TC ++G   F TFDG ++  +   C YV  +P                           +SA+    ++    +  S+  LK+ +  L  +QT V I            T+LP +  +  I       I  +  +     L    +  ++++++  L+    GLCG F+    +DF      +  +      ++ T  +C N   S  DP              CS +   +GP F  C  + K    +Y+       +  + +   C+A+ +   AC   G+Q    +   +    +  C    T +     TCQ TCR L+E   + C     P  GC CP   +   TG+CV  S C C++    +   IP G ++  +   C C +G+L+C        PVC    V+ D        + +GC  SC   D    +      C CP+  V+  +G C+   DCPC++    Y     I + C    C +RMW    +    C A C  YGD HY T DGQ +SF G C YTL+    G   +      +   N+ CG +  TC+K ++I +GG    LS G  + I      ++   I Q+  +  + +D IGL +LWD+ T +++ L P F+G V GLCGN+D    N++   +     D ++F  S+  +   CP  ++P         +D C ANP RKSWA++ C ++      FA+C    H +  RYY  C+ DAC C+ GGDCEC CT++A +A  C  +G+ V WRT ++CP+ C     EG    HY  C  PC +TC     N    C      +EGC   CP      +    +CV     PP    C  +G+SY  GA++  + NC+ C C +    CT     C+ T    +F   D
Sbjct:   76 HNGRVCSTWGSFHYKTFDGDVFRFPGLCNYVFSEHCGAAYEDFNIQLRRSQESAAPTLSRVLMKVDGVVIQLTKGSVLV---NGHPVLLPFS----QSGVLIQQSSSYTKVEARLGLVLMWNHDDSLLLELDTKYA-----------NKTCGLCGDFNGMPVVSELLSHNTKLTPMEFGNLQKMDDPTDQCQDPVPEPPRNCSTGFGICEELLHGQLFSGCVALVDVGSYLEACRQDLCFCEDTD--------LLSCVCHTLAEYSRQCTHAGGLPQDWRGPDFCPQKCPNNMQYHECRSPCADTCSN--QEHSRACEDHCVAGCFCPEGTVLDDIGQTGCVPVSKCACVYNGAAYAPGATYSTDCTNCTCSGGRWSCQEVPCPGTCSVLGGAHFSTFDGKQYTVHG-DCSYVLTKPC-------------------------DSSAFTVLAELRRCGLTDSETCLKSVTLSLDGAQTVVVIKASGEVFLNQIYTQLPISAANVTIFRPSTFFIIAQTSLGLQLNLQLVPTMQLFMQLAPKLRGQTCGLCGNFNSIQADDFRTLSGVVEATAAAFFNTFKTQAACPNIRNSFEDPCSLSVENEKYAQHWCSQLTDADGP-FGRCHAAVK-PGTYYSNCMFDTCNCERSEDCLCAALSSYVHACAAKGVQLGG-WRDGVCTKPMTTCPKSMT-YHYHVSTCQPTCRSLSEGDIT-CSVGFIPVDGCICPKGTFLDDTGKCVQASNCPCYH----RGSMIPNGESVHDSGAICTCTHGKLSC-IGGQAPAPVCAAPMVFFDCRNATPGDTGAGCQKSCHTLDMTCYSPQCVPGCVCPDGLVADGEGGCITAEDCPCVHNEASYRAGQTIRVGCNTCTCDSRMWRCTDDP---CLATCAVYGDGHYLTFDGQSYSFNGDCEYTLVQNHCGGKDSTQDSFRVVTENVPCGTTGTTCSKAIKIFLGGFELKLSHGKVEVIGTDESQEVPYTIRQMGIYLVVDTD-IGLVLLWDKKTSIFINLSPEFKGRVCGLCGNFDDIAVNDFATRSRSVVGDVLEFGNSWKLSPS-CPDALAP---------KDPCTANPFRKSWAQKQCSILH--GPTFAAC--HAHVEPARYYEACVNDACACDSGGDCECFCTAVAAYAQACHEVGLCVSWRTPSICPLFCDYYNPEGQCEWHYQPCGVPCLRTC----RNPRGDCLRDVRGLEGCYPKCPPEAPIFDEDKMQCVATCPTPPLPPRCHVHGKSYRPGAVVPSDKNCQSCLCTERGVECTYKAEACVCTYNGQRFHPGD 1288          

HSP 2 Score: 83.9593 bits (206), Expect = 2.795e-15
Identity = 113/430 (26.28%), Postives = 161/430 (37.44%), Query Frame = 3
Query:  762 FTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAP--SDVSAVTWSINIVYENC---TSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCG-----XXXXXXXXXXXXXXXVASFGNSFK-GFGCPDIANTLSTCK--PDDQILANQQCSKIR-LKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLC---------ETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVG------RC-----ICGSGEVEYGYTCIKPESCP-CLYDGQEHPPGTVRQFD--CNTCTCNSSLWHCTEKICPSTCGIMGTQFDTFDGAKFAFNDV 1940
              TC  YG  +Y TFD Q Y++ G C Y L         +   S  +V EN    T+ T C K I I  G   +K S   +              V  TD +  +P    Y +RQ    L+      + L WD          +  + G V GLCG       ++  +   S   +V  FGNS+K    CPD       C   P  +  A +QCS +    F  C   V    Y+  CV + C      +         +  CT ++AY+ +C + G C+ WR+ ++C         E QC  +  +  C   C  TCRN    P   C     G      +C     I    +++   TC  P   P C   G+ + PG V   D  C +C C      CT K     C        T++G +F   DV
Sbjct:  900 LATCAVYGDGHYLTFDGQSYSFNGDCEYTLVQNHCGGKDSTQDSFRVVTENVPCGTTGTTCSKAIKIFLGGFELKLSHGKV-------------EVIGTDESQEVP----YTIRQMGIYLVVDTDIGLVLLWD-KKTSIFINLSPEFKGRVCGLCGNFDDIAVNDFATRSRSVVGDVLEFGNSWKLSPSCPDALAPKDPCTANPFRKSWAQKQCSILHGPTFAACHAHVEPARYYEACVNDACACDSGGD--------CECFCTAVAAYAQACHEVGLCVSWRTPSICPLFCDYYNPEGQCEWH--YQPCGVPCLRTCRN----PRGDCLRDVRGLEGCYPKCPPEAPIFDEDKMQCVATCPTPPLPPRCHVHGKSYRPGAVVPSDKNCQSCLCTERGVECTYKAEACVC--------TYNGQRFHPGDV 1289          

HSP 3 Score: 74.7146 bits (182), Expect = 1.906e-12
Identity = 100/422 (23.70%), Postives = 164/422 (38.86%), Query Frame = 3
Query: 3303 NCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPI----TISVANIACGFSLA-TCAKFVQIIIGGQTYLLSRG------------NNDTI-PLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKP--SFQGNVQGLCGNYDGDLQNE-------------YMHGTMKYEDAIQFA------------ESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKW--RTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHC---VEGCSCPNGM--IDLNGECVPPTTCP-CF-YNGQSYVNGAIIKMENCKKCQCVQAKFNCT 4406
             C+ VC  +GDPHY T DG  ++F  +C Y L+         I P+     + V N  CG     +C + + +       +L+R             NN  + P F K  IV+ ++          +G++V++  S  ++    P   F  N +G CG    D ++E              M G        Q A             + + +  + P  +     V P+     C  +P        +C ++   + VF  C   +   +  +Y  C++D C      D + +C+SL  +A  CA   I + W  RT ++CP  C   K Y  C    P  C   G+++ S  +        EGC CP GM     + +   PT CP C   +G+    G  + M+ C++C C  A +  T
Sbjct: 4916 QCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLV-------QQIVPVYGHFRVLVDNYFCGAEDGLSCPRSIILEYHQDRVVLTRKPVHGVMTNEIIFNNKVVSPGFRKNGIVVSRIGVKMYATIPELGVQVMF--SGLIFSVEVPFSKFANNTEGQCGTCTNDRKDECRTPRGTVVASCSEMSGLWNVSIPDQPACHRPHPTPTTVGPTTVGSTTVGPTTVG-STTVGPTTPPAPCLPSP--------ICQLI--LSKVFEPCHTVIPPLL--FYEGCVFDRCHMT---DLDVVCSSLELYAALCASHDICIDWRGRTGHMCPFTCPADKVYQPCGPSNPSYC--YGNDSASLGALPEAGPITEGCFCPEGMTLFSTSAQVCVPTGCPRCLGPHGEPVKVGHTVGMD-CQECTCEAATWTLT 5309          
BLAST of SCO-spondin vs. Ensembl Human
Match: MUC2 (mucin 2, oligomeric mucus/gel-forming [Source:HGNC Symbol;Acc:HGNC:7512])

HSP 1 Score: 335.109 bits (858), Expect = 1.583e-92
Identity = 327/1288 (25.39%), Postives = 535/1288 (41.54%), Query Frame = 3
Query:  726 NFAGGNDVNNENFT------TCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMY-----VLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVA----SFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRLK---------FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCI-QWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEV--EYGYT-CIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY-ITGSCDNTPQSIVDP------PAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQ---SSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFP--GCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMD---------SVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDS-IGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYM-HGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMC-------EGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGC--SCPNGMI----DLNGECVPPTTCPCFYNGQSYVNGAIIKMEN-CKKCQCVQA 4391
            + AGG+++  E  T       C ++G  +Y+TFD  ++ + G C Y   +    S   +++++                   G     +    IL T   +       +   + A++   TP Y     + + D +  +   AG + L W+  + + + +          GLCG+ +   S      D V      FGN  K    PD+      C+  ++ +A   CS+ R +         F  C DLV  + Y   C Q+ C            P     +C+ ++ +S  CS  G     WR+ TLC   CPGN ++ +  S C  TC +L    S+ C+  ++  C C  G V  + G + C+    C C   G  + PG     DC  C CN+  W C +  CP TC + G +   TFDG  + F+   C YV  +   N++           S  +             +  +V  K +GS +        L + Q N           LP      ++      +I   + +    ++       +++ +  A +  + GLCG F+G   +DF      +  +    A ++    SC +    + DP       A   +   ++L   E       S VD   Y   C+ +     +N+D L  C+A+ + A AC   G+     +  ++    +  C     VF     TCQ TCR L+EA  S C +   P  GC CP + +    G+CV  ++C+C++    +   + AG  +    + CVC +GRL+C+ +       C   +++MD         S     SC         +   + C CP+  +    G CV   +CPC++ N  Y+    I + C    C    W       A C   C  YG  HY T DG+ + F G C Y  +      ++++   +I   N+ CG +  TC+K ++I +G     L   +   I     + +          LV +S  G+ V+WD+ T V++ L PS++G V GLCGN+D    N++     M     + F  S+   A  CP       +V+ + E   C+ NP R+SWAE+ C ++K +  VF+ C   +  D   +Y  C++D+C C+ GGDCEC C+++A++A +C   G  V WRT +LCPI C       E   HY+ C +   +TC TI +   S+ S ++ +EGC   CP        DL  +CV    C C+     Y  GA +  E  CK C C  +
Sbjct:   16 SLAGGSELQTEGRTRNHGHNVCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRG---------------PGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVV--STPHYSPGLLIEKSDAYTKVYSRAG-LTLMWNREDALMLELDTKFR-NHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQK-INQPDVV-----CEDPEEEVAPASCSEHRAECERLLTAEAFADCQDLVPLEPYLRACQQDRCR----------CPGGDTCVCSTVAEFSRQCSHAGGRPGNWRTATLCPKTCPGNLVYLESGSPCMDTCSHL--EVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLYTPGQEITNDCEQCVCNAGRWVCKDLPCPGTCALEGGSHITTFDGKTYTFHG-DCYYVLAKGDHNDSYALLGELAPCGSTDKQTCLKTVVLLADKKKNVVVFKSDGSVL--------LNELQVN-----------LPHVTASFSVFRPSSYHIMVSMAIGVRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKAQSSCHDKLDWLDDPCSLNIESANYAEHWCSLLKKTETPFGRCHSAVDPAEYYKRCKYDTCNCQNNEDCL--CAALSSYARACTAKGVML-WGWREHVCNKDVGSC-PNSQVFLYNLTTCQQTCRSLSEAD-SHCLEGFAPVDGCGCPDHTFLDEKGRCVPLAKCSCYH----RGLYLEAGDVVVRQEERCVCRDGRLHCR-QIRLIGQSCTAPKIHMDCSNLTALATSKPRALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCNTCTCKRGRWVCTQ---AVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVVESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNSW-KEAPTCP-------DVSTNPEP--CSLNPHRRSWAEKQCSILKSS--VFSICHSKV--DPKPFYEACVHDSCSCDTGGDCECFCSAVASYAQECTKEGACVFWRTPDLCPIFCDYYNPPHECEWHYEPCGNRSFETCRTI-NGIHSNISVSY-LEGCYPRCPKDRPIYEEDLK-KCVTADKCGCYVEDTHYPPGASVPTEETCKSCVCTNS 1216          

HSP 2 Score: 139.428 bits (350), Expect = 3.172e-32
Identity = 132/487 (27.10%), Postives = 218/487 (44.76%), Query Frame = 3
Query: 3033 CPKNQVYMDSVSGCNSCTNYDTCT--DTSSI-----ANSCGCPNDTVSKI--DGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIA-CGFS-LATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTF---------FTQLVSDSIGLRVLWDRSTRVYLF--LKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYE-DAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPI---MCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHC-VEGCSCPNG-MIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTE 4409
            CP N VY++S S C      DTC+  + SS+      + C CP  TV     D  CV  S C C      Y P   IT  C + +C+   W     +   C   C   G  H  T DG+ ++F G C Y L    GD +++   +      +A CG +   TC K V ++   +  ++   ++ ++ L  +  + +  +T          +  +VS +IG+R+    +  + LF  L  + QG VQGLCGN++G   +++   +   E     FA ++ A +  C  ++   +        D C+ N +  ++AE  C ++K T   F  C  A+  D   YY  C YD C C    D  CLC +L+++A  C   G+ +    +++C      C   + +    + C QTC ++ S A SHC      V+GC CP+   +D  G CVP   C C++ G  Y+    + +   ++C C   + +C +
Sbjct:  295 CPGNLVYLESGSPC-----MDTCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLYTPGQEITNDCEQCVCNAGRWVC---KDLPCPGTCALEGGSHITTFDGKTYTFHGDCYYVL--AKGDHNDSYALL----GELAPCGSTDKQTCLKTVVLLADKKKNVVVFKSDGSV-LLNELQVNLPHVTASFSVFRPSSYHIMVSMAIGVRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKAQSS-CHDKLDWLD--------DPCSLNIESANYAEHWCSLLKKTETPFGRCHSAV--DPAEYYKRCKYDTCNCQNNED--CLCAALSSYARACTAKGVMLWGWREHVCNKDVGSCPNSQVFLYNLTTCQQTCRSL-SEADSHCLEGFAPVDGCGCPDHTFLDEKGRCVPLAKCSCYHRGL-YLEAGDVVVRQEERCVCRDGRLHCRQ 751          

HSP 3 Score: 117.087 bits (292), Expect = 2.384e-25
Identity = 106/377 (28.12%), Postives = 172/377 (45.62%), Query Frame = 3
Query: 3315 VCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGN---NDTIPLFPKYD--IVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQN--EYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNAN-PDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLG-IPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMI--DL-NGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTE 4409
            VC  +G+ HYKT DG +F F G C Y       D   +     + +             + + + I   T  L+R     N  +   P Y   ++IE+   +T++ S + GL ++W+R   + L L   F+ +  GLCG+Y+G LQ+  E++       D + F+     N      +I+  + V    E+++  A+  + ++  E++      T   FA C + +   +  Y   C  D C C  GGD  C+C+++A F+ QC+  G  P  WRT  LCP  C G   Y    SPC  TC  +     S C   H ++GC CP G +  D+ +  CVP + C C  +G  Y  G  I   +C++C C   ++ C +
Sbjct:   36 VCSTWGNFHYKTFDGDVFRFPGLCDYNFAS---DCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRA-GLTLMWNREDALMLELDTKFRNHTCGLCGDYNG-LQSYSEFL------SDGVLFSPLEFGNMQ----KINQPDVVCEDPEEEVAPASCSEHRAECERLL-----TAEAFADCQDLV--PLEPYLRACQQDRCRCP-GGD-TCVCSTVAEFSRQCSHAGGRPGNWRTATLCPKTCPGNLVYLESGSPCMDTCSHL--EVSSLCE-EHRMDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLYTPGQEI-TNDCEQCVCNAGRWVCKD 384          
BLAST of SCO-spondin vs. Ensembl Human
Match: MUC2 (mucin 2, oligomeric mucus/gel-forming [Source:HGNC Symbol;Acc:HGNC:7512])

HSP 1 Score: 335.109 bits (858), Expect = 4.693e-92
Identity = 327/1287 (25.41%), Postives = 540/1287 (41.96%), Query Frame = 3
Query:  726 NFAGGNDVNNENFT------TCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVA----SFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRLK---------FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCI-QWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEV--EYGYT-CIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY-ITGSCDNTPQSIVDP------PAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQ---SSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFP--GCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCK----TKDNCTNPVCPKNQVYMD---------SVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDS-IGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYM-HGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMC-------EGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGC--SCPNGMI----DLNGECVPPTTCPCFYNGQSYVNGAIIKMEN-CKKCQCVQA 4391
            + AGG+++  E  T       C ++G  +Y+TFD  ++ + G C Y   +    S   +++++         G  +       + ++ +  +  +Y T     L  L+     +    PG  + + + D +  +   AG + L W+  + + + +          GLCG+ +   S      D V      FGN  +    PD+      C+  ++ +A   CS+ R +         F  C DLV  + Y   C Q+ C            P     +C+ ++ +S  CS  G     WR+ TLC   CPGN ++ +  S C  TC +L    S+ C+  ++  C C  G V  + G + C+    C C   G  + PG     DC  C CN+  W C +  CP TC + G +   TFDG  + F+   C YV  +   N++           S  +             +  +V  K +GS +        L + Q N           LP      ++      +I   + +    ++       +++ +  A +  + GLCG F+G   +DF      +  +    A ++    SC +    + DP       A   +   ++L   E       S VD   Y   C+ +     +N+D L  C+A+ + A AC   G+     +  ++    +  C     VF     TCQ TCR L+EA  S C +   P  GC CP + +    G+CV  ++C+C++    +   + AG  +    + CVC +GRL+C+       +CT P     +++MD         S     SC         +   + C CP+  +    G CV   +CPC++ N  Y+    I + C    C    W       A C   C  YG  HY T DG+ + F G C Y  +      ++++   +I   N+ CG +  TC+K ++I +G     L   +   I     + +          LV +S  G+ V+WD+ T V++ L PS++G V GLCGN+D    N++     M     + F  S+   A  CP       +V+ + E   C+ NP R+SWAE+ C ++K +  VF+ C   +  D   +Y  C++D+C C+ GGDCEC C+++A++A +C   G  V WRT +LCPI C       E   HY+ C +   +TC TI +   S+ S ++ +EGC   CP        DL  +CV    C C+     Y  GA +  E  CK C C  +
Sbjct:   16 SLAGGSELQTEGRTRNHGHNVCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHL-------KRGPGQAEAPAGVESILLTIKDDTIYLTRH---LAVLNGAVVSTPHYSPG--LLIEKSDAYTKVYSRAG-LTLMWNREDALMLELDTKFR-NHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGN-MQKINQPDVV-----CEDPEEEVAPASCSEHRAECERLLTAEAFADCQDLVPLEPYLRACQQDRCR----------CPGGDTCVCSTVAEFSRQCSHAGGRPGNWRTATLCPKTCPGNLVYLESGSPCMDTCSHL--EVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLYTPGQEITNDCEQCVCNAGRWVCKDLPCPGTCALEGGSHITTFDGKTYTFHG-DCYYVLAKGDHNDSYALLGELAPCGSTDKQTCLKTVVLLADKKKNVVVFKSDGSVL--------LNELQVN-----------LPHVTASFSVFRPSSYHIMVSMAIGVRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKAQSSCHDKLDWLDDPCSLNIESANYAEHWCSLLKKTETPFGRCHSAVDPAEYYKRCKYDTCNCQNNEDCL--CAALSSYARACTAKGVML-WGWREHVCNKDVGSC-PNSQVFLYNLTTCQQTCRSLSEAD-SHCLEGFAPVDGCGCPDHTFLDEKGRCVPLAKCSCYH----RGLYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAP-----KIHMDCSNLTALATSKPRALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCNTCTCKRGRWVCTQ---AVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVVESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNSW-KEAPTCP-------DVSTNPEP--CSLNPHRRSWAEKQCSILKSS--VFSICHSKV--DPKPFYEACVHDSCSCDTGGDCECFCSAVASYAQECTKEGACVFWRTPDLCPIFCDYYNPPHECEWHYEPCGNRSFETCRTI-NGIHSNISVSY-LEGCYPRCPKDRPIYEEDLK-KCVTADKCGCYVEDTHYPPGASVPTEETCKSCVCTNS 1216          

HSP 2 Score: 139.428 bits (350), Expect = 4.658e-32
Identity = 131/486 (26.95%), Postives = 216/486 (44.44%), Query Frame = 3
Query: 3033 CPKNQVYMDSVSGCNSCTNYDTCT--DTSSI-----ANSCGCPNDTVSKI--DGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFS-LATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTF---------FTQLVSDSIGLRVLWDRSTRVYLF--LKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYE-DAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPI---MCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHC-VEGCSCPNG-MIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTE 4409
            CP N VY++S S C      DTC+  + SS+      + C CP  TV     D  CV  S C C      Y P   IT  C + +C+   W     +   C   C   G  H  T DG+ ++F G C Y L    GD +++     +      CG +   TC K V ++   +  ++   ++ ++ L  +  + +  +T          +  +VS +IG+R+    +  + LF  L  + QG VQGLCGN++G   +++   +   E     FA ++ A +  C  ++   +        D C+ N +  ++AE  C ++K T   F  C  A+  D   YY  C YD C C    D  CLC +L+++A  C   G+ +    +++C      C   + +    + C QTC ++ S A SHC      V+GC CP+   +D  G CVP   C C++ G  Y+    + +   ++C C   + +C +
Sbjct:  295 CPGNLVYLESGSPC-----MDTCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLYTPGQEITNDCEQCVCNAGRWVC---KDLPCPGTCALEGGSHITTFDGKTYTFHGDCYYVLAK--GDHNDS---YALLGELAPCGSTDKQTCLKTVVLLADKKKNVVVFKSDGSV-LLNELQVNLPHVTASFSVFRPSSYHIMVSMAIGVRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKAQSS-CHDKLDWLD--------DPCSLNIESANYAEHWCSLLKKTETPFGRCHSAV--DPAEYYKRCKYDTCNCQNNED--CLCAALSSYARACTAKGVMLWGWREHVCNKDVGSCPNSQVFLYNLTTCQQTCRSL-SEADSHCLEGFAPVDGCGCPDHTFLDEKGRCVPLAKCSCYHRGL-YLEAGDVVVRQEERCVCRDGRLHCRQ 751          

HSP 3 Score: 116.701 bits (291), Expect = 3.088e-25
Identity = 106/377 (28.12%), Postives = 172/377 (45.62%), Query Frame = 3
Query: 3315 VCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGN---NDTIPLFPKYD--IVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQN--EYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNAN-PDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLG-IPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMI--DL-NGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTE 4409
            VC  +G+ HYKT DG +F F G C Y       D   +     + +             + + + I   T  L+R     N  +   P Y   ++IE+   +T++ S + GL ++W+R   + L L   F+ +  GLCG+Y+G LQ+  E++       D + F+     N      +I+  + V    E+++  A+  + ++  E++      T   FA C + +   +  Y   C  D C C  GGD  C+C+++A F+ QC+  G  P  WRT  LCP  C G   Y    SPC  TC  +     S C   H ++GC CP G +  D+ +  CVP + C C  +G  Y  G  I   +C++C C   ++ C +
Sbjct:   36 VCSTWGNFHYKTFDGDVFRFPGLCDYNFAS---DCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRA-GLTLMWNREDALMLELDTKFRNHTCGLCGDYNG-LQSYSEFL------SDGVLFSPLEFGNMQ----KINQPDVVCEDPEEEVAPASCSEHRAECERLL-----TAEAFADCQDLV--PLEPYLRACQQDRCRCP-GGD-TCVCSTVAEFSRQCSHAGGRPGNWRTATLCPKTCPGNLVYLESGSPCMDTCSHL--EVSSLCE-EHRMDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLYTPGQEI-TNDCEQCVCNAGRWVCKD 384          

HSP 4 Score: 74.3294 bits (181), Expect = 2.327e-12
Identity = 81/342 (23.68%), Postives = 136/342 (39.77%), Query Frame = 3
Query: 3306 CEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFS-LATCAKFVQIIIGGQTYLLS-----------RGNNDTIPL-FPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNE-YMHGTMKYEDAIQFAESFIAN---ADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWR--TQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMID 4274
            C+  C  +GDPHY T DG  +S+QG+C Y L++    S +N     + + N  C  +   +C + + +    Q  L+            + N   + L + KY + + Q      +    +G+ V ++  +         F  N +G CG       ++  +       +    A+ ++ N      CP+  S     A +         P +      +C ++KD+  +FA C   +      YY  C++D+C    G   EC   SL  +A  CA   I + WR  T   C + C   + Y AC      TC +  S      + T  VEGC CP G ++
Sbjct: 2115 CDCYCTGWGDPHYVTFDGLYYSYQGNCTYVLVEEISPSVDNF---GVYIDNYHCDPNDKVSCPRTLIVRHETQEVLIKTVHMMPMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVLVSYNGLSFSVRLPYHRFGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGG-KTTPHKDCTPSPLCQLIKDS--LFAQCHALV--PPQHYYDACVFDSCF-MPGSSLEC--ASLQAYAALCAQQNICLDWRNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQQ----NNTVLVEGCFCPEGTMN 2441          
BLAST of SCO-spondin vs. Ensembl Human
Match: MUC2 (mucin 2, oligomeric mucus/gel-forming [Source:NCBI gene;Acc:4583])

HSP 1 Score: 335.109 bits (858), Expect = 7.042e-92
Identity = 328/1287 (25.49%), Postives = 540/1287 (41.96%), Query Frame = 3
Query:  726 NFAGGNDVNNENFT------TCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVA----SFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRLK---------FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCI-QWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEV--EYGYT-CIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY-ITGSCDNTPQSIVDP------PAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQ---SSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFP--GCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCK----TKDNCTNPVCPKNQVYMD---------SVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDS-IGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYM-HGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMC-------EGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGC--SCPNGMI----DLNGECVPPTTCPCFYNGQSYVNGAIIKM-ENCKKCQCVQA 4391
            + AGG+++  E  T       C ++G  +Y+TFD  ++ + G C Y   +    S   +++++         G  +       + ++ +  +  +Y T     L  L+     +    PG  + + + D +  +   AG + L W+  + + + +          GLCG+ +   S      D V      FGN  K    PD+      C+  ++ +A   CS+ R +         F  C DLV  + Y   C Q+ C            P     +C+ ++ +S  CS  G     WR+ TLC   CPGN ++ +  S C  TC +L    S+ C+  ++  C C  G V  + G + C+    C C   G  + PG     DC  C CN+  W C +  CP TC + G +   TFDG  + F+   C YV  +   N++           S  +             +  +V  K +GS +        L + Q N           LP      ++      +I   + +    ++       +++ +  A +  + GLCG F+G   +DF      +  +    A ++    SC +    + DP       A   +   ++L   E       S VD   Y   C+ +     +N+D L  C+A+ + A AC   G+     +  ++    +  C     VF     TCQ TCR L+EA  S C +   P  GC CP + +    G+CV  ++C+C++    +   + AG  +    + CVC +GRL+C+       +CT P     +++MD         S     SC         +   + C CP+  +    G CV   +CPC++ N  Y+    I + C    C    W       A C   C  YG  HY T DG+ + F G C Y  +      ++++   +I   N+ CG +  TC+K ++I +G     L   +   I     + +          LV +S  G+ V+WD+ T V++ L PS++G V GLCGN+D    N++     M     + F  S+   A  CP       +V+ + E   C+ NP R+SWAE+ C ++K +  VF+ C   +  D   +Y  C++D+C C+ GGDCEC C+++A++A +C   G  V WRT +LCPI C       E   HY+ C +   +TC TI +   S+ S ++ +EGC   CP        DL  +CV    C C+     Y  GA +   E CK C C  +
Sbjct:   16 SLAGGSELQTEGRTRNHGHNVCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHL-------KRGPGQAEAPAGVESILLTIKDDTIYLTRH---LAVLNGAVVSTPHYSPG--LLIEKSDAYTKVYSRAG-LTLMWNREDALMLELDTKFR-NHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQK-INQPDVV-----CEDPEEEVAPASCSEHRAECERLLTAEAFADCQDLVPLEPYLRACQQDRCR----------CPGGDTCVCSTVAEFSRQCSHAGGRPGNWRTATLCPKTCPGNLVYLESGSPCMDTCSHL--EVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLYTPGQEITNDCEQCVCNAGRWVCKDLPCPGTCALEGGSHITTFDGKTYTFHG-DCYYVLAKGDHNDSYALLGELAPCGSTDKQTCLKTVVLLADKKKNVVVFKSDGSVL--------LNELQVN-----------LPHVTASFSVFRPSSYHIMVSMAIGVRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKAQSSCHDKLDWLDDPCSLNIESANYAEHWCSLLKKTETPFGRCHSAVDPAEYYKRCKYDTCNCQNNEDCL--CAALSSYARACTAKGVML-WGWREHVCNKDVGSC-PNSQVFLYNLTTCQQTCRSLSEAD-SHCLEGFAPVDGCGCPDHTFLDEKGRCVPLAKCSCYH----RGLYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAP-----KIHMDCSNLTALATSKPRALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCNTCTCKRGRWVCTQ---AVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVVESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNSW-KEAPTCP-------DVSTNPEP--CSLNPHRRSWAEKQCSILKSS--VFSICHSKV--DPKPFYEACVHDSCSCDTGGDCECFCSAVASYAQECTKEGACVFWRTPDLCPIFCDYYNPPHECEWHYEPCGNRSFETCRTI-NGIHSNISVSY-LEGCYPRCPKDRPIYEEDLK-KCVTADKCGCYVEDTHYPPGASVPTEETCKSCVCTNS 1216          

HSP 2 Score: 139.043 bits (349), Expect = 6.440e-32
Identity = 131/486 (26.95%), Postives = 216/486 (44.44%), Query Frame = 3
Query: 3033 CPKNQVYMDSVSGCNSCTNYDTCT--DTSSI-----ANSCGCPNDTVSKI--DGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFS-LATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTF---------FTQLVSDSIGLRVLWDRSTRVYLF--LKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYE-DAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPI---MCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHC-VEGCSCPNG-MIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTE 4409
            CP N VY++S S C      DTC+  + SS+      + C CP  TV     D  CV  S C C      Y P   IT  C + +C+   W     +   C   C   G  H  T DG+ ++F G C Y L    GD +++     +      CG +   TC K V ++   +  ++   ++ ++ L  +  + +  +T          +  +VS +IG+R+    +  + LF  L  + QG VQGLCGN++G   +++   +   E     FA ++ A +  C  ++   +        D C+ N +  ++AE  C ++K T   F  C  A+  D   YY  C YD C C    D  CLC +L+++A  C   G+ +    +++C      C   + +    + C QTC ++ S A SHC      V+GC CP+   +D  G CVP   C C++ G  Y+    + +   ++C C   + +C +
Sbjct:  295 CPGNLVYLESGSPC-----MDTCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLYTPGQEITNDCEQCVCNAGRWVC---KDLPCPGTCALEGGSHITTFDGKTYTFHGDCYYVLAK--GDHNDS---YALLGELAPCGSTDKQTCLKTVVLLADKKKNVVVFKSDGSV-LLNELQVNLPHVTASFSVFRPSSYHIMVSMAIGVRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKAQSS-CHDKLDWLD--------DPCSLNIESANYAEHWCSLLKKTETPFGRCHSAV--DPAEYYKRCKYDTCNCQNNED--CLCAALSSYARACTAKGVMLWGWREHVCNKDVGSCPNSQVFLYNLTTCQQTCRSL-SEADSHCLEGFAPVDGCGCPDHTFLDEKGRCVPLAKCSCYHRGL-YLEAGDVVVRQEERCVCRDGRLHCRQ 751          

HSP 3 Score: 116.701 bits (291), Expect = 4.235e-25
Identity = 106/377 (28.12%), Postives = 172/377 (45.62%), Query Frame = 3
Query: 3315 VCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGN---NDTIPLFPKYD--IVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQN--EYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNAN-PDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLG-IPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMI--DL-NGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTE 4409
            VC  +G+ HYKT DG +F F G C Y       D   +     + +             + + + I   T  L+R     N  +   P Y   ++IE+   +T++ S + GL ++W+R   + L L   F+ +  GLCG+Y+G LQ+  E++       D + F+     N      +I+  + V    E+++  A+  + ++  E++      T   FA C + +   +  Y   C  D C C  GGD  C+C+++A F+ QC+  G  P  WRT  LCP  C G   Y    SPC  TC  +     S C   H ++GC CP G +  D+ +  CVP + C C  +G  Y  G  I   +C++C C   ++ C +
Sbjct:   36 VCSTWGNFHYKTFDGDVFRFPGLCDYNFAS---DCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRA-GLTLMWNREDALMLELDTKFRNHTCGLCGDYNG-LQSYSEFL------SDGVLFSPLEFGNMQ----KINQPDVVCEDPEEEVAPASCSEHRAECERLL-----TAEAFADCQDLV--PLEPYLRACQQDRCRCP-GGD-TCVCSTVAEFSRQCSHAGGRPGNWRTATLCPKTCPGNLVYLESGSPCMDTCSHL--EVSSLCE-EHRMDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLYTPGQEI-TNDCEQCVCNAGRWVCKD 384          

HSP 4 Score: 74.3294 bits (181), Expect = 2.675e-12
Identity = 81/342 (23.68%), Postives = 136/342 (39.77%), Query Frame = 3
Query: 3306 CEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFS-LATCAKFVQIIIGGQTYLLS-----------RGNNDTIPL-FPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNE-YMHGTMKYEDAIQFAESFIAN---ADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWR--TQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMID 4274
            C+  C  +GDPHY T DG  +S+QG+C Y L++    S +N     + + N  C  +   +C + + +    Q  L+            + N   + L + KY + + Q      +    +G+ V ++  +         F  N +G CG       ++  +       +    A+ ++ N      CP+  S     A +         P +      +C ++KD+  +FA C   +      YY  C++D+C    G   EC   SL  +A  CA   I + WR  T   C + C   + Y AC      TC +  S      + T  VEGC CP G ++
Sbjct: 4471 CDCYCTGWGDPHYVTFDGLYYSYQGNCTYVLVEEISPSVDNF---GVYIDNYHCDPNDKVSCPRTLIVRHETQEVLIKTVHMMPMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVLVSYNGLSFSVRLPYHRFGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGG-KTTPHKDCTPSPLCQLIKDS--LFAQCHALV--PPQHYYDACVFDSCF-MPGSSLEC--ASLQAYAALCAQQNICLDWRNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQQ----NNTVLVEGCFCPEGTMN 4797          
BLAST of SCO-spondin vs. Ensembl Celegans
Match: lrp-2 (Low-density lipoprotein RecePtor related [Source:UniProtKB/TrEMBL;Acc:O01768])

HSP 1 Score: 84.3445 bits (207), Expect = 9.198e-16
Identity = 87/239 (36.40%), Postives = 112/239 (46.86%), Query Frame = 3
Query: 4410 DYSDCITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNC---NVCDLQQF------QCISNGACIPMTKKCDGTQNCEDNSDEISCGC----------------LPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENC--KKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWN-----GFDEKNC 5030
            D S+C  TC  ++FRC  G CI S   C+ + DC+++ DE  C   N   L +F       C +   CI  + KCDGT +C D SDE  C                     Q  C  +RTC+ +   CDG  DC   D SDE+NC  KKC   E+ C +S+ CI L  KCDG+ DC DG DEH CE  C             +T    N +CI    +CDG  DC +     G DE +C
Sbjct: 2711 DESNC--TCNENEFRCQSGACIPSKARCNHMQDCNDASDEIGCPFRNCSALNEFGMTGLINCATTSQCIHPSWKCDGTNDCYDGSDEKDCFVEFDATGGSVSAPRSCDAKTQFACLATRTCMPKHWQCDGQPDCA--DGSDEKNCDAKKCTSFEFSCESSKKCIPLEQKCDGRRDCPDGEDEHQCETECDS-------KGGNATFRCTNHRCIPMAWRCDGTDDCMDNAKSLGSDEVDC 2938          

HSP 2 Score: 77.0258 bits (188), Expect = 1.695e-13
Identity = 82/235 (34.89%), Postives = 113/235 (48.09%), Query Frame = 3
Query: 4407 EDYSDCIT-TCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGC----------LPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENC--------------KKCQM-TEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNCE 5033
            ED   C T  C P  F C +G CI   K+C+++ DC+N  DE NC  C+  +F+C S GACIP   +C+  Q+C D SDEI C            +   I C  +  CI     CDG  DC   D SDE++C              + C   T++ C  ++ C+  + +CDGQ DC DGSDE  C+          CE+ +         +CI   ++CDG  DC +G DE  CE
Sbjct: 2671 EDTKYCSTRVCRPGYFNCGNGLCIPEQKVCNRINDCANFADESNC-TCNENEFRCQS-GACIPSKARCNHMQDCNDASDEIGCPFRNCSALNEFGMTGLINCATTSQCIHPSWKCDGTNDC--YDGSDEKDCFVEFDATGGSVSAPRSCDAKTQFACLATRTCMPKHWQCDGQPDCADGSDEKNCDAKKCTSFEFSCESSK---------KCIPLEQKCDGRRDCPDGEDEHQCE 2892          

HSP 3 Score: 68.5514 bits (166), Expect = 5.860e-11
Identity = 68/220 (30.91%), Postives = 98/220 (44.55%), Query Frame = 3
Query: 4425 ITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNC---NVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCG----CLP-HQIVC-NISRTCIEEKKICDGNYDCGVNDKSDEENCKK------CQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCEC---ICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNC 5030
            I  C+ SQF+C   KCI  SK C+ V +C N  DE++C    +CD  +F+C   G CI  ++ CDG   C D  DE  C     CL   Q  C N   TC++    CDG  DC  +    +E CK        +M ++ C + +    L +           + E   EC   +C     + C   +         +CI+   +CDGV DC +  DEK+C
Sbjct: 1010 IVKCSVSQFQCSKTKCIIKSKRCNGVQECDNGADEEDCPRSKLCDPDEFRC-GTGLCIKQSQVCDGKMQCLDGLDEEHCNEEEKCLQGRQFRCANGKSTCLDLIFRCDGVADCEDSSDESDEFCKGNSSSTCGKMNQFMCADGK---CLRSFQLCDGFPDCLTGEDETECPPSMCDSTTHLSCLNGQ---------KCISKQLECDGVDDCGDNSDEKHC 1216          

HSP 4 Score: 67.3958 bits (163), Expect = 1.380e-10
Identity = 83/239 (34.73%), Postives = 116/239 (48.54%), Query Frame = 3
Query: 4368 KKCQCVQAKFNCTEDYSDCITT--CTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDL----QQFQCISNG--ACIPMTKKCDGTQNCEDNSDE----------ISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQ---MTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDE 5021
            K+C  VQ   N   D  DC  +  C P +FRC  G CI+ S++CD    C +  DE++CN  +     +QF+C +NG   C+ +  +CDG  +CED+SDE           +CG + +Q +C   + C+   ++CDG  DC   +  DE  C        T   C N Q CI    +CDG DDCGD SDE  C  I  +   + C        +  N +CI+    CDG  DC  G DE
Sbjct: 1030 KRCNGVQECDN-GADEEDCPRSKLCDPDEFRCGTGLCIKQSQVCDGKMQCLDGLDEEHCNEEEKCLQGRQFRC-ANGKSTCLDLIFRCDGVADCEDSSDESDEFCKGNSSSTCGKM-NQFMCADGK-CLRSFQLCDGFPDCLTGE--DETECPPSMCDSTTHLSCLNGQKCISKQLECDGVDDCGDNSDEKHCTEIRLDEAALRC-QSPMYQCDGPNFKCISDKHLCDGTNDCEEGDDE 1261          

HSP 5 Score: 64.3142 bits (155), Expect = 1.001e-9
Identity = 79/257 (30.74%), Postives = 111/257 (43.19%), Query Frame = 3
Query: 4434 CTPSQFRCDD------GKCIESSKICDKVTDCSNSEDEKNCN----VCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISC-------------------GCLPHQIVCN----------------------------ISRTCIEEKKICDGNYDCGVNDKSDEENCKK-CQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNC 5030
            C   QF C         +C+ +SK+CD V DCS  +DE+        C   QF+C     CIP+T  CD  ++C+D SDE++C                    C+P +  C+                             S  CI +++ CDG  DC   D SDE+ CKK C +    C+NS  C+  ++ CDG+  C DGSDE    C+ K+              E+ N +C  G   CDG+ DC +G DEK C
Sbjct: 3527 CIAGQFVCGRTAQNATAQCLYASKLCDGVKDCSGGDDEEPAFCENFECTEAQFKCGDKKKCIPLTSVCDKEKDCDDGSDELNCEITSCKPDFFACFNGTAISKCIPKEFYCDGEDDCPEGQDEPDSCFGIGECTHEQFQCTSGKCIPKRRQCDGTLDC--RDGSDEKGCKKECAIV---CDNS--CVHADDLCDGKKKCNDGSDEDEEACVIKQ------------LLEKENRKC--GGFACDGIVDCEDGSDEKGC 3762          

HSP 6 Score: 62.003 bits (149), Expect = 4.856e-9
Identity = 60/201 (29.85%), Postives = 85/201 (42.29%), Query Frame = 3
Query: 4425 ITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCK--KCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDE 5021
            I  CT  QF+C  GKCI   + CD   DC +  DEK C     ++   + + +C+     CDG + C D SDE    C+  Q++   +R C      CDG  DC   D SDE+ C   +C +     N S IC                  +   +C   + E   C     S   + + Q I   + CDG +DC +G DE
Sbjct: 3656 IGECTHEQFQCTSGKCIPKRRQCDGTLDCRDGSDEKGCK----KECAIVCDNSCVHADDLCDGKKKCNDGSDEDEEACVIKQLLEKENRKC--GGFACDGIVDC--EDGSDEKGCPDLECHLAS---NKSLIC------------------DGTIDCSSGKDENN-CHNNGESNFFQCSMQTIKEWQVCDGRWDCADGLDE 3826          

HSP 7 Score: 53.5286 bits (127), Expect = 2.085e-6
Identity = 64/227 (28.19%), Postives = 89/227 (39.21%), Query Frame = 3
Query: 4422 CITTCTPSQFRCDDG-KCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISN------------GACIPMTKKCDGTQNCEDNSDEISC-----GCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCK--KCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECICKEPEMILCXXXXXXXXXXXNC---QCINGTKQCDGVYDCWNGFDEKNCE 5033
            C++ C P+ F C    KCI S   CD   DC + EDE          F CI+               C+  +K CDG ++C    DE         C   Q  C   + CI    +CD   DC  +D SDE NC+   C+   + C         N     +    +   +   +C   + E   C      T E+  C   +CI   +QCDG  DC +G DEK C+
Sbjct: 3478 CVSECKPNDFVCTKTYKCISSWWRCDGQDDCGDGEDEGYFVEGVCPPFPCIAGQFVCGRTAQNATAQCLYASKLCDGVKDCSGGDDEEPAFCENFECTEAQFKCGDKKKCIPLTSVCDKEKDC--DDGSDELNCEITSCKPDFFAC--------FNGTAISKCIPKEFYCDGEDDCPEGQDEPDSCFGIGECTHEQFQCTSGKCIPKRRQCDGTLDCRDGSDEKGCK 3694          

HSP 8 Score: 53.1434 bits (126), Expect = 2.572e-6
Identity = 38/131 (29.01%), Postives = 65/131 (49.62%), Query Frame = 3
Query: 4311 CFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRC-------DDGKCIE-SSKICDKVTDCSNSEDEKNCNVCDL--QQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQI 4673
            C  NG+S  N     M+  K+ Q    +++C +   +    C   + RC       D  +C++ S+ +CD + DC +  DE   +  D+   +++C +NG CI ++ +CDG  +C D SDE +CG   H  
Sbjct: 3792 CHNNGES--NFFQCSMQTIKEWQVCDGRWDCADGLDESPEMCASRKARCFRIGYCDDKKQCLDVSTALCDGIRDCFDGSDENPIHCKDMCKGKYRC-TNGRCIDVSARCDGRDDCGDGSDEDTCGAECHHF 3919          

HSP 9 Score: 51.6026 bits (122), Expect = 7.660e-6
Identity = 31/94 (32.98%), Postives = 47/94 (50.00%), Query Frame = 3
Query: 4404 TEDYSDCITTCTPSQFRCDDGKCIESSKICDKVTDCS---------NSEDEKNCNV---CDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEIS 4649
            +++ S C  TC  ++F C  GKC+    +CD   DC          + E  + CN    CD  ++ C  +  C+P+ K CDG ++C D SDE S
Sbjct:   71 SDEPSTCKRTCLENEFVCKTGKCLPRGYLCDSQYDCGRLPNGDRDLSDEAPELCNQPLHCDYNEYACSKSAQCVPLFKFCDGKRDCSDGSDEHS 164          
BLAST of SCO-spondin vs. Ensembl Celegans
Match: lrp-1 (Low-density lipoprotein receptor-related protein [Source:UniProtKB/Swiss-Prot;Acc:Q04833])

HSP 1 Score: 82.8037 bits (203), Expect = 2.433e-15
Identity = 70/206 (33.98%), Postives = 92/206 (44.66%), Query Frame = 3
Query: 4338 NGAIIKMENCKKCQCVQAKFNCT----------------------EDYSDCI-TTCTPSQFRCDDGK-CIESSKICDKVTDCSNSEDEKNCNV----CDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCL------PHQIVCNISRTCIEEKKICDGNYDCG-VNDKSDEENCK------KCQMTEYKCNNSQ-ICILLN 4829
            +G+  K+E C    C   +F+C                       ED   C    C+  QFRC +G+ C+     CD  +DC +  DE +C V    C   QF+C+S+G CIP + KCDG Q+C+D SDE   GC         Q  C   R CI    +CDG  DCG  +D+S E  CK      KC      C N Q  CI L+
Sbjct: 1173 DGSDEKLEMCGNATCAANQFSCANGRCIPIYWLCDGDNDCYDGTDEDKERCPPVQCSALQFRCANGRQCVPLRNHCDGQSDCEDGSDEDSCAVTAESCTPDQFKCVSSGLCIPASWKCDGQQDCDDGSDEPKFGCTSGRQCSSDQFKCGNGR-CILNNWLCDGENDCGDGSDESSERGCKTSMNARKCPFEHVACENDQETCIPLH 1377          

HSP 2 Score: 82.8037 bits (203), Expect = 2.737e-15
Identity = 55/140 (39.29%), Postives = 70/140 (50.00%), Query Frame = 3
Query: 4410 DYSDC-ITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNC-----NVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCL------PHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEY 4793
            D S C +  C P   +CDDG CI   K CD+  DC N+ DE +C       C   +F+C +N  CIP    CDG  +C DNSDE S  C       P +  C  SR C+   ++C+G  DCG ND SDE        +EY
Sbjct: 3908 DESQCTLRRCLPGHRQCDDGTCIAEHKWCDRKKDCPNAADELHCEDVSRRTCSPFEFEC-ANSVCIPRKFMCDGDNDCGDNSDETSSECRSAQCDPPLRFRCAHSRLCLNILQLCNGFNDCGPNDFSDEHLSMCSSFSEY 4046          

HSP 3 Score: 78.9518 bits (193), Expect = 3.794e-14
Identity = 51/140 (36.43%), Postives = 73/140 (52.14%), Query Frame = 3
Query: 4434 CTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNV--CDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISC------GCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQ---MTEYKCNNSQICI 4820
            C+ S+FRC+DGKCI  SK+CD    CS+  DE  C +  C     QC  +G CI   K CD  ++C + +DE+ C       C P +  C  S  CI  K +CDG+ DCG N       C+  Q      ++C +S++C+
Sbjct: 3878 CSESEFRCNDGKCIPGSKVCDGTIQCSDGLDESQCTLRRCLPGHRQC-DDGTCIAEHKWCDRKKDCPNAADELHCEDVSRRTCSPFEFECANS-VCIPRKFMCDGDNDCGDNSDETSSECRSAQCDPPLRFRCAHSRLCL 4015          

HSP 4 Score: 74.7146 bits (182), Expect = 6.711e-13
Identity = 83/267 (31.09%), Postives = 117/267 (43.82%), Query Frame = 3
Query: 4311 CFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTED-----YSD---------CITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEK----NCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLP-----HQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENC----KKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECICKEPEMILCXXXXXXXXXXXNC---QCINGTKQCDGVYDCWNGFDE 5021
            CF+  +   N   IK  N KKC  + A++ C  D     YSD             C   +F+CD+ +CI     CD   DC +  DEK        C   QF C +NG CIP+   CDG  +C D +DE    C P      Q  C   R C+  +  CDG  DC   D SDE++C    + C   ++KC +S +CI  + K            +  C+    EP+   C + R  ++++  C   +CI     CDG  DC +G DE
Sbjct: 1095 CFHETECAEN--TIKCRNTKKC--IPAQYGCDGDNDCGDYSDEDVKYCKDGQKPVCAAKKFQCDNHRCIPEQWKCDSDNDCGDGSDEKLEMCGNATCAANQFSC-ANGRCIPIYWLCDGDNDCYDGTDEDKERCPPVQCSALQFRCANGRQCVPLRNHCDGQSDC--EDGSDEDSCAVTAESCTPDQFKCVSSGLCIPASWK---------CDGQQDCDDGSDEPKF-GCTSGRQCSSDQFKCGNGRCILNNWLCDGENDCGDGSDE 1344          

HSP 5 Score: 72.0182 bits (175), Expect = 4.331e-12
Identity = 53/148 (35.81%), Postives = 74/148 (50.00%), Query Frame = 3
Query: 4428 TTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNV--CDLQQFQCIS----NGACIPMTKKCDGTQNCEDNSDEISC-----GCLPHQI-VCNISRTCIEEKKICDGNYDCGVNDKSDEE-----NCKKCQMTEYKCNNSQICI 4820
            + C  + FRC+DGKCI +   CD   DCS+ EDEK+C    C   Q+QC +    + +CI   ++CD   +C D SDE  C      C    + +C   R C +  K CDG YDC   D SDE+     N   C   +++C +   CI
Sbjct:   51 SVCNENDFRCNDGKCIRTEWKCDGSGDCSDGEDEKDCPHPGCKSDQWQCDTYTWHSVSCIAEYQRCDNITDCADGSDEKDCPASTVDCSSQNVFMCADGRQCFDVSKKCDGKYDC--RDLSDEKDSCSRNHTACFQYQFRCADKTQCI 196          

HSP 6 Score: 70.8626 bits (172), Expect = 1.177e-11
Identity = 48/123 (39.02%), Postives = 66/123 (53.66%), Query Frame = 3
Query: 4428 TTCTPSQFRC-DDGKCIESSKICDKVTDCSNSEDEKNC---NVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCG---CLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKK 4775
            T C   QFRC D  +CI+ S +CD   DC++  DE +      C   +FQC  N  C P   +CD   +C DNSDE  CG   C P +  C  +  CI++ K+CDG+ DC   D +DE+ C +
Sbjct:  180 TACFQYQFRCADKTQCIQKSWVCDGSKDCADGSDEPDTCEFKKCTANEFQC-KNKRCQPRKFRCDYYDDCGDNSDEDECGEYRCPPGKWNCPGTGHCIDQLKLCDGSKDCA--DGADEQQCSQ 299          

HSP 7 Score: 66.2402 bits (160), Expect = 2.419e-10
Identity = 77/235 (32.77%), Postives = 112/235 (47.66%), Query Frame = 3
Query: 4377 QCVQAKFNCTEDYSDCITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDL----QQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCN------ISRTCIEEKKICDGNYDCGVNDKSDEENCK------KCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECICKE--PEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKN 5027
            QCV    N +E   +C+    P  F+C DG CI     CD   DC+++ DE N N C+     + +   +N  CI   KKC+   +C D SDE+ C   P  + C        +  CI + K+CDG+ DC     SDE           C+  + +C N+ ICI   + CDG DDCGD +DE+   C+ ++     + C +           +CI  T QCDG  DC +G+DE +
Sbjct: 2778 QCVLRGSN-SEPAKECLP---PYNFQCGDGSCILLGATCDSKPDCADASDE-NPNYCNTRSCPEDYNLCTNRRCIDSAKKCNHIDDCGDGSDELDC---PSAVACAEGTFPCSNGHCINQTKVCDGHNDCHDEQVSDESLATCPGLPIDCRGVKVRCPNTNICIQPADLCDGYDDCGDKADENQLFCMNQQCAQHYVRCPSG----------RCIPETWQCDGDNDCSDGWDETH 2994          

HSP 8 Score: 61.2326 bits (147), Expect = 9.902e-9
Identity = 75/226 (33.19%), Postives = 99/226 (43.81%), Query Frame = 3
Query: 4434 CTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQ---------FQCISNGACIPMTKKCDGTQNCEDNSDEIS---CG----------CLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENC----KKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHG-CECICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNC 5030
            C     RC  G+CI  +  CD   DCS+  DE + N  D            FQC  N  CI     CDG  +C D SDE S   CG          C  +  +      CI    +CDG+  C   +    E C    K+C   E++C+N Q CI    +CDG +DC DGSDEH  C     +P+   C           N +C+  + +CDG  DC +G DEK+C
Sbjct: 2961 CAQHYVRCPSGRCIPETWQCDGDNDCSDGWDETHTNCTDTAGKKICVGDYLFQC-DNLKCISRAFICDGEDDCGDGSDEHSRHGCGNRTCTDQEFHCTSNAKLAQPKYECIPRAWLCDGDVTCAGGEDESTELCKTEKKECNKGEFRCSN-QHCIHSTWECDGDNDCLDGSDEHANCTYSSCQPDFFQC----------ANHKCVPNSWKCDGNDDCEDGSDEKDC 3174          

HSP 9 Score: 58.5362 bits (140), Expect = 5.873e-8
Identity = 66/204 (32.35%), Postives = 97/204 (47.55%), Query Frame = 3
Query: 4467 KCIESSKICDKVTDCSNS--EDEKNCNVCD-LQQFQCISNGACIPMTKKCDGTQNCEDNSDEI--SCG-----CLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENC--KKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECICKE---PEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNCE 5033
            +CI +   C+   DC ++  ED++ C  CD + +F+C ++G CIP    CD   +C DNSDE+  SCG     C   +  CN  + CI   K+CDG   C  +D  DE  C  ++C     +C++   CI  +  CD + DC + +DE  CE + +    P    C           N  CI     CDG  DC +  DE + E
Sbjct: 3805 RCIPNWAFCNGQDDCRDNSDEDKQRCPTCDDVGEFRCATSGKCIPRRWMCDTENDCGDNSDELDASCGGTTRPCSESEFRCNDGK-CIPGSKVCDGTIQC--SDGLDESQCTLRRCLPGHRQCDDG-TCIAEHKWCDRKKDCPNAADELHCEDVSRRTCSPFEFECA----------NSVCIPRKFMCDGDNDCGDNSDETSSE 3994          

HSP 10 Score: 55.4546 bits (132), Expect = 5.125e-7
Identity = 46/134 (34.33%), Postives = 60/134 (44.78%), Query Frame = 3
Query: 4449 FRCDDGK-CIESSKICDKVTDCSNSEDEK-----NCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISC----GCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICI 4820
            F C DG+ C + SK CD   DC +  DEK     N   C   QF+C     CI  +  CDG+++C D SDE        C  ++  C   R C   K  CD   DCG N   DE    +C   ++ C  +  CI
Sbjct:  144 FMCADGRQCFDVSKKCDGKYDCRDLSDEKDSCSRNHTACFQYQFRCADKTQCIQKSWVCDGSKDCADGSDEPDTCEFKKCTANEFQCKNKR-CQPRKFRCDYYDDCGDNSDEDECGEYRCPPGKWNCPGTGHCI 276          

HSP 11 Score: 53.5286 bits (127), Expect = 1.746e-6
Identity = 49/155 (31.61%), Postives = 70/155 (45.16%), Query Frame = 3
Query: 4392 KFNCTEDYSDCITTCTPSQFRC--DDGKCIESSKICDKVTDCSNSEDEKNCNVCD-----LQQFQCISNGACIPMTKKCDGTQNCEDNSDEISC--GCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENC------KKCQMTEYKCNNSQ 4811
            +F    D   C   CT  QF C  DD KCI     CD   DC +  DE   ++C      + +FQC +N  C    + CDG  +C D+SDE +C   C P    C  +  CI  +     + D    D+SDE +       + C   E++CNN++
Sbjct: 3613 QFVLLSDQKTCEPNCTERQFACGGDDAKCIPKLWYCDGEPDCRDGSDEPGESICGQRICPVGEFQC-TNHNCTRPFQICDGNDDCGDSSDEQNCDKACDPWMFKCAATGRCIPRRFT--CDGDDDCGDRSDEADTLCMSAERNCTAEEFRCNNNK 3764          

HSP 12 Score: 52.7582 bits (125), Expect = 3.505e-6
Identity = 36/99 (36.36%), Postives = 48/99 (48.48%), Query Frame = 3
Query: 4557 QFQCISNGACIPMTKKCDGTQNCEDNSDEI---------SCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKK-----CQMTEYKCNNSQ 4811
            QFQC  NG CIP   KCDG  +C D SDEI            C  + I C  ++ CI  +  CDG+ DCG     D + CK      C   +++C+N +
Sbjct: 1060 QFQC-KNGRCIPKEWKCDGENDCLDESDEIDEKGDKCFHETECAENTIKCRNTKKCIPAQYGCDGDNDCGDYSDEDVKYCKDGQKPVCAAKKFQCDNHR 1157          
BLAST of SCO-spondin vs. Ensembl Celegans
Match: egg-2 (LDL receptor repeat-containing protein egg-2 [Source:UniProtKB/Swiss-Prot;Acc:Q21629])

HSP 1 Score: 79.7221 bits (195), Expect = 1.058e-14
Identity = 81/222 (36.49%), Postives = 106/222 (47.75%), Query Frame = 3
Query: 4425 ITTCTPSQFRCDDG--KCIESSKICDKVTDCSNSEDEKNCNVCD---------------LQQFQCISNGACIPMTKKCDGTQNCEDNSDEISC--GCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCEC-ICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNC 5030
            ++TC+   F C       I SSK CD + DCS+  DE+NC  C                  +   +    C+   K C+G +NC D SDE SC   C   Q  C+ S  C+     CDG  DC   ++SDE NC KCQ   +KC  +  CI  +  CDG  DC DGSDEH C+C  C   E  LC           +  CI  ++ CDG +DC +G DE+NC
Sbjct:  120 VSTCSGFGFACTGSIDMIIPSSKRCDGLKDCSDGSDEENCKECQSIYSCRAHIEEESEKKDKTSVLPTLICLTAEKLCNGVENCPDGSDEASCRSKCSKDQFKCSGSDACLPISVKCDGVSDC--ENESDESNCNKCQKGAHKCGKN--CIKASKVCDGIPDCDDGSDEHQCDCKTCSGSEKALC----------EDGTCIMRSQVCDGKHDCLDGIDEENC 327          

HSP 2 Score: 64.3142 bits (155), Expect = 5.345e-10
Identity = 36/97 (37.11%), Postives = 54/97 (55.67%), Query Frame = 3
Query: 4446 QFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLP------HQIVCNISRTCIEEKKIC 4718
            QF CD+ KC+ESS+ CD V DC +  DEK C+ C  + F+C ++  C+P   +C+G   C D SDE  C C           +C+ S  C++  ++C
Sbjct:  424 QFTCDN-KCLESSRRCDGVWDCEDKSDEKGCDKCPSRSFKCSADKKCLPFHTRCNGVAECSDGSDEHKCSCQECLGTHHDTYMCSESNRCLKRGEVC 519          

HSP 3 Score: 61.2326 bits (147), Expect = 4.650e-9
Identity = 66/208 (31.73%), Postives = 92/208 (44.23%), Query Frame = 3
Query: 4419 DCITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNC----------------------------------NVCDL--------QQFQCISNGA----CIPMTKKCDGTQNCEDNSDEISCGCLPHQIV-CNISRTC----IEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCEC 4889
            DC T     +  C+DG CI  S++CD   DC +  DE+NC                                    C+L          F C + G     CI  +K CDG  +CED +DE  C  +   +V  +I  TC    +E  + CDG +DC   DKSDE+ C KC    +KC+  + C+  + +C+G  +C DGSDEH C C
Sbjct:  288 DCKTCSGSEKALCEDGTCIMRSQVCDGKHDCLDGIDEENCPGSCSNERFSSKLKLLTCDDGNQYSEVEACSGLVEACELNCPKCDPKHTFTCPAVGGIHNKCIKRSKVCDGIFDCEDGADEKKCTPVKECVVESSIQFTCDNKCLESSRRCDGVWDC--EDKSDEKGCDKCPSRSFKCSADKKCLPFHTRCNGVAECSDGSDEHKCSC 493          
BLAST of SCO-spondin vs. Ensembl Celegans
Match: egg-2 (LDL receptor repeat-containing protein egg-2 [Source:UniProtKB/Swiss-Prot;Acc:Q21629])

HSP 1 Score: 79.7221 bits (195), Expect = 1.058e-14
Identity = 81/222 (36.49%), Postives = 106/222 (47.75%), Query Frame = 3
Query: 4425 ITTCTPSQFRCDDG--KCIESSKICDKVTDCSNSEDEKNCNVCD---------------LQQFQCISNGACIPMTKKCDGTQNCEDNSDEISC--GCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCEC-ICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNC 5030
            ++TC+   F C       I SSK CD + DCS+  DE+NC  C                  +   +    C+   K C+G +NC D SDE SC   C   Q  C+ S  C+     CDG  DC   ++SDE NC KCQ   +KC  +  CI  +  CDG  DC DGSDEH C+C  C   E  LC           +  CI  ++ CDG +DC +G DE+NC
Sbjct:  120 VSTCSGFGFACTGSIDMIIPSSKRCDGLKDCSDGSDEENCKECQSIYSCRAHIEEESEKKDKTSVLPTLICLTAEKLCNGVENCPDGSDEASCRSKCSKDQFKCSGSDACLPISVKCDGVSDC--ENESDESNCNKCQKGAHKCGKN--CIKASKVCDGIPDCDDGSDEHQCDCKTCSGSEKALC----------EDGTCIMRSQVCDGKHDCLDGIDEENC 327          

HSP 2 Score: 64.3142 bits (155), Expect = 5.345e-10
Identity = 36/97 (37.11%), Postives = 54/97 (55.67%), Query Frame = 3
Query: 4446 QFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLP------HQIVCNISRTCIEEKKIC 4718
            QF CD+ KC+ESS+ CD V DC +  DEK C+ C  + F+C ++  C+P   +C+G   C D SDE  C C           +C+ S  C++  ++C
Sbjct:  424 QFTCDN-KCLESSRRCDGVWDCEDKSDEKGCDKCPSRSFKCSADKKCLPFHTRCNGVAECSDGSDEHKCSCQECLGTHHDTYMCSESNRCLKRGEVC 519          

HSP 3 Score: 61.2326 bits (147), Expect = 4.650e-9
Identity = 66/208 (31.73%), Postives = 92/208 (44.23%), Query Frame = 3
Query: 4419 DCITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNC----------------------------------NVCDL--------QQFQCISNGA----CIPMTKKCDGTQNCEDNSDEISCGCLPHQIV-CNISRTC----IEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCEC 4889
            DC T     +  C+DG CI  S++CD   DC +  DE+NC                                    C+L          F C + G     CI  +K CDG  +CED +DE  C  +   +V  +I  TC    +E  + CDG +DC   DKSDE+ C KC    +KC+  + C+  + +C+G  +C DGSDEH C C
Sbjct:  288 DCKTCSGSEKALCEDGTCIMRSQVCDGKHDCLDGIDEENCPGSCSNERFSSKLKLLTCDDGNQYSEVEACSGLVEACELNCPKCDPKHTFTCPAVGGIHNKCIKRSKVCDGIFDCEDGADEKKCTPVKECVVESSIQFTCDNKCLESSRRCDGVWDC--EDKSDEKGCDKCPSRSFKCSADKKCLPFHTRCNGVAECSDGSDEHKCSC 493          
BLAST of SCO-spondin vs. Ensembl Celegans
Match: egg-1 (LDL receptor repeat-containing protein egg-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09967])

HSP 1 Score: 68.9366 bits (167), Expect = 2.031e-11
Identity = 78/223 (34.98%), Postives = 97/223 (43.50%), Query Frame = 3
Query: 4425 ITTCTPSQFRCDDG--KCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGA----------------CIPMTKKCDGTQNCEDNSDEISC--GCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCEC-ICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNC 5030
            ++TC+   F C       I SSK CD   DC +  DE+NC  C    F C                     C+     CD  +NC D SDE  C   C   Q  C  S  C+     CDG  DC   D SDE+NC KCQ   +KC     CI  ++ CDG   C DGSDE  C+C  C   +  LC+             CI  T+ CDG  DC +G DE++C
Sbjct:  120 VSTCSGFGFACTGAVHMVIPSSKRCDGRRDCEDGSDEENCKECQ-SVFSCKLRPEEESKKKGRSTVQPTLICLTAQHLCDNVENCPDGSDEAVCKSSCSKDQFKCPGSNACLPLSAKCDGINDCA--DASDEKNCSKCQNNAHKCGKQ--CIKASHVCDGVAQCADGSDEQQCDCQRCSGTDKALCDDGT----------CIMRTQVCDGKKDCTDGMDEEDC 327          

HSP 2 Score: 66.6254 bits (161), Expect = 1.144e-10
Identity = 35/98 (35.71%), Postives = 56/98 (57.14%), Query Frame = 3
Query: 4443 SQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCL------PHQIVCNISRTCIEEKKIC 4718
            +QF+CD  KC++SS+ CD V DC +  DEK C+ C     +C ++  C+P   +C+G  +C D SDE+ C C        +  +CN S  C++  ++C
Sbjct:  425 TQFKCDH-KCLDSSRRCDGVWDCEDKSDEKGCDKCPSGTIKCAADKKCLPAFTRCNGVADCSDGSDELKCSCQECLGVHSNTYMCNESNRCLKRDEVC 521          

HSP 3 Score: 64.6994 bits (156), Expect = 4.805e-10
Identity = 54/164 (32.93%), Postives = 82/164 (50.00%), Query Frame = 3
Query: 4359 ENCKKCQCVQAKFNCT-----EDYSDCITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNC-NVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCG-CLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEE--NCKKCQMTEYKCNNSQICIL 4823
            ENCK+CQ V   F+C      E      +T  P+        C+ +  +CD V +C +  DE  C + C   QF+C  + AC+P++ KCDG  +C D SDE +C  C  +   C   + CI+   +CDG   C   D SDE+  +C++C  T+    +   CI+
Sbjct:  157 ENCKECQSV---FSCKLRPEEESKKKGRSTVQPTLI------CLTAQHLCDNVENCPDGSDEAVCKSSCSKDQFKCPGSNACLPLSAKCDGINDCADASDEKNCSKCQNNAHKCG--KQCIKASHVCDGVAQCA--DGSDEQQCDCQRCSGTDKALCDDGTCIM 307          

HSP 4 Score: 56.225 bits (134), Expect = 1.830e-7
Identity = 43/129 (33.33%), Postives = 59/129 (45.74%), Query Frame = 3
Query: 4470 CIESSKICDKVTDCSNSEDE------KNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISC-GCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDE-----ENCKKCQMTEYKCNNSQICI 4820
            CI   K+CD   DC +  DE      K C +    QF+C  +  C+  +++CDG  +CED SDE  C  C    I C   + C+     C+G  DC  +D SDE     + C       Y CN S  C+
Sbjct:  391 CISRRKVCDGTPDCDDGADEINCTPIKECGIAKNTQFKC--DHKCLDSSRRCDGVWDCEDKSDEKGCDKCPSGTIKCAADKKCLPAFTRCNGVADC--SDGSDELKCSCQECLGVHSNTYMCNESNRCL 515          

HSP 5 Score: 53.1434 bits (126), Expect = 1.829e-6
Identity = 60/229 (26.20%), Postives = 88/229 (38.43%), Query Frame = 3
Query: 4359 ENCKKCQ---------CVQAKFNCT----------EDYSDCITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNC-NVCDLQQFQ------CISNGA-----------------------------------------CIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISR--------TCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICI 4820
            +NC KCQ         C++A   C           E   DC       +  CDDG CI  +++CD   DC++  DE++C   C ++ F         S+G                                          CI   K CDGT +C+D +DEI+C  +     C I++         C++  + CDG +DC   DKSDE+ C KC     KC   + C+
Sbjct:  249 KNCSKCQNNAHKCGKQCIKASHVCDGVAQCADGSDEQQCDCQRCSGTDKALCDDGTCIMRTQVCDGKKDCTDGMDEEDCPGSCTIESFSPKLKMVTCSDGKQYTEAEACSGSFESCDHDCPNSKCHPKLAFTCPASKEARKMCISRRKVCDGTPDCDDGADEINCTPIKE---CGIAKNTQFKCDHKCLDSSRRCDGVWDC--EDKSDEKGCDKCPSGTIKCAADKKCL 472          
BLAST of SCO-spondin vs. Ensembl Fly
Match: Hml (gene:FBgn0029167 transcript:FBtr0333020)

HSP 1 Score: 334.339 bits (856), Expect = 4.596e-92
Identity = 329/1308 (25.15%), Postives = 547/1308 (41.82%), Query Frame = 3
Query:  771 CHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCT--SDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXX-----XXXXXXXXXXXXXVASFGNSFK----------------GFGC-----PDIANTLSTCKPDDQILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQ--WRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEP---KIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITG-SCDNTPQSIVDP---------PAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCS-AILNA-AIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTC---WNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCP---------KNQVYMD----SVSGCNSCTNYDT-CTDTSSIANSCGCPNDTVSKIDG-TCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGG---QTYLLSRG-----NNDTIPLFPKYDIV---------IEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDV--NRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGG-KHYDACASPCP-QTCDTIGSN--APSHCSTTHCVEGCS---CPNGMIDLNG---ECVPPTTCP---CFYNGQSYVNGAIIKMENCKKCQCVQAKFNCT 4406
            C ++G    +TFD  ++     CS+ L        V+ + +I+ + C   S  GC   + I             +LYT ++ N    L+       + +    M V+     + + LE+  +KL WD+   + +     ++ G V GLCG        +  S        V +F ++++                 FG        +   +S C   +++LAN+       K   C    N D     C+ + C  +   +            C  ++  +  C+ KG  ++  WR+  +C   C   +++  C      TC +    P++  + +    C C  G V+Y   CI  E CPC   G+E  P +  + +CNTCTC +  W CTE  C + CG +G   + TFDG ++ F    C Y  ++    NT   A       + +ESM     N A  ++P   K VT++     I+   T   +   Q    I  +    KLP  +    + +R+ ++ +  V+ +   ++++DG   +YI    +L+    GLCG F+ N+++DF   +  +  ++   A  + T  +C    ++   P          A     C  IL    F  C     V+ E +   C  +  + KD++S C   IL+A    C R G++     +        PL    G VF  C   C  +C +L   +   C  +C  GC CP   Y    G+CV +  C C       RP   E+  G         C C +G  +C+  +       P           Q Y +    +     +C N D    D+S     C C    V       CV P++C C +  + Y   + I   C    C    W         CE+ C  +GD H+ T DG  F FQG+C Y L     D+ +     +I++ N+ CG    TC+K ++I + G   ++ LLS       + +  P+    D V         I +   F  +    + L+V WD  TRVY+ L   ++  V GLCGNY+G+  ++    +M     ++ +     +A    +++ P  + AP    D C  +P+R++WA+  CG +K  + +F  C    H +V   R++  C++D C C++GGDCECLCT++A +A  CA  GI ++WR+Q+ CP+ C+     Y AC   C  +TCD       A   C+  +C+EGC    C +G I LN    +CVP   C       +G+++  G I   ++C  C+C + K  C+
Sbjct:  484 CTTWGGINMKTFDGLVFKAPLSCSHTLI----TDKVSGTFDIILKACPYGSGYGCAHTLKI---------LWQSVLYTFENLNGTMQLTTPIKKLPMPVQVMGMKVMPVAQHVQIDLESVGLKLDWDHRQYVSVQAGPQMW-GKVGGLCGTLDGDPNTDLTSRTGKKLATVKAFADAWRVEDRSELCQVENSAEMEFGMDSCEQSKLQKAVSVC---ERLLANE-------KLGDCIKPFNYDALIRTCMADYCNCANREHP-------ESCNCDAIAMLAKECAFKGIKLEHGWRNLEICPISCGFGRVYQACGPNVEPTCDSDLALPAS--KGACNEGCFCPEGTVQYKEACITRELCPCSLRGKEFKPESTVKKNCNTCTCKNGQWRCTEDKCGARCGAVGDPHYQTFDGKRYDFMG-KCSYHLLK--TQNTSVEAENVACSGAVSESM-----NFAAPDDPSCTKAVTIRF----ILRDGTPSVIKLDQGLTTIVNDKPIAKLPKMLGLGEVLIRRASSTFLTVEFADGIRVWWDGVSRVYIDAPPSLRGQTQGLCGTFNSNTQDDFLTPEGDVETAVEPFADKWRTKDTCQFKAETHQGPHPCTLNPEKKAQAEKFCDWILQD-IFQDC--HFLVEPEQFYEDCLYDTCACKDEMSKCFCPILSAYGTECMRQGVKTGWRMSVKECAVKCPL----GQVFDECGDGCALSCDDL--PSKGSCKRECVEGCRCPHGEYVNEDGECVPKKMCHCNFDGMSFRPGYKEVRPGEKFL---DLCTCTDGVWDCQDAEPGDKDKYPPSSELRSKCAKQPYAEFTKCAPKEPKTCKNMDKYVADSSDCLPGCVCMEGYVYDTSRLACVLPANCSCHHAGKSYDDGEKIKEDCNLCECRAGNWKC---SKNGCESTCSVWGDSHFTTFDGHDFDFQGACDYVLAKGVFDNGDGF---SITIQNVLCGTMGVTCSKSLEIALTGHAEESLLLSADSAYSTDPNKTPIKKLRDSVNSKGHNAFHIYKAGVFVVVEVIPLKLQVKWDEGTRVYVKLGNEWRQKVSGLCGNYNGNSLDDMQTPSM----GLETSPMLFGHA----WKLQPHCS-APVAPIDACKKHPERETWAQLKCGALK--SDLFKEC----HAEVPLERFWKRCIFDTCACDQGGDCECLCTAVAAYADACAQKGINIRWRSQHFCPMQCDPHCSDYKACTPACAVETCDNFLDQGIAERMCNRENCLEGCHIKPCEDGFIYLNDTYRDCVPKAECKPVCMVRDGKTFYEGDITFTDSCATCRCSKRKEICS 1713          

HSP 2 Score: 127.487 bits (319), Expect = 8.785e-29
Identity = 108/382 (28.27%), Postives = 163/382 (42.67%), Query Frame = 3
Query: 3312 AVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNND---TIPL--FPK----YDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQ-FAESFIA--NADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGC-NRGGDCECLCTSLATFATQCAFLGIPVK--WRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTED 4412
            A+C  +G  + KT DG +F    SC +TL+    D  +    I +       G+    CA  ++I+     Y     N     T P+   P       + +  +    Q+  +S+GL++ WD    V +   P   G V GLCG  DGD   +    T K    ++ FA+++     +++C  E S E         D C  +  +K  A  +C  +   N     CI+  + D       C+ D C C NR     C C ++A  A +CAF GI ++  WR   +CPI C  G+ Y AC      TCD   S+     S   C EGC CP G +     C+    CPC   G+ +   + +K +NC  C C   ++ CTED
Sbjct:  482 ALCTTWGGINMKTFDGLVFKAPLSCSHTLIT---DKVSGTFDIILKACPYGSGYG---CAHTLKILWQSVLYTFENLNGTMQLTTPIKKLPMPVQVMGMKVMPVAQHVQIDLESVGLKLDWDHRQYVSVQAGPQMWGKVGGLCGTLDGDPNTDLTSRTGKKLATVKAFADAWRVEDRSELCQVENSAEMEFG----MDSCEQSKLQK--AVSVCERLL-ANEKLGDCIKPFNYDA--LIRTCMADYCNCANREHPESCNCDAIAMLAKECAFKGIKLEHGWRNLEICPISCGFGRVYQACGPNVEPTCD---SDLALPASKGACNEGCFCPEGTVQYKEACITRELCPCSLRGKEFKPESTVK-KNCNTCTCKNGQWRCTED 844          

HSP 3 Score: 78.1814 bits (191), Expect = 8.444e-14
Identity = 183/766 (23.89%), Postives = 293/766 (38.25%), Query Frame = 3
Query:  795 YRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTG--CVKVIVI---EAGDVVV-----KSSGNGILYTTDS--NNPLTPLSVTNTDSALIIPG-TPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCG-----XXXXXXXXXXXXXXXVASFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRLK-FPGCADLVNSDTYFS-MCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQ---WRSDTLCETQCPGNKIWSDC-ASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMGTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQ------SNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKV-SSHFKLYFDGSKSIYIKVSDALK--NNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY--------ITGSC--DNTPQSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQ-SSNKDQLSYCSAILNAAIACRRFGI--QYEVPFTSNILQACIPLCQAGGTVFQI--CSRTCQSTCRELNEATA-----------SKCDDDC-----FPGCECPPNYYKTGTGQCVSESECT 2900
            + TFD  ++ Y G CS+IL    D+ + +WSI+ V++ C+ +T   C KVI I   EAG+ ++     K   NG  +T     N+P+   S   +      PG T + V  +  F +   + G +K+             +S +   V GLCG       D+  S D     N   FG+S+     P        C  + Q  A Q C+ I    F  C   VN   + +  C++  C     +N        +   C  L ++   C      +Q   WR+   CE  CP   + +DC    C  +C N+         ++    C C  G V  G  C+ P S                  +C  C CNS               +  +++ T+D   F+FN   C Y+     V        V+V +         T    G+   S +I         +NG  +I     PQ   S   V +DG +   K+P+   D  I +R++      + +  SH +L       I+     ++K  + + GLCG  +GN+ ND  + + + +++ V++ +S+        +   C  ++ P+    P   + D C    N   F  C     VD   Y + C+++       Q   C A+   A  C + GI   +  P      Q C   C +   V++   C++ C  T + L+E  A            K D+ C     F GC CPP     G GQCV E  CT
Sbjct: 2709 FTTFDGTVFKY-GPCSHILA--RDIHSSSWSIS-VHQQCSDETRKVCHKVITIQDTEAGNELILLPHLKLKFNGYEFTVQQLINSPICKASFVVSQ-----PGKTLLAVSTKYGFWVQLDDIGIVKV-----------GISSKFIRTVDGLCGYYNGNQKDDKRSPDGQIIPNTEKFGDSWYDKRIPKDQCGDLKCPREMQAKALQLCNIIHHPTFARCHKAVNYKQFLNNYCLEAACNCMMANNG-----DPAACKCNILESFVKKCLSVNPLVQLTTWRAVAQCEINCPSPLVHTDCYKRRCEPSCDNVHGDDCPVLPDACFPGCYCPEGTVRKGPNCV-PIS------------------ECKDCVCNS---------------LGASKYMTYDRKSFSFNG-NCTYLLSRDVVLPGVHTFQVYVSMDDCKKLGQPTPVEGGSCAKSLHI---------LNGDHVIHVQRVPQKPKS-LQVLVDGFE-VKKIPYK--DSWISLRQVVGKELVLSLPESHVELTASFEDLIFSLGVPSIKYGSKMEGLCGDCNGNAGNDL-QPNPAKKKAGVDVIQSWQADEPKLGLVEECLSEDVPKEHCIPLPPEKDPCLQFYNAELFGKC--PLAVDPIAYVSACQQDICKPGNTQQGVCVALAAYAKECNQHGICTNWRRP------QLCPYECPS-DMVYEPCGCAKNC-DTIKALSEFDAVSLKNEAVVHTVKTDEMCLSSERFEGCFCPPGKVMDG-GQCVPEIACT 3389          

HSP 4 Score: 75.8702 bits (185), Expect = 4.421e-13
Identity = 100/410 (24.39%), Postives = 158/410 (38.54%), Query Frame = 3
Query: 3315 VCIAYGDPHYKTLDGQMFSFQGSCMYTL---MDTPGDSSNNIPPITISVANIACGFSL--ATCAKFVQIIIGGQTYLLSRGNNDTIPLFPK-YDIVIEQLTFFTQLVSDS-IGLRVLWDRSTRV-----YLFLKPSFQ--------------GNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGS-----------NAPSH-------CSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQC-VQAKFNCTE 4409
            VC + G   Y T D + FSF G+C Y L   +  PG  +  +         +     +   +CAK + I+ G     + R     +P  PK   ++++          DS I LR +  +   +     ++ L  SF+                ++GLCG+ +G+  N+      K +  +   +S+ A+    P     E  ++    ++ C   P  K    Q          +F  C  A+  D   Y S C  D C    G   + +C +LA +A +C   GI   WR   LCP  C     Y+ C   C + CDTI +            A  H       C ++   EGC CP G +   G+CVP   C    +G  ++     K + C +CQC  + K  C E
Sbjct: 3033 VCNSLGASKYMTYDRKSFSFNGNCTYLLSRDVVLPGVHTFQVYVSMDDCKKLGQPTPVEGGSCAKSLHILNGDHVIHVQR-----VPQKPKSLQVLVDGFEVKKIPYKDSWISLRQVVGKELVLSLPESHVELTASFEDLIFSLGVPSIKYGSKMEGLCGDCNGNAGNDLQPNPAKKKAGVDVIQSWQADE---PKLGLVEECLSEDVPKEHCIPLPPEKDPCLQFYNAE-----LFGKCPLAV--DPIAYVSACQQDIC--KPGNTQQGVCVALAAYAKECNQHGICTNWRRPQLCPYECPSDMVYEPCG--CAKNCDTIKALSEFDAVSLKNEAVVHTVKTDEMCLSSERFEGCFCPPGKVMDGGQCVPEIACTKCDDGL-HLPDEKWKKDKCTECQCDSKGKTTCVE 3422          

HSP 5 Score: 57.3806 bits (137), Expect = 1.793e-7
Identity = 78/314 (24.84%), Postives = 137/314 (43.63%), Query Frame = 3
Query:  765 TTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENC-TSDTGCVKVIVI----EAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCG-----XXXXXXXXXXXXXXXVASFGNSFK-GFGCPDIANTLSTCK--PDDQILANQQCSKIRLK-FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQC-PGNKIWSDCASECPV-TCRNLF 1658
            +TC  +G  ++ TFD   + +QG C Y+L      +   +SI I    C T    C K + I     A + ++ S+ +   Y+TD N   TP+     DS         ++ +   F+++ +    +++KWD    +++ + N      V+GLCG     + D+  +       +   FG+++K    C      +  CK  P+ +  A  +C  ++   F  C   V  + ++  C+ + C   Q  +         + LCT ++AY+D+C+ KG  I+WRS   C  QC P    +  C   C V TC N  
Sbjct: 1335 STCSVWGDSHFTTFDGHDFDFQGACDYVLAKGVFDNGDGFSITIQNVLCGTMGVTCSKSLEIALTGHAEESLLLSADSA--YSTDPNK--TPIKKLR-DSVNSKGHNAFHIYKAGVFVVVEVIPLKLQVKWDEGTRVYVKLGNEWRQ-KVSGLCGNYNGNSLDDMQTPSMGLETSPMLFGHAWKLQPHCSAPVAPIDACKKHPERETWAQLKCGALKSDLFKECHAEVPLERFWKRCIFDTCACDQGGDC--------ECLCTAVAAYADACAQKGINIRWRSQHFCPMQCDPHCSDYKACTPACAVETCDNFL 1634          

HSP 6 Score: 55.4546 bits (132), Expect = 6.704e-7
Identity = 83/347 (23.92%), Postives = 129/347 (37.18%), Query Frame = 3
Query: 3342 YKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFV---------QIIIGGQTYLLSRGNNDTIPLFP-----KYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKY-EDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMH--QDVNRYYSNCLYDACGC---NRGGDCECLCTSLATFATQCAFLGIPVK---WRTQNLCPIMCEGGK-HYDACASPCPQTCDTI-GSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTC 4307
            + T DG +F + G C + L      SS      +ISV       +   C K +         ++I+     L   G   T+         K   V+ Q       VS   G  V  D    V + +   F   V GLCG Y+G+ +++      +   +  +F +S+              +   P  +        + ++ A Q+C ++   +  FA C +A++  Q +N Y   CL  AC C   N G    C C  L +F  +C  +   V+   WR    C I C     H D     C  +CD + G + P       C  GC CP G +     CVP + C
Sbjct: 2709 FTTFDGTVFKY-GPCSHILARDIHSSS-----WSISVHQQCSDETRKVCHKVITIQDTEAGNELILLPHLKLKFNGYEFTVQQLINSPICKASFVVSQPGKTLLAVSTKYGFWVQLDDIGIVKVGISSKFIRTVDGLCGYYNGNQKDDKRSPDGQIIPNTEKFGDSWY-------------DKRIPKDQCGDLKCPREMQAKALQLCNIIH--HPTFARCHKAVNYKQFLNNY---CLEAACNCMMANNGDPAACKCNILESFVKKCLSVNPLVQLTTWRAVAQCEINCPSPLVHTDCYKRRCEPSCDNVHGDDCP--VLPDACFPGCYCPEGTVRKGPNCVPISEC 3029          

HSP 7 Score: 55.0694 bits (131), Expect = 9.460e-7
Identity = 97/413 (23.49%), Postives = 155/413 (37.53%), Query Frame = 3
Query:  768 TCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAV-TWSINIVYENC--------TSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYV-LRQ--DNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXG-DVTGLCGX--------XXXXXXXXXXXXXXVASFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRLKF------PGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWS--DCASECPVTCRNLFQTPSAYCQNSKVGR----------------CICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSS-LWHCTEKIC 1868
             C+S G   Y T+D + +++ G C+Y+L+    +  V T+ + +  ++C             C K + I  GD V       I        P +   + +      IP    ++ LRQ     ++LSL   +++L     + IF     SI  G  + GLCG+           NP+   +  D + S+       G   +   LS   P +  +         L+F        C   V+   Y S C Q+IC   +  NT   +       C  L+AY+  C+  G C  WR   LC  +CP + ++    CA  C  T + L +  +   +N  V                  C C  G+V  G  C+   +C    DG   P    ++  C  C C+S     C EK C
Sbjct: 3033 VCNSLGASKYMTYDRKSFSFNGNCTYLLSRDVVLPGVHTFQVYVSMDDCKKLGQPTPVEGGSCAKSLHILNGDHV-------IHVQRVPQKPKSLQVLVDGFEVKKIPYKDSWISLRQVVGKELVLSLPESHVELTASFEDLIFSLGVPSIKYGSKMEGLCGDCNGNAGNDLQPNPAKKKAGVDVIQSWQADEPKLGL--VEECLSEDVPKEHCIPLPPEKDPCLQFYNAELFGKCPLAVDPIAYVSACQQDIC---KPGNTQQGV-------CVALAAYAKECNQHGICTNWRRPQLCPYECPSDMVYEPCGCAKNCD-TIKALSEFDAVSLKNEAVVHTVKTDEMCLSSERFEGCFCPPGKVMDGGQCVPEIACTKCDDGLHLPDEKWKKDKCTECQCDSKGKTTCVEKKC 3425          
BLAST of SCO-spondin vs. Ensembl Fly
Match: Hml (gene:FBgn0029167 transcript:FBtr0075753)

HSP 1 Score: 333.954 bits (855), Expect = 5.464e-92
Identity = 329/1308 (25.15%), Postives = 547/1308 (41.82%), Query Frame = 3
Query:  771 CHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCT--SDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXX-----XXXXXXXXXXXXXVASFGNSFK----------------GFGC-----PDIANTLSTCKPDDQILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQ--WRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEP---KIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITG-SCDNTPQSIVDP---------PAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCS-AILNA-AIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTC---WNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCP---------KNQVYMD----SVSGCNSCTNYDT-CTDTSSIANSCGCPNDTVSKIDG-TCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGG---QTYLLSRG-----NNDTIPLFPKYDIV---------IEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDV--NRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGG-KHYDACASPCP-QTCDTIGSN--APSHCSTTHCVEGCS---CPNGMIDLNG---ECVPPTTCP---CFYNGQSYVNGAIIKMENCKKCQCVQAKFNCT 4406
            C ++G    +TFD  ++     CS+ L        V+ + +I+ + C   S  GC   + I             +LYT ++ N    L+       + +    M V+     + + LE+  +KL WD+   + +     ++ G V GLCG        +  S        V +F ++++                 FG        +   +S C   +++LAN+       K   C    N D     C+ + C  +   +            C  ++  +  C+ KG  ++  WR+  +C   C   +++  C      TC +    P++  + +    C C  G V+Y   CI  E CPC   G+E  P +  + +CNTCTC +  W CTE  C + CG +G   + TFDG ++ F    C Y  ++    NT   A       + +ESM     N A  ++P   K VT++     I+   T   +   Q    I  +    KLP  +    + +R+ ++ +  V+ +   ++++DG   +YI    +L+    GLCG F+ N+++DF   +  +  ++   A  + T  +C    ++   P          A     C  IL    F  C     V+ E +   C  +  + KD++S C   IL+A    C R G++     +        PL    G VF  C   C  +C +L   +   C  +C  GC CP   Y    G+CV +  C C       RP   E+  G         C C +G  +C+  +       P           Q Y +    +     +C N D    D+S     C C    V       CV P++C C +  + Y   + I   C    C    W         CE+ C  +GD H+ T DG  F FQG+C Y L     D+ +     +I++ N+ CG    TC+K ++I + G   ++ LLS       + +  P+    D V         I +   F  +    + L+V WD  TRVY+ L   ++  V GLCGNY+G+  ++    +M     ++ +     +A    +++ P  + AP    D C  +P+R++WA+  CG +K  + +F  C    H +V   R++  C++D C C++GGDCECLCT++A +A  CA  GI ++WR+Q+ CP+ C+     Y AC   C  +TCD       A   C+  +C+EGC    C +G I LN    +CVP   C       +G+++  G I   ++C  C+C + K  C+
Sbjct:  485 CTTWGGINMKTFDGLVFKAPLSCSHTLI----TDKVSGTFDIILKACPYGSGYGCAHTLKI---------LWQSVLYTFENLNGTMQLTTPIKKLPMPVQVMGMKVMPVAQHVQIDLESVGLKLDWDHRQYVSVQAGPQMW-GKVGGLCGTLDGDPNTDLTSRTGKKLATVKAFADAWRVEDRSELCQVENSAEMEFGMDSCEQSKLQKAVSVC---ERLLANE-------KLGDCIKPFNYDALIRTCMADYCNCANREHP-------ESCNCDAIAMLAKECAFKGIKLEHGWRNLEICPISCGFGRVYQACGPNVEPTCDSDLALPAS--KGACNEGCFCPEGTVQYKEACITRELCPCSLRGKEFKPESTVKKNCNTCTCKNGQWRCTEDKCGARCGAVGDPHYQTFDGKRYDFMG-KCSYHLLK--TQNTSVEAENVACSGAVSESM-----NFAAPDDPSCTKAVTIRF----ILRDGTPSVIKLDQGLTTIVNDKPIAKLPKMLGLGEVLIRRASSTFLTVEFADGIRVWWDGVSRVYIDAPPSLRGQTQGLCGTFNSNTQDDFLTPEGDVETAVEPFADKWRTKDTCQFKAETHQGPHPCTLNPEKKAQAEKFCDWILQD-IFQDC--HFLVEPEQFYEDCLYDTCACKDEMSKCFCPILSAYGTECMRQGVKTGWRMSVKECAVKCPL----GQVFDECGDGCALSCDDL--PSKGSCKRECVEGCRCPHGEYVNEDGECVPKKMCHCNFDGMSFRPGYKEVRPGEKFL---DLCTCTDGVWDCQDAEPGDKDKYPPSSELRSKCAKQPYAEFTKCAPKEPKTCKNMDKYVADSSDCLPGCVCMEGYVYDTSRLACVLPANCSCHHAGKSYDDGEKIKEDCNLCECRAGNWKC---SKNGCESTCSVWGDSHFTTFDGHDFDFQGACDYVLAKGVFDNGDGF---SITIQNVLCGTMGVTCSKSLEIALTGHAEESLLLSADSAYSTDPNKTPIKKLRDSVNSKGHNAFHIYKAGVFVVVEVIPLKLQVKWDEGTRVYVKLGNEWRQKVSGLCGNYNGNSLDDMQTPSM----GLETSPMLFGHA----WKLQPHCS-APVAPIDACKKHPERETWAQLKCGALK--SDLFKEC----HAEVPLERFWKRCIFDTCACDQGGDCECLCTAVAAYADACAQKGINIRWRSQHFCPMQCDPHCSDYKACTPACAVETCDNFLDQGIAERMCNRENCLEGCHIKPCEDGFIYLNDTYRDCVPKAECKPVCMVRDGKTFYEGDITFTDSCATCRCSKRKEICS 1714          

HSP 2 Score: 127.487 bits (319), Expect = 8.639e-29
Identity = 108/382 (28.27%), Postives = 163/382 (42.67%), Query Frame = 3
Query: 3312 AVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNND---TIPL--FPK----YDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQ-FAESFIA--NADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGC-NRGGDCECLCTSLATFATQCAFLGIPVK--WRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTED 4412
            A+C  +G  + KT DG +F    SC +TL+    D  +    I +       G+    CA  ++I+     Y     N     T P+   P       + +  +    Q+  +S+GL++ WD    V +   P   G V GLCG  DGD   +    T K    ++ FA+++     +++C  E S E         D C  +  +K  A  +C  +   N     CI+  + D       C+ D C C NR     C C ++A  A +CAF GI ++  WR   +CPI C  G+ Y AC      TCD   S+     S   C EGC CP G +     C+    CPC   G+ +   + +K +NC  C C   ++ CTED
Sbjct:  483 ALCTTWGGINMKTFDGLVFKAPLSCSHTLIT---DKVSGTFDIILKACPYGSGYG---CAHTLKILWQSVLYTFENLNGTMQLTTPIKKLPMPVQVMGMKVMPVAQHVQIDLESVGLKLDWDHRQYVSVQAGPQMWGKVGGLCGTLDGDPNTDLTSRTGKKLATVKAFADAWRVEDRSELCQVENSAEMEFG----MDSCEQSKLQK--AVSVCERLL-ANEKLGDCIKPFNYDA--LIRTCMADYCNCANREHPESCNCDAIAMLAKECAFKGIKLEHGWRNLEICPISCGFGRVYQACGPNVEPTCD---SDLALPASKGACNEGCFCPEGTVQYKEACITRELCPCSLRGKEFKPESTVK-KNCNTCTCKNGQWRCTED 845          

HSP 3 Score: 77.7962 bits (190), Expect = 9.579e-14
Identity = 182/766 (23.76%), Postives = 291/766 (37.99%), Query Frame = 3
Query:  795 YRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTG--CVKVIVI---EAGDVVV-----KSSGNGILYTTDS--NNPLTPLSVTNTDSALIIPG-TPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCG-----XXXXXXXXXXXXXXXVASFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRLK-FPGCADLVNSDTYFS-MCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQ---WRSDTLCETQCPGNKIWSDC-ASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMGTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQ------SNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKV-SSHFKLYFDGSKSIYIKVSDALK--NNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY--------ITGSC--DNTPQSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQ-SSNKDQLSYCSAILNAAIACRRFGI--QYEVPFTSNILQACIPLCQAGGTVFQI--CSRTCQSTCRELNEATA-----------SKCDDDC-----FPGCECPPNYYKTGTGQCVSESECT 2900
            + TFD  ++ Y G CS+IL    D+ + +WSI+ V++ C+ +T   C KVI I   EAG+ ++     K   NG  +T     N+P+   S   +      PG T + V  +  F +   + G +K+   +                V GLCG       D+  S D     N   FG+S+     P        C  + Q  A Q C+ I    F  C   VN   + +  C++  C     +N        +   C  L ++   C      +Q   WR+   CE  CP   + +DC    C  +C N+         ++    C C  G V  G  C+ P S                  +C  C CNS               +  +++ T+D   F+FN   C Y+     V        V+V +         T    G+   S +I         +NG  +I     PQ   S   V +DG +   K+P+   D  I +R++      + +  SH +L       I+     ++K  + + GLCG  +GN+ ND  + + + +++ V++ +S+        +   C  ++ P+    P   + D C    N   F  C     VD   Y + C+++       Q   C A+   A  C + GI   +  P      Q C   C +   V++   C++ C  T + L+E  A            K D+ C     F GC CPP     G GQCV E  CT
Sbjct: 2710 FTTFDGTVFKY-GPCSHILA--RDIHSSSWSIS-VHQQCSDETRKVCHKVITIQDTEAGNELILLPHLKLKFNGYEFTVQQLINSPICKASFVVSQ-----PGKTLLAVSTKYGFWVQLDDIGIVKVGISSKFIRT-----------VDGLCGYYNGNQKDDKRSPDGQIIPNTEKFGDSWYDKRIPKDQCGDLKCPREMQAKALQLCNIIHHPTFARCHKAVNYKQFLNNYCLEAACNCMMANNG-----DPAACKCNILESFVKKCLSVNPLVQLTTWRAVAQCEINCPSPLVHTDCYKRRCEPSCDNVHGDDCPVLPDACFPGCYCPEGTVRKGPNCV-PIS------------------ECKDCVCNS---------------LGASKYMTYDRKSFSFNG-NCTYLLSRDVVLPGVHTFQVYVSMDDCKKLGQPTPVEGGSCAKSLHI---------LNGDHVIHVQRVPQKPKS-LQVLVDGFE-VKKIPYK--DSWISLRQVVGKELVLSLPESHVELTASFEDLIFSLGVPSIKYGSKMEGLCGDCNGNAGNDL-QPNPAKKKAGVDVIQSWQADEPKLGLVEECLSEDVPKEHCIPLPPEKDPCLQFYNAELFGKC--PLAVDPIAYVSACQQDICKPGNTQQGVCVALAAYAKECNQHGICTNWRRP------QLCPYECPS-DMVYEPCGCAKNC-DTIKALSEFDAVSLKNEAVVHTVKTDEMCLSSERFEGCFCPPGKVMDG-GQCVPEIACT 3390          

HSP 4 Score: 75.8702 bits (185), Expect = 4.728e-13
Identity = 100/410 (24.39%), Postives = 158/410 (38.54%), Query Frame = 3
Query: 3315 VCIAYGDPHYKTLDGQMFSFQGSCMYTL---MDTPGDSSNNIPPITISVANIACGFSL--ATCAKFVQIIIGGQTYLLSRGNNDTIPLFPK-YDIVIEQLTFFTQLVSDS-IGLRVLWDRSTRV-----YLFLKPSFQ--------------GNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGS-----------NAPSH-------CSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQC-VQAKFNCTE 4409
            VC + G   Y T D + FSF G+C Y L   +  PG  +  +         +     +   +CAK + I+ G     + R     +P  PK   ++++          DS I LR +  +   +     ++ L  SF+                ++GLCG+ +G+  N+      K +  +   +S+ A+    P     E  ++    ++ C   P  K    Q          +F  C  A+  D   Y S C  D C    G   + +C +LA +A +C   GI   WR   LCP  C     Y+ C   C + CDTI +            A  H       C ++   EGC CP G +   G+CVP   C    +G  ++     K + C +CQC  + K  C E
Sbjct: 3034 VCNSLGASKYMTYDRKSFSFNGNCTYLLSRDVVLPGVHTFQVYVSMDDCKKLGQPTPVEGGSCAKSLHILNGDHVIHVQR-----VPQKPKSLQVLVDGFEVKKIPYKDSWISLRQVVGKELVLSLPESHVELTASFEDLIFSLGVPSIKYGSKMEGLCGDCNGNAGNDLQPNPAKKKAGVDVIQSWQADE---PKLGLVEECLSEDVPKEHCIPLPPEKDPCLQFYNAE-----LFGKCPLAV--DPIAYVSACQQDIC--KPGNTQQGVCVALAAYAKECNQHGICTNWRRPQLCPYECPSDMVYEPCG--CAKNCDTIKALSEFDAVSLKNEAVVHTVKTDEMCLSSERFEGCFCPPGKVMDGGQCVPEIACTKCDDGL-HLPDEKWKKDKCTECQCDSKGKTTCVE 3423          

HSP 5 Score: 57.3806 bits (137), Expect = 1.748e-7
Identity = 78/314 (24.84%), Postives = 137/314 (43.63%), Query Frame = 3
Query:  765 TTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENC-TSDTGCVKVIVI----EAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCG-----XXXXXXXXXXXXXXXVASFGNSFK-GFGCPDIANTLSTCK--PDDQILANQQCSKIRLK-FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQC-PGNKIWSDCASECPV-TCRNLF 1658
            +TC  +G  ++ TFD   + +QG C Y+L      +   +SI I    C T    C K + I     A + ++ S+ +   Y+TD N   TP+     DS         ++ +   F+++ +    +++KWD    +++ + N      V+GLCG     + D+  +       +   FG+++K    C      +  CK  P+ +  A  +C  ++   F  C   V  + ++  C+ + C   Q  +         + LCT ++AY+D+C+ KG  I+WRS   C  QC P    +  C   C V TC N  
Sbjct: 1336 STCSVWGDSHFTTFDGHDFDFQGACDYVLAKGVFDNGDGFSITIQNVLCGTMGVTCSKSLEIALTGHAEESLLLSADSA--YSTDPNK--TPIKKLR-DSVNSKGHNAFHIYKAGVFVVVEVIPLKLQVKWDEGTRVYVKLGNEWRQ-KVSGLCGNYNGNSLDDMQTPSMGLETSPMLFGHAWKLQPHCSAPVAPIDACKKHPERETWAQLKCGALKSDLFKECHAEVPLERFWKRCIFDTCACDQGGDC--------ECLCTAVAAYADACAQKGINIRWRSQHFCPMQCDPHCSDYKACTPACAVETCDNFL 1635          

HSP 6 Score: 55.0694 bits (131), Expect = 7.478e-7
Identity = 83/347 (23.92%), Postives = 129/347 (37.18%), Query Frame = 3
Query: 3342 YKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFV---------QIIIGGQTYLLSRGNNDTIPLFP-----KYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKY-EDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMH--QDVNRYYSNCLYDACGC---NRGGDCECLCTSLATFATQCAFLGIPVK---WRTQNLCPIMCEGGK-HYDACASPCPQTCDTI-GSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTC 4307
            + T DG +F + G C + L      SS      +ISV       +   C K +         ++I+     L   G   T+         K   V+ Q       VS   G  V  D    V + +   F   V GLCG Y+G+ +++      +   +  +F +S+              +   P  +        + ++ A Q+C ++   +  FA C +A++  Q +N Y   CL  AC C   N G    C C  L +F  +C  +   V+   WR    C I C     H D     C  +CD + G + P       C  GC CP G +     CVP + C
Sbjct: 2710 FTTFDGTVFKY-GPCSHILARDIHSSS-----WSISVHQQCSDETRKVCHKVITIQDTEAGNELILLPHLKLKFNGYEFTVQQLINSPICKASFVVSQPGKTLLAVSTKYGFWVQLDDIGIVKVGISSKFIRTVDGLCGYYNGNQKDDKRSPDGQIIPNTEKFGDSWY-------------DKRIPKDQCGDLKCPREMQAKALQLCNIIH--HPTFARCHKAVNYKQFLNNY---CLEAACNCMMANNGDPAACKCNILESFVKKCLSVNPLVQLTTWRAVAQCEINCPSPLVHTDCYKRRCEPSCDNVHGDDCP--VLPDACFPGCYCPEGTVRKGPNCVPISEC 3030          

HSP 7 Score: 54.6842 bits (130), Expect = 1.029e-6
Identity = 97/413 (23.49%), Postives = 155/413 (37.53%), Query Frame = 3
Query:  768 TCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAV-TWSINIVYENC--------TSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYV-LRQ--DNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXG-DVTGLCGX--------XXXXXXXXXXXXXXVASFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRLKF------PGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWS--DCASECPVTCRNLFQTPSAYCQNSKVGR----------------CICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSS-LWHCTEKIC 1868
             C+S G   Y T+D + +++ G C+Y+L+    +  V T+ + +  ++C             C K + I  GD V       I        P +   + +      IP    ++ LRQ     ++LSL   +++L     + IF     SI  G  + GLCG+           NP+   +  D + S+       G   +   LS   P +  +         L+F        C   V+   Y S C Q+IC   +  NT   +       C  L+AY+  C+  G C  WR   LC  +CP + ++    CA  C  T + L +  +   +N  V                  C C  G+V  G  C+   +C    DG   P    ++  C  C C+S     C EK C
Sbjct: 3034 VCNSLGASKYMTYDRKSFSFNGNCTYLLSRDVVLPGVHTFQVYVSMDDCKKLGQPTPVEGGSCAKSLHILNGDHV-------IHVQRVPQKPKSLQVLVDGFEVKKIPYKDSWISLRQVVGKELVLSLPESHVELTASFEDLIFSLGVPSIKYGSKMEGLCGDCNGNAGNDLQPNPAKKKAGVDVIQSWQADEPKLGL--VEECLSEDVPKEHCIPLPPEKDPCLQFYNAELFGKCPLAVDPIAYVSACQQDIC---KPGNTQQGV-------CVALAAYAKECNQHGICTNWRRPQLCPYECPSDMVYEPCGCAKNCD-TIKALSEFDAVSLKNEAVVHTVKTDEMCLSSERFEGCFCPPGKVMDGGQCVPEIACTKCDDGLHLPDEKWKKDKCTECQCDSKGKTTCVEKKC 3426          
BLAST of SCO-spondin vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342805)

HSP 1 Score: 95.1301 bits (235), Expect = 5.837e-19
Identity = 78/221 (35.29%), Postives = 111/221 (50.23%), Query Frame = 3
Query: 4434 CTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNC-----------------NVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISC-----GCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNC 5030
            C  SQ++C DG CI   K C+ + DC+++ DE NC                 N CD+ +F+C     C+P+ KKCDG  +CED SDE+ C      CL  +  C+    C+   ++C+G  +C   D SDE NC  C+   Y CN  + C+  N +C+G  DC DGSDE  C  I   P  + C           N  C++   +CDG+ DC +G+DE  C
Sbjct:  525 CLESQYQCGDGSCISGYKRCNGIHDCADASDEYNCIYDYEDTYDTDPNNNPLNECDILEFEC-DYSQCLPLEKKCDGYADCEDMSDELECQSYTDHCLESEFECD--SYCLPRDQLCNGIPNC--QDGSDERNCTFCREDAYLCNTGE-CVADNQRCNGIADCADGSDERHCARIYCPPNKLAC-----------NGTCVSRRIKCDGIRDCLDGYDEMYC 728          

HSP 2 Score: 78.5666 bits (192), Expect = 6.137e-14
Identity = 73/208 (35.10%), Postives = 108/208 (51.92%), Query Frame = 3
Query: 4428 TTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCG---CLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGC----ECICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNC 5030
            + C+P QF CD+  C   S  C+   DCS+  DE  C++    Q QC S G C   +++CD  ++CED SDE +C    C  ++ +C   + CI   + CDG YDC   D SDE+NC  C   +++CNN   C+  +  C+G  +C D SDE  C    EC+   P    C +           QC++ + +C+G  DC +  DE+NC
Sbjct:  803 SDCSPEQFYCDE-SCYNRSVRCNGHVDCSDGSDEVGCSL-PCPQHQCPS-GRCYTESERCDRHRHCEDGSDEANCTAILCKDNEFLCFDRQFCINATQQCDGYYDC--RDFSDEQNCIGCYANQFRCNNGD-CVSGSAPCNGYSECSDHSDELNCGGTQECL---PNQFRCNSG----------QCVSSSVRCNGRTDCQDSSDEQNC 991          

HSP 3 Score: 72.4034 bits (176), Expect = 4.606e-12
Identity = 48/134 (35.82%), Postives = 73/134 (54.48%), Query Frame = 3
Query: 4434 CTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKN--CNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISC-GCLPH-QIVCNISR------TCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNN 4805
            C  ++FRC++G CI++ K C+ V+DCS  EDE       C   ++QC     CI ++++CDG  +C D  DE  C G +P  +  C   +      +CI     CDG  DC  ND+SDEE C  C   +++C++
Sbjct:   73 CQANEFRCNNGDCIDARKRCNNVSDCSEGEDENEECPAACSGMEYQCRDGTRCISVSQQCDGHSDCSDGDDEEHCDGIVPKLRYTCPKGKFTCRDLSCISIVHRCDGRADC-PNDRSDEEGC-PCLYDKWQCDD 204          

HSP 4 Score: 68.5514 bits (166), Expect = 7.813e-11
Identity = 49/123 (39.84%), Postives = 64/123 (52.03%), Query Frame = 3
Query: 4428 TTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNV---CDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNI------SRTCIEEKKICDGNYDCGVNDKSDEENC 4769
            + CT  Q  C +G+CI+ S ICD   DCS++ DE++C++   C   QF C SN  C+  T +CDG  +C DNSDE SC   P    C        S  CI +   CD   DC   D +DE  C
Sbjct: 1209 SACTEYQATCMNGECIDKSSICDGNPDCSDASDEQSCSLGLKCQPNQFMC-SNSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDC--TDGTDEVGC 1328          

HSP 5 Score: 62.7734 bits (151), Expect = 4.118e-9
Identity = 59/214 (27.57%), Postives = 88/214 (41.12%), Query Frame = 3
Query: 4431 TCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEK------------NCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKK--CQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNC 5030
            +C P +++C + +CI+SS  C+++ DCS+  DE+              + C  +QF C  + +C   + +C+G  +C D SDE+ C     Q  C   R C  E + CD +  C   D SDE NC    C+  E+ C + Q                                                  CIN T+QCDG YDC +  DE+NC
Sbjct:  755 SCRPHEWQCANLECIDSSLQCNEIKDCSDGSDEELSVCFGTATTRLKPSDCSPEQFYC--DESCYNRSVRCNGHVDCSDGSDEVGCSLPCPQHQCPSGR-CYTESERCDRHRHC--EDGSDEANCTAILCKDNEFLCFDRQF-------------------------------------------------CINATQQCDGYYDCRDFSDEQNC 914          

HSP 6 Score: 59.3066 bits (142), Expect = 4.511e-8
Identity = 70/268 (26.12%), Postives = 110/268 (41.04%), Query Frame = 3
Query: 4347 IIKMENCKKCQCVQAKFNCTEDYSDC------------ITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCG---CLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECI-----CKE---------PEMILCXXXXXXXXXXXNCQ---------CINGTKQCDGVYDCWNGFDEKNCEI 5036
            I++ E C   QC+  +  C + Y+DC               C  S+F CD   C+   ++C+ + +C +  DE+NC  C    + C + G C+   ++C+G  +C D SDE  C    C P+++ CN   TC+  +  CDG  DC   D  DE  C +        N + I   L      +            ECI     C E          E+ +C    T+  +  +C          C N + +C+G  DC +G DE  C +
Sbjct:  581 ILEFE-CDYSQCLPLEKKC-DGYADCEDMSDELECQSYTDHCLESEFECD-SYCLPRDQLCNGIPNCQDGSDERNCTFCREDAYLC-NTGECVADNQRCNGIADCADGSDERHCARIYCPPNKLACN--GTCVSRRIKCDGIRDC--LDGYDEMYCPETNNHYPTQNVNVIRPKLGPNPIPKSCRPHEWQCANLECIDSSLQCNEIKDCSDGSDEELSVCFGTATTRLKPSDCSPEQFYCDESCYNRSVRCNGHVDCSDGSDEVGCSL 840          

HSP 7 Score: 58.5362 bits (140), Expect = 8.540e-8
Identity = 61/212 (28.77%), Postives = 84/212 (39.62%), Query Frame = 3
Query: 4446 QFRCDDGKCIESSKICDKVTDCSNSEDEKNCN-VCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISC-------------GCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNCEIF 5039
            +F C +  CI    +CD + DC  +EDE +    C   +++C   G CIP ++ CDG   C D SDE +C              CL  Q  C    +CI   K C+G +DC   D SDE NC       Y  + +      NN  +              EC   E E                 QC+   K+CDG  DC +  DE  C+ +
Sbjct:  441 EFACHNRDCISIESVCDGIPDCGRNEDEDDALCKCSGDKYKCQRGGGCIPKSQVCDGKPQCHDRSDESACHLHGRLNKTRLGVKCLESQYQCG-DGSCISGYKRCNGIHDCA--DASDEYNCIYDYEDTYDTDPN------NNPLN--------------ECDILEFECDYS-------------QCLPLEKKCDGYADCEDMSDELECQSY 616          

HSP 8 Score: 53.5286 bits (127), Expect = 2.317e-6
Identity = 37/112 (33.04%), Postives = 51/112 (45.54%), Query Frame = 3
Query: 4434 CTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCN-------------------------------VCDLQQFQCISNGACIPMTKKCDGTQNCE-DNSDEISCGCLPHQI 4673
            C P+QFRC+ G+C+ SS  C+  TDC +S DE+NC                                +C    F+C  NG CI +  KC+G  +C  D SDE  CG + + I
Sbjct:  957 CLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCGHRHTEVSQGLETTGVFTTSTTSTTAMTPLRIICPPTSFKC-ENGPCISLGLKCNGRVDCPYDGSDEADCGQISNDI 1067          
BLAST of SCO-spondin vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342810)

HSP 1 Score: 93.5893 bits (231), Expect = 1.859e-18
Identity = 78/221 (35.29%), Postives = 111/221 (50.23%), Query Frame = 3
Query: 4434 CTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNC-----------------NVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISC-----GCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNC 5030
            C  SQ++C DG CI   K C+ + DC+++ DE NC                 N CD+ +F+C     C+P+ KKCDG  +CED SDE+ C      CL  +  C+    C+   ++C+G  +C   D SDE NC  C+   Y CN  + C+  N +C+G  DC DGSDE  C  I   P  + C           N  C++   +CDG+ DC +G+DE  C
Sbjct:  488 CLESQYQCGDGSCISGYKRCNGIHDCADASDEYNCIYDYEDTYDTDPNNNPLNECDILEFEC-DYSQCLPLEKKCDGYADCEDMSDELECQSYTDHCLESEFECD--SYCLPRDQLCNGIPNC--QDGSDERNCTFCREDAYLCNTGE-CVADNQRCNGIADCADGSDERHCARIYCPPNKLAC-----------NGTCVSRRIKCDGIRDCLDGYDEMYC 691          

HSP 2 Score: 72.0182 bits (175), Expect = 5.490e-12
Identity = 46/112 (41.07%), Postives = 63/112 (56.25%), Query Frame = 3
Query: 4446 QFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCG----CLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENC 4769
            Q +C  G+C   S+ CD+   C +  DE NC  C   QF+C +NG C+  +  C+G   C D+SDE++CG    CLP+Q  CN S  C+     C+G  DC   D SDE+NC
Sbjct:  807 QHQCPSGRCYTESERCDRHRHCEDGSDEANC--CYANQFRC-NNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQFRCN-SGQCVSSSVRCNGRTDC--QDSSDEQNC 912          

HSP 3 Score: 70.8626 bits (172), Expect = 1.209e-11
Identity = 48/134 (35.82%), Postives = 73/134 (54.48%), Query Frame = 3
Query: 4434 CTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKN--CNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISC-GCLPH-QIVCNISR------TCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNN 4805
            C  ++FRC++G CI++ K C+ V+DCS  EDE       C   ++QC     CI ++++CDG  +C D  DE  C G +P  +  C   +      +CI     CDG  DC  ND+SDEE C  C   +++C++
Sbjct:   36 CQANEFRCNNGDCIDARKRCNNVSDCSEGEDENEECPAACSGMEYQCRDGTRCISVSQQCDGHSDCSDGDDEEHCDGIVPKLRYTCPKGKFTCRDLSCISIVHRCDGRADC-PNDRSDEEGC-PCLYDKWQCDD 167          

HSP 4 Score: 68.1662 bits (165), Expect = 9.877e-11
Identity = 65/188 (34.57%), Postives = 85/188 (45.21%), Query Frame = 3
Query: 4245 GCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDC----ITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNV---CDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNI------SRTCIEEKKICDGNYDCGVNDKSDEENC 4769
            G   P G  D NG    P       +  +YV  A+    +    Q V    N  E Y+D      + CT  Q  C +G+CI+ S ICD   DCS++ DE++C++   C   QF C SN  C+  T +CDG  +C DNSDE SC   P    C        S  CI +   CD   DC   D +DE  C
Sbjct: 1039 GRPLPPGFTDRNGRLEIPNIR--VEDAGTYVCEAV-GYASYIPGQQVTVNLN-VERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDEQSCSLGLKCQPNQFMC-SNSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDC--TDGTDEVGC 1219          

HSP 5 Score: 60.4622 bits (145), Expect = 1.804e-8
Identity = 67/216 (31.02%), Postives = 106/216 (49.07%), Query Frame = 3
Query: 4431 TCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEK------------NCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGC----ECICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNC 5030
            +C P +++C + +CI+SS  C+++ DCS+  DE+              + C  +QF C  + +C   + +C+G  +C D SDE+ C     Q  C   R C  E + CD +  C   D SDE NC  C   +++CNN   C+  +  C+G  +C D SDE  C    EC+   P    C           + QC++ + +C+G  DC +  DE+NC
Sbjct:  718 SCRPHEWQCANLECIDSSLQCNEIKDCSDGSDEELSVCFGTATTRLKPSDCSPEQFYC--DESCYNRSVRCNGHVDCSDGSDEVGCSLPCPQHQCPSGR-CYTESERCDRHRHC--EDGSDEANC--CYANQFRCNNGD-CVSGSAPCNGYSECSDHSDELNCGGTQECL---PNQFRC----------NSGQCVSSSVRCNGRTDCQDSSDEQNC 912          

HSP 6 Score: 57.7658 bits (138), Expect = 1.377e-7
Identity = 70/268 (26.12%), Postives = 110/268 (41.04%), Query Frame = 3
Query: 4347 IIKMENCKKCQCVQAKFNCTEDYSDC------------ITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCG---CLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECI-----CKE---------PEMILCXXXXXXXXXXXNCQ---------CINGTKQCDGVYDCWNGFDEKNCEI 5036
            I++ E C   QC+  +  C + Y+DC               C  S+F CD   C+   ++C+ + +C +  DE+NC  C    + C + G C+   ++C+G  +C D SDE  C    C P+++ CN   TC+  +  CDG  DC   D  DE  C +        N + I   L      +            ECI     C E          E+ +C    T+  +  +C          C N + +C+G  DC +G DE  C +
Sbjct:  544 ILEFE-CDYSQCLPLEKKC-DGYADCEDMSDELECQSYTDHCLESEFECD-SYCLPRDQLCNGIPNCQDGSDERNCTFCREDAYLC-NTGECVADNQRCNGIADCADGSDERHCARIYCPPNKLACN--GTCVSRRIKCDGIRDC--LDGYDEMYCPETNNHYPTQNVNVIRPKLGPNPIPKSCRPHEWQCANLECIDSSLQCNEIKDCSDGSDEELSVCFGTATTRLKPSDCSPEQFYCDESCYNRSVRCNGHVDCSDGSDEVGCSL 803          

HSP 7 Score: 56.9954 bits (136), Expect = 2.079e-7
Identity = 62/212 (29.25%), Postives = 86/212 (40.57%), Query Frame = 3
Query: 4446 QFRCDDGKCIESSKICDKVTDCSNSEDEKNCN-VCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISC-------------GCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNCEIF 5039
            +F C +  CI    +CD + DC  +EDE +    C   +++C   G CIP ++ CDG   C D SDE +C              CL  Q  C    +CI   K C+G +DC   D SDE NC       Y  + +      NN  +              EC   E E   C+            QC+   K+CDG  DC +  DE  C+ +
Sbjct:  404 EFACHNRDCISIESVCDGIPDCGRNEDEDDALCKCSGDKYKCQRGGGCIPKSQVCDGKPQCHDRSDESACHLHGRLNKTRLGVKCLESQYQCG-DGSCISGYKRCNGIHDCA--DASDEYNCIYDYEDTYDTDPN------NNPLN--------------ECDILEFE---CDYS----------QCLPLEKKCDGYADCEDMSDELECQSY 579          

HSP 8 Score: 53.1434 bits (126), Expect = 2.954e-6
Identity = 37/112 (33.04%), Postives = 51/112 (45.54%), Query Frame = 3
Query: 4434 CTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCN-------------------------------VCDLQQFQCISNGACIPMTKKCDGTQNCE-DNSDEISCGCLPHQI 4673
            C P+QFRC+ G+C+ SS  C+  TDC +S DE+NC                                +C    F+C  NG CI +  KC+G  +C  D SDE  CG + + I
Sbjct:  878 CLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCGHRHTEVSQGLETTGVFTTSTTSTTAMTPLRIICPPTSFKC-ENGPCISLGLKCNGRVDCPYDGSDEADCGQISNDI 988          
BLAST of SCO-spondin vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342819)

HSP 1 Score: 93.5893 bits (231), Expect = 1.970e-18
Identity = 78/221 (35.29%), Postives = 111/221 (50.23%), Query Frame = 3
Query: 4434 CTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNC-----------------NVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISC-----GCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNC 5030
            C  SQ++C DG CI   K C+ + DC+++ DE NC                 N CD+ +F+C     C+P+ KKCDG  +CED SDE+ C      CL  +  C+    C+   ++C+G  +C   D SDE NC  C+   Y CN  + C+  N +C+G  DC DGSDE  C  I   P  + C           N  C++   +CDG+ DC +G+DE  C
Sbjct:  902 CLESQYQCGDGSCISGYKRCNGIHDCADASDEYNCIYDYEDTYDTDPNNNPLNECDILEFEC-DYSQCLPLEKKCDGYADCEDMSDELECQSYTDHCLESEFECD--SYCLPRDQLCNGIPNC--QDGSDERNCTFCREDAYLCNTGE-CVADNQRCNGIADCADGSDERHCARIYCPPNKLAC-----------NGTCVSRRIKCDGIRDCLDGYDEMYC 1105          

HSP 2 Score: 72.0182 bits (175), Expect = 5.756e-12
Identity = 46/112 (41.07%), Postives = 63/112 (56.25%), Query Frame = 3
Query: 4446 QFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCG----CLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENC 4769
            Q +C  G+C   S+ CD+   C +  DE NC  C   QF+C +NG C+  +  C+G   C D+SDE++CG    CLP+Q  CN S  C+     C+G  DC   D SDE+NC
Sbjct: 1221 QHQCPSGRCYTESERCDRHRHCEDGSDEANC--CYANQFRC-NNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQFRCN-SGQCVSSSVRCNGRTDC--QDSSDEQNC 1326          

HSP 3 Score: 69.3218 bits (168), Expect = 3.940e-11
Identity = 45/122 (36.89%), Postives = 64/122 (52.46%), Query Frame = 3
Query: 4434 CTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKN--CNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCG--------CLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENC 4769
            C  ++FRC++G CI++ K C+ V+DCS  EDE       C   ++QC     CI ++++CDG  +C D  DE  C         C   +  C     CI  +++CD  YDC  ND SDE NC
Sbjct:  532 CQANEFRCNNGDCIDARKRCNNVSDCSEGEDENEECPAACSGMEYQCRDGTRCISVSQQCDGHSDCSDGDDEEHCDGSGYDSEECRFDEFHCGTGE-CIPMRQVCDNIYDC--NDYSDEVNC 650          

HSP 4 Score: 68.1662 bits (165), Expect = 9.280e-11
Identity = 65/188 (34.57%), Postives = 85/188 (45.21%), Query Frame = 3
Query: 4245 GCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDC----ITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNV---CDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNI------SRTCIEEKKICDGNYDCGVNDKSDEENC 4769
            G   P G  D NG    P       +  +YV  A+    +    Q V    N  E Y+D      + CT  Q  C +G+CI+ S ICD   DCS++ DE++C++   C   QF C SN  C+  T +CDG  +C DNSDE SC   P    C        S  CI +   CD   DC   D +DE  C
Sbjct: 1376 GRPLPPGFTDRNGRLEIPNIR--VEDAGTYVCEAV-GYASYIPGQQVTVNLN-VERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDEQSCSLGLKCQPNQFMC-SNSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDC--TDGTDEVGC 1556          

HSP 5 Score: 60.4622 bits (145), Expect = 2.162e-8
Identity = 67/216 (31.02%), Postives = 106/216 (49.07%), Query Frame = 3
Query: 4431 TCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEK------------NCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGC----ECICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNC 5030
            +C P +++C + +CI+SS  C+++ DCS+  DE+              + C  +QF C  + +C   + +C+G  +C D SDE+ C     Q  C   R C  E + CD +  C   D SDE NC  C   +++CNN   C+  +  C+G  +C D SDE  C    EC+   P    C           + QC++ + +C+G  DC +  DE+NC
Sbjct: 1132 SCRPHEWQCANLECIDSSLQCNEIKDCSDGSDEELSVCFGTATTRLKPSDCSPEQFYC--DESCYNRSVRCNGHVDCSDGSDEVGCSLPCPQHQCPSGR-CYTESERCDRHRHC--EDGSDEANC--CYANQFRCNNGD-CVSGSAPCNGYSECSDHSDELNCGGTQECL---PNQFRC----------NSGQCVSSSVRCNGRTDCQDSSDEQNC 1326          

HSP 6 Score: 56.9954 bits (136), Expect = 1.935e-7
Identity = 71/271 (26.20%), Postives = 112/271 (41.33%), Query Frame = 3
Query: 4347 IIKMENCKKCQCVQAKFNCTEDYSDC------------ITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCG---CLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGC---ECI-----CKE---------PEMILCXXXXXXXXXXXNCQ---------CINGTKQCDGVYDCWNGFDEKNCEI 5036
            I++ E C   QC+  +  C + Y+DC               C  S+F CD   C+   ++C+ + +C +  DE+NC  C    + C + G C+   ++C+G  +C D SDE  C    C P+++ CN   TC+  +  CDG  DC   D  DE  C +     Y   N  + ++                E  C   ECI     C E          E+ +C    T+  +  +C          C N + +C+G  DC +G DE  C +
Sbjct:  958 ILEFE-CDYSQCLPLEKKC-DGYADCEDMSDELECQSYTDHCLESEFECD-SYCLPRDQLCNGIPNCQDGSDERNCTFCREDAYLC-NTGECVADNQRCNGIADCADGSDERHCARIYCPPNKLACN--GTCVSRRIKCDGIRDC--LDGYDEMYCPETN-NHYPTQN--VNVIRPKLGPNPIPKSCRPHEWQCANLECIDSSLQCNEIKDCSDGSDEELSVCFGTATTRLKPSDCSPEQFYCDESCYNRSVRCNGHVDCSDGSDEVGCSL 1217          

HSP 7 Score: 56.9954 bits (136), Expect = 2.195e-7
Identity = 62/212 (29.25%), Postives = 86/212 (40.57%), Query Frame = 3
Query: 4446 QFRCDDGKCIESSKICDKVTDCSNSEDEKNCN-VCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISC-------------GCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNCEIF 5039
            +F C +  CI    +CD + DC  +EDE +    C   +++C   G CIP ++ CDG   C D SDE +C              CL  Q  C    +CI   K C+G +DC   D SDE NC       Y  + +      NN  +              EC   E E   C+            QC+   K+CDG  DC +  DE  C+ +
Sbjct:  818 EFACHNRDCISIESVCDGIPDCGRNEDEDDALCKCSGDKYKCQRGGGCIPKSQVCDGKPQCHDRSDESACHLHGRLNKTRLGVKCLESQYQCG-DGSCISGYKRCNGIHDCA--DASDEYNCIYDYEDTYDTDPN------NNPLN--------------ECDILEFE---CDYS----------QCLPLEKKCDGYADCEDMSDELECQSY 993          

HSP 8 Score: 54.6842 bits (130), Expect = 1.207e-6
Identity = 54/198 (27.27%), Postives = 78/198 (39.39%), Query Frame = 3
Query: 4368 KKCQCVQAKFNCTEDYSDCITTCTPSQFRCDDG-KCIESSKICDKVTDCSNSEDEKNCN-------VCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDE-------------ISCG---------------------------------------CLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQ 4781
            K+C  V       ++  +C   C+  +++C DG +CI  S+ CD  +DCS+ +DE++C+        C   +F C   G CIPM + CD   +C D SDE             I  G                                       C  +Q  C  S  CI     CDG Y C  ND SDE++C++ Q
Sbjct:  549 KRCNNVSDCSEGEDENEECPAACSGMEYQCRDGTRCISVSQQCDGHSDCSDGDDEEHCDGSGYDSEECRFDEFHC-GTGECIPMRQVCDNIYDCNDYSDEVNCVEGEEEDRVGIPIGHQPWRPASKHDDWLHEMDTSEYQVYQPSNVYEKANSQNPCASNQFRCTTSNVCIPLHLRCDGFYHC--NDMSDEKSCEQYQ 743          
BLAST of SCO-spondin vs. Ensembl Zebrafish
Match: scospondin (subcommissural organ spondin [Source:ZFIN;Acc:ZDB-GENE-051114-1])

HSP 1 Score: 547.74 bits (1410), Expect = 7.192e-161
Identity = 439/1471 (29.84%), Postives = 679/1471 (46.16%), Query Frame = 3
Query:  765 TTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXX-----XXXXXXXXXXVASFGNSFK------GFGCPDIANTLSTCKPDDQIL----ANQQCSKIR-LKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQ-CPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMGT-QFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPAGD--------NDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLS-YCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDD---CFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVY-----MDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDT---IPL-FPKY----DIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPE-NNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDV--NRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCDDG--KCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECI-CKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNC 5030
            +TC S+   ++RTFD + + +QG C+Y+L + +D    TW++ I    C +   C K + +  G         G++     N  +  L+V   +  L   G  ++ L   +F+ +    G ++LK+D  N I++++       +  GLCG  +NN      ++  S     ASFGNS++         C D A    +C   + +     A   C  ++   F  C   V+   Y   C+   C+        L++      +C  L++Y   C+ +   I WR    C T+ CP  +++SDC S CP TC +     +  C++  VG C C  G   +   C++ + CPC +    +  G   +  CNTC C +  W C+ + C + C ++G     TFD  ++      C++ AVE  V+       + +II +   +     G +  + E  I  +        L  T         +V ++G  H   LP    D  +  R  +++       +    + DG   ++I +     + + GLCG    +  +DFT  +  +  S  + A  +I GSC   P ++   P G           +CS +++   F  C +   VD+E +   C  E  S   Q S +CS +   A  C + G        S       P+  +GG V+Q C R C ++C +L +  + + D+    C  GC+CP    +   GQCV    C C    +  D   PAG++I  NC TCVC  G  NC          CP + ++     + + S  NS    D CT+     + C CP  TV   D  CV+P +CPC +  R Y  ND I+  C   +C  + W+      A C   C+A GDPHY T DG+ +SF G C Y L+      S+ +   ++S  N+ CG +  TC K V + IG     L RG   T   IP+  PK      +++E++  F  L S  +G+ +LWD   RVY+ L P   G V GLCGN+DGD +N++       +  ++       N+    ++ISP   +VA    +D C  NP R +WA++ C V+     +F+SC    H +V   +YY  C++DACGC+ GGDCECLCT++A +A +C   G+ V+WR+Q LCP+ CE G  Y+AC + C   C +  S + S CS   CVEGC CP G +  +  C+ P+ CPC ++G  +  GA++  ++C+ C C    + C        + C  S+FRC  G  +CI +  +CD   DC +  DE     C  + F+C S GAC+P+  +CDG  +C D SDE  C   P +  C   R C+   K+CDG  DCG  D SDE  C  C + E +C   Q C+     CDG  DC  G DE  C    C + E               + QC+    +CDG  DC +G DEK C
Sbjct:  196 STCMSWSGTHFRTFDRKHFHFQGSCTYLLASSTDG---TWAVYI-STVCETSGRCRKDLRMMLG--------LGLVSIHKDNMTVNGLAVPQGE-PLFQNGVSVHWL--GDFVFVESGLG-VRLKFDMENTIYLTVTAEHLT-NTRGLCGVYNNNPDDDFTTSTGSVSQYAASFGNSWRVQDQQQSQVCSDAAELGHSCDLSNDVSLRRDAESACHLLKETPFSHCHHQVDPGPYIDTCLYLFCS--------LEVKDRDTAVCDTLASYVRECAQQHIIISWRRRGFCGTRVCPRGQVFSDCVSSCPATCASPRPPAAGQCRDECVGGCECPQGVYLHAGQCVRRDDCPCFHRRHSYSAGQTIRQRCNTCVCRAGQWECSTEKCEAQCSVLGAMHITTFDQKRYGLQTADCRFTAVEDFVDK-----KLSIIIGAGPCAG----GEAGCLREMSITALHTT-----LTVTD------AGSVLVNG--HRNPLPVVTGDLLVR-RASSSVLLIQAFGAQLMWHLDGPL-LFITLQPGFAHKVRGLCGTLSWSQHDDFTTPEGDVENSAASFAAKFIVGSCP-APSAMTSDPCGTLTQRRQLAERVCS-VIHSNVFQACHDV--VDREPFMRLCVSEVCSCGPQASCHCSVLTAYATHCAQEGA-----LLSWRNHTFCPVQCSGGQVYQECGRLCGTSCADLWDGWSCEPDEGSRVCVSGCQCPDGLAQDAQGQCVPVHMCPC----KSGDTLHPAGSSINNNCNTCVCARGVWNCTDLSCPELNQCPGSLIFSPRSCLRTCSSPNS--PLDACTEP---IHGCICPEGTVLLGD-QCVKPDECPCHHNGRLYFTNDTISKDCNTCVCREQRWHC---GQALCSGTCVATGDPHYITFDGRHYSFLGDCEYVLVQ----ESSGL--FSVSAENVPCGSTGVTCTKSVTLTIGNTAIHLLRGKAVTVNGIPVTLPKSYSGSGLILERVGLFVSL-SSRLGVTLLWDGGMRVYVRLMPHLHGRVGGLCGNFDGDAENDFT----TRQGIMESTPELFGNS----WKISPSCPDVADQDLRDPCFINPHRVTWAKKKCAVINQE--IFSSC----HSEVPYQQYYDWCVFDACGCDSGGDCECLCTAVAAYAEECNRRGVYVRWRSQELCPLQCENGLVYEACGAACSPACPSTPSLSDSLCSALSCVEGCFCPQGTVYHDDACISPSQCPCEWDGSVFPAGAMV-TQHCQNCSCSAGLWQCVGSPCPPPSPCKDSEFRCSGGSERCIPAVWVCDNEDDCGDGSDEVCPITCPPEHFRC-SGGACLPVELRCDGHPDCADQSDEDFC---PPKFRCANGR-CVPGHKVCDGRMDCGFADDSDEYGC-VCALGELQCPGDQ-CVSAERVCDGNRDCPSGIDELICPAKGCSQFEF-----------GCTSGQCVPLAWRCDGETDCLDGSDEKRC 1555          

HSP 2 Score: 55.8398 bits (133), Expect = 6.537e-7
Identity = 41/106 (38.68%), Postives = 51/106 (48.11%), Query Frame = 3
Query: 2724 CQAGGTVFQ-ICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCP 3038
            C+  G VF   C+  C  +C +L +         C PGC CPP       G CV   EC C  P +    EI  G NIT++C TCVC+NG L       CT+ VCP
Sbjct: 4224 CEDRGRVFDGSCANQCPRSCADLWDHVQCL-QGVCHPGCRCPPGQLLQ-DGSCVPVDECRCGLPMQNGTLEIRPGENITLSCNTCVCVNGSL------VCTDHVCP 4321          
BLAST of SCO-spondin vs. Ensembl Zebrafish
Match: otog (otogelin [Source:ZFIN;Acc:ZDB-GENE-120228-1])

HSP 1 Score: 337.035 bits (863), Expect = 7.730e-93
Identity = 314/1194 (26.30%), Postives = 515/1194 (43.13%), Query Frame = 3
Query:  744 DVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYEN----CTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGT--PMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXV-----ASFGNSFKGFGCPDIA----------NTLSTCKPDDQILANQQCSKI-RLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQ-WRSD-TLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKV---GRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMGTQF-DTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSK-SIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY-ITGSCDNTPQ-SIVDPPAGDNDICS------TILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPP-NYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMD---SVSGCNS---------CTNYD---TCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLS--RGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAI------QFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCE 4142
            ++  E   TC S+G   Y TFD   Y + G+CSY L    + +A + S++I   N     +S   C + I               +    +    L   SVT    ++++P     + + R  ++I++S +     L W    +      +  + G   GLCGN + +  +D      V     A FGNS+     P++A          +  +T  P   +   + CS + R  F  C + V+  +Y + C  ++C    N            V+C   + Y+ +C+     +  WR+   +C   CP   ++ +C + CP+ C+         C +SK+     C C    +     C+K   CPC + G  +P G + Q DCN CTC   +W+CTE  CP  C + G  F  +FDG  + F    CQYV     +  + +     V IQ+   +  G   + A I    +V  +   ++I +  +      SQ  +          LP++  D    +++L++++ +VK+S    L ++  +  +Y+++ +  ++N +GLCG F+GN ++DF      I  +      ++ ++ +C   P    +DP        S       +L    FS C     V    +   CR +       L  CS + + A  CRR G+  E  F S+ L  C   C +    + +C   CQ  C  L  +    C D+C  GC CP   Y+   T  CV  +EC C        P    G  I  +    +C +G+L  +T  +    +CP  Q Y D    V G ++         C  Y    TC+        C CP   +   D  C +P  CPC++  +EY P D ++  C + +C +  +     E   C ++C AYGD HY+T DG +F + G C   L+ +  D+      +T++  N+ C  S   C K + I +G    +     G  +   +  +    I Q  ++T +      L VLWDR T +++   P +QG + GLCGN+D    NE     M+  + I      +F  S+ A   +   +I           +  CN NP R+ +A++ CG++   + VF  C   +  DV  +Y NCL D CGCNRGGDCEC CTS+A +A +C   GIP+ WR+ ++CP  CE
Sbjct:  124 NLGFEREMTCRSWGQYNYETFDGLYYYFPGKCSYTLLRDCEDNARS-SVHIQVHNDPECSSSPYSCTRSI--------------SLFLPWEGEIRLQHFSVTFKGQSVLLPHHIHDVELERISDYIVVS-QPHVFTLAWQGLTSSVYIKMSPEFVGHTCGLCGNFNADTQDDLKTSYGVFTQDLAMFGNSWAEEE-PELARCTVVPSLYPSPCATLDPHVLLKVEEVCSTLLREPFQSCHEFVSPYSYMASCSNDLCLSGPNGA----------VVCQVFTEYARACAHADHPLHDWRTHFPVCNVDCPDELLFRECITCCPMHCKI-----EQMCIDSKLQCLDGCYCPDDLIFEDGVCVKASDCPCEHHGMLYPSGHIIQEDCNNCTCFGGIWNCTEHNCPGECSVTGDMFFQSFDGRVYTF-PATCQYV-----LAKSRNSGKFTVTIQN---APCGANLDGACIQSVNLVVNEDPRTEITMSHSGEVFLASQFRI---------SLPYS--DDMFQIQELSSMFVQVKLSQGLWLQYNWKEFRLYLQLEEQWRDNTLGLCGTFNGNIQDDFLAPSGMIESTPFLFGNAWRVSSACVPRPSLPQLDPCDTHQQAASYAVEKCDVLTQEVFSACHE--YVSPVGFQLQCRAD-VCKCGALCLCSILAHYARTCRRHGVIIE--FRSH-LPECAVSCPSTME-YGVCVSACQRRCLFL--SLPQPCGDECEEGCVCPEGTYFNMHTHTCVPRNECPCSFLGADYSP----GDVIITSSGVQICQDGKLVSQT--SIIETLCPAGQFYEDCGNRVDGPSASKGLACEQTCETYLLNLTCSTHEPCVPGCVCPAGLLKHGD-ECFKPRACPCLWKGKEYYPGDKVSSPCHQCVCQHGTFQC---EFRPCPSMCTAYGDRHYRTFDGFLFDYIGVCKVYLVKSSLDAM-----LTVTAENVDCFESGVICRKSLHISVGRSFIVFDDDTGRPNPSSVIDRQRAYIWQAGYYTIVHLLGEDLTVLWDRKTTIHIQAGPRWQGRLTGLCGNFDQKTANE-----MRTPENIDSSTPQEFGNSWTAAECVNSPDI-----------RHPCNLNPLREPFAKRQCGIL--LSEVFQVCHPVV--DVTWFYMNCLVDTCGCNRGGDCECFCTSVAAYAHRCCQKGIPIDWRSPSICPYDCE 1221          

HSP 2 Score: 139.813 bits (351), Expect = 2.120e-32
Identity = 124/462 (26.84%), Postives = 208/462 (45.02%), Query Frame = 3
Query: 3033 CPKNQVYMDSVSGCN-SCTNYDTCTDTS-SIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSL-ATCAKFVQIII------------GGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQL-VSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQ-DMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNR--YYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQ-NLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGM-IDLNGE-CVPPTTCPCFYNGQSYVNGAII 4352
            CP   ++ + ++ C   C     C D+     + C CP+D + + DG CV+ SDCPC +    Y    +I   C    C   +WN       NC   C   GD  +++ DG++++F  +C Y L       S N    T+++ N  CG +L   C + V +++             G+ +L S+    ++P       + E  + F Q+ +S  + L+  W +  R+YL L+  ++ N  GLCG ++G++Q++++  +      I+       NA    + +S      PS  Q D C+ +    S+A + C V+  T  VF++C    H+ V+   +   C  D C C       CLC+ LA +A  C   G+ +++R+    C + C     Y  C S C + C  +  + P  C    C EGC CP G   +++   CVP   CPC + G  Y  G +I
Sbjct:  404 CPDELLFRECITCCPMHCKIEQMCIDSKLQCLDGCYCPDDLIFE-DGVCVKASDCPCEHHGMLYPSGHIIQEDCNNCTCFGGIWNCTEH---NCPGECSVTGDMFFQSFDGRVYTFPATCQYVLAK-----SRNSGKFTVTIQNAPCGANLDGACIQSVNLVVNEDPRTEITMSHSGEVFLASQFR-ISLPYSDDMFQIQELSSMFVQVKLSQGLWLQYNW-KEFRLYLQLEEQWRDNTLGLCGTFNGNIQDDFLAPS----GMIESTPFLFGNA----WRVSSACVPRPSLPQLDPCDTHQQAASYAVEKCDVL--TQEVFSAC----HEYVSPVGFQLQCRADVCKCG----ALCLCSILAHYARTCRRHGVIIEFRSHLPECAVSCPSTMEYGVCVSACQRRC--LFLSLPQPCGD-ECEEGCVCPEGTYFNMHTHTCVPRNECPCSFLGADYSPGDVI 833          

HSP 3 Score: 106.301 bits (264), Expect = 3.034e-22
Identity = 118/449 (26.28%), Postives = 193/449 (42.98%), Query Frame = 3
Query: 3309 EAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVAN-IACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIP----LFPKY--DIVIEQLTFFTQLVSDSIGLRVLWD-RSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKY-EDAIQFAESFIANADICPYEISPEN---NVAPSKEQDMC-NANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVK-WRTQ-NLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHC--STTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQ---FRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISN--GACI 4589
            E  C ++G  +Y+T DG  + F G C YTL+    D++ +   + I V N   C  S  +C + + + +  +  +  +  + T      L P +  D+ +E+++ +  +VS      + W   ++ VY+ + P F G+  GLCGN++ D Q++       + +D   F  S+         E  PE     V PS     C   +P      E++C  +      F SC E +      Y ++C  D C     G    +C     +A  CA    P+  WRT   +C + C     +  C + CP  C          C  S   C++GC CP+ +I  +G CV  + CPC ++G  Y +G II+ E+C  C C    +NCTE   +C   C+ +    F+  DG+       C  V   S +  +    +   Q   C +N  GACI
Sbjct:  130 EMTCRSWGQYNYETFDGLYYYFPGKCSYTLLRDCEDNARS--SVHIQVHNDPECSSSPYSCTRSISLFLPWEGEIRLQHFSVTFKGQSVLLPHHIHDVELERISDYI-VVSQPHVFTLAWQGLTSSVYIKMSPEFVGHTCGLCGNFNADTQDDLKTSYGVFTQDLAMFGNSWA--------EEEPELARCTVVPSLYPSPCATLDPHVLLKVEEVCSTL--LREPFQSCHEFVSP--YSYMASCSNDLCLSGPNG--AVVCQVFTEYARACAHADHPLHDWRTHFPVCNVDCPDELLFRECITCCPMHC-----KIEQMCIDSKLQCLDGCYCPDDLIFEDGVCVKASDCPCEHHGMLYPSGHIIQ-EDCNNCTCFGGIWNCTEH--NCPGECSVTGDMFFQSFDGRVYTFPATCQYVLAKSRNSGKFTVTI---QNAPCGANLDGACI 550          

HSP 4 Score: 62.7734 bits (151), Expect = 4.593e-9
Identity = 92/395 (23.29%), Postives = 154/395 (38.99%), Query Frame = 3
Query: 3303 NCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIP-----PITISVANIA--CGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNV--QGLCGNYDGDLQNEYM--HGTM--KYEDAIQFAESF-IANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPC--PQTCDTIGSNAPSHCSTTHCVEGCSCPNGMI---DLNGECVPPTTCPCFYN-GQSYVNGAIIK-------MENCKKCQCVQAKFNCT 4406
            +C   C  + D +  T DG+  +   + +Y +   P ++ + +      P    V N    C  +L    K  ++++      L   +    P F KY   I   T    L+    GL++ W  +T + +    S+   +   GLCG+ DG+  N+    +GT+  + ED   F +S+ I N           + V+ S+ +++     D        C  M + N  F  C   +   V  +    + D    N        C +LA +A  C    I ++WR+ + CP +C G   Y AC   C  P   +      P  C  T   EGC CP G +     +  C+PP+ C C  + G     G + K       M  C+    V  ++NC+
Sbjct: 2304 DCPCRCSVFPDLNLITFDGKSVAIYKAALYVVTQLPNETVSILVQECSGPDDTLVWNFTNLCLAALNITHKSNEVLVNRLQRRLYVNSRYAKPRFKKYGFEILD-TGNMYLIRSPAGLKIQWFHTTGMMVIEMDSYNNRLPTMGLCGSCDGNPLNDLTLSNGTVVPEQEDPAVFIDSWQIPNTT---------SYVSNSRRREVNCTTSDCS-----QCFNMLN-NNTFTLCHAYVPPGV--FCEMWVRDVEYVNNP------CIALAAYAASCHKFNICMEWRSSDFCPFVCPGNLRYQACLPACTAPSCPNQEFEFVPEQC--TGLSEGCVCPEGTLLHRPYSALCIPPSKCACTDSFGAPRALGEVWKASLDGCCMYKCENDSIVPVEYNCS 2672          

HSP 5 Score: 58.151 bits (139), Expect = 1.178e-7
Identity = 41/135 (30.37%), Postives = 58/135 (42.96%), Query Frame = 3
Query: 4134 MCEGGKHYDACAS-----------PCPQTCDTIGSNAPSHCSTTH-CVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTP---SQFRCDDGKCIESSKIC 4493
            +C  G+ Y+ C +            C QTC+T   N    CST   CV GC CP G++    EC  P  CPC + G+ Y  G  +    C +C C    F C  ++  C + CT      +R  DG   +   +C
Sbjct:  857 LCPAGQFYEDCGNRVDGPSASKGLACEQTCETYLLNL--TCSTHEPCVPGCVCPAGLLKHGDECFKPRACPCLWKGKEYYPGDKVS-SPCHQCVCQHGTFQC--EFRPCPSMCTAYGDRHYRTFDGFLFDYIGVC 986          
BLAST of SCO-spondin vs. Ensembl Zebrafish
Match: CABZ01080550.1 (pep chromosome:GRCz11:25:8269956:8292650:1 gene:ENSDARG00000100621.2 transcript:ENSDART00000166938.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01080550.1)

HSP 1 Score: 324.324 bits (830), Expect = 8.907e-90
Identity = 308/1206 (25.54%), Postives = 505/1206 (41.87%), Query Frame = 3
Query:  765 TTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGC-VKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAG-NIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXX----XXXXXXXXXXXXXVASFGNSFKGFGCPDIANTLSTCKPDDQILANQ----QCSKIRL---------KFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKG-SCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYT---CIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIM-GTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTK------LPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGS-CDNTPQSIVDPPAGDND-------ICSTILNGPE-FSGCMNSSKVDKEFYATYCRREQSS-NKDQLSYCSAILNAAIACRRFGI---QYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFP--GCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMD-SVSG--------CNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTP-GDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDS-IGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYM-HGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMC----EGGK---HYDACASPCPQTC 4190
            + C  +G  +++TFD  +Y + G C Y L   SD  ++    +I  +     TG  +  + I   D+ ++               LT   V   ++ + +P     +L ++N I   L +   I + W+ ++ + + + +        GLCG+       N             FGN  +      + N    C+   + +  Q    QC K R          K+  C+ +++ + Y   C  ++C +      T         LC  L+ YS  CS  G +   WR+   C  QCP N + S+  S C  TC +  +  +A C+   +  C C  G V    +   CI  E C C +D + +  G V +     C C    W C     P  C +  G+ F TFDG +F F+   C Y+       + D   + F+I+                    +IV    + +D  LK+      + + N      D T +      LP+   D  +      +I  +       ++       +YI V  + +    GLCG F+    +D       +  + V+ A ++   S C +  + + DP +  +D        CS + +    F+ C   + V+ + Y   C+    +  K +   C+   + A AC   G+    +        ++ C P  Q+     Q C RTC S   E        C+ D  P  GC CP   Y+     CV   +C C++  +    +I  G ++TI  + CVC+NG+ +C++        CP  +V+ + S +G          +C++ +    +    + C CP   +    G CVQP +CPC +  + YAP  VI   C K  CS   W         C  +C  YG  HYKT D Q F F+G C Y       G+ + N   +T    N+ CG +  TC+K V I++G    LLS G      +    +I   +      LV D+ IGL VLWDR T V + L+P    +V GLCGN++G+ ++++   G +   + ++F +S+      CP       +  P  + D C+  P+R++WA+  C ++K+    F  C   +  D N YY NC+ D+C C+ GGDCEC CT++A +A  C   G+ V WRT  +CP+ C    E G+   HY  C +PC +TC
Sbjct:    2 SICSMWGNFHFKTFDGDVYQFPGMCEYNLV--SDCQSLIRQFSIYVKRTERSTGPKISRVSITINDIAIE---------------LTENQVNVNEAKVTLPVHVSGILVEENTIYTRLYSKMGITVMWNKDDAVMVELDSKYS-NRTCGLCGDFNGIPVYNEFIQSGRTVGYTEFGNMHR------VPNPTHQCEDPFENVDEQNVVDQCEKYRADCADLLEDEKWSSCSWVLDPEAYIKACTNDLCNRQPEDEDTT-------ALCATLTEYSRQCSHAGGNPPAWRTAKFCNVQCPYNMVHSESGSPCMDTCSH--KDTNALCEEHNIDGCFCPPGTVFDDISDTGCIPAEKCQCKHD-RVYSSGEVLRKSEEECYCQEGSWVCMSIPGPGLCAVEEGSHFTTFDGKEFTFHG-DCNYLL------SKDCEESKFIILG-------------------QIVPCFTHETDTCLKSIVVLFDNDKKNPLFIKADGTVQHNAEVSLPYMTADFTVFRPSSFHIILQTVFGLQVQVQLVPLMQVYITVDQSFQGKTCGLCGNFNKVLADDLKTPQGVVEGTAVSFANAWKAQSNCPDRSERMDDPCSYSSDSEHFAEHWCSKMKDKESLFAQC--HATVNPDSYYKRCKYSSCTCEKSEDCLCTVFSSYARACAAKGVILEGWREVVCDKYIKDC-PASQSYSYELQSCQRTCVSLASE-----RQSCNVDFVPVDGCACPDGLYQDENNLCVPMEKCPCYHNGQ----KIHPGKSLTIRDEHCVCMNGKFHCRSWKT-QILGCPSPKVFFNCSTAGPEEYGLECAKTCSHQEVDCFSLDCQSGCQCPFGLLDDGRGHCVQPYNCPCKHDGQYYAPGSVIVKDCNK--CSICRWGNWLCSQKKCPGICTIYGSGHYKTFDQQRFGFRGDCSYIAAQNKCGNKTGNFHVVT---ENMPCGTTGTTCSKAVGILLGRTWLLLSDGTVTATDVGTGPNIKYNERNVGMYLVIDAAIGLTVLWDRKTTVRIILQPQHMDDVCGLCGNFNGNGKDDFTTQGNLPTTNIMEFVDSWKV-LSTCP-------DAQP--DFDPCSQTPNRETWAKIQCSIIKEV--TFKDCHSKV--DPNPYYENCVKDSCSCDTGGDCECFCTAVAAYAQACNEAGVCVVWRTPEICPVYCDYYNEPGECTWHYSPCHTPCYKTC 1115          

HSP 2 Score: 91.2781 bits (225), Expect = 9.206e-18
Identity = 96/382 (25.13%), Postives = 164/382 (42.93%), Query Frame = 3
Query: 3312 AVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGN---NDTIPLFPKY--DIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDG-DLQNEYMH-----GTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNR---GGDCECLCTSLATFATQCAFLGI-PVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMI--DLNGE-CVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNC 4403
            ++C  +G+ H+KT DG ++ F G C Y L+    D  + I   +I V       S       V I I      L+      N+     P +   I++E+ T +T+L S  +G+ V+W++   V + L   +     GLCG+++G  + NE++      G  ++ +  +         D  P+E   E NV      D C      + +      +++D    ++SC   +  D   Y   C  D   CNR     D   LC +L  ++ QC+  G  P  WRT   C + C     +    SPC  TC    +NA       H ++GC CP G +  D++   C+P   C C ++ + Y +G +++    ++C C +  + C
Sbjct:    2 SICSMWGNFHFKTFDGDVYQFPGMCEYNLV---SDCQSLIRQFSIYVKRTE--RSTGPKISRVSITINDIAIELTENQVNVNEAKVTLPVHVSGILVEENTIYTRLYS-KMGITVMWNKDDAVMVELDSKYSNRTCGLCGDFNGIPVYNEFIQSGRTVGYTEFGNMHRVPNPTHQCED--PFENVDEQNVV-----DQC------EKYRADCADLLEDEK--WSSCSWVL--DPEAYIKACTNDL--CNRQPEDEDTTALCATLTEYSRQCSHAGGNPPAWRTAKFCNVQCPYNMVHSESGSPCMDTCSHKDTNA---LCEEHNIDGCFCPPGTVFDDISDTGCIPAEKCQCKHD-RVYSSGEVLRKSE-EECYCQEGSWVC 353          
BLAST of SCO-spondin vs. Ensembl Zebrafish
Match: otogl (otogelin-like [Source:ZFIN;Acc:ZDB-GENE-050419-93])

HSP 1 Score: 319.316 bits (817), Expect = 1.931e-87
Identity = 316/1229 (25.71%), Postives = 514/1229 (41.82%), Query Frame = 3
Query:  633 FLGKAVSYDECCADKTGSWGSQSGSCVSCKANFAGGNDV-------NNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTP--MYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCG-----XXXXXXXXXXXXXXXVASFGNSF-----KGFGCPDIANTL-----STCKPDDQILANQQCSKIRLKFP--GCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCI-QWR-SDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDG-SKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSI--VDPPAGDND------ICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPN-YYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDN-CTNPVCPKNQVYMD-------SVSGCN-----SCTNYD---TCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGN---NDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYM-HGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCE 4142
            FL +     E C    G W    G C    A F G  D          +    C S+G  ++ TFD   Y Y G CSYIL      S   +++ +      +   C        G V        + +  +    ++   V      L +P T   +++ R  ++IL+    G   L WD  + +++ +  +   G   GLCG      +D+  S+     D++A FGNS+     +   CP++ +       S    DD I   ++CS + L FP   C + ++ + +   CV ++C                +  C  L  Y+ +CS  G  + +WR S   C  +C  + +  DC S CP TC   F           +  C C  G +    TCI    CPC+Y G  +P G V +  C  C C   LW+CTE  C + C ++G T   TFDG +   +   CQYV V+   N        F +    T    G     + I+   +V         + +  S Q+  ++    + G      LP++  D+ ++VR+LT+++  ++     +  +D     IY+++      + +GLCG  +GN  +DF      I  +      ++   S   +P +I  +DP   +         C  +L    F  C   + V    Y   CR  Q+        C+A+ + A  C +  +   + F +++ + C  +C  GG ++  C+  C  TC+ +  ++A  CD DC  GC C    +Y     +CV  S+C C+       P    G     +   C+C NGR+ C  ++       CP  +VY           SG       +C N     TC   +     CGCP   V   +G C  P +CPC ++  EY P + +   C + +C    +N        C AVC  Y D HY T DG  + +   C   L+ + GD+      ++I   N  C  S   C K++ I +G      S  +   + +  +   Y+  +    ++T +   +  L VLWDR T V++   P ++G + GLCGN+D    N+    G M+  +A  F +S+             E++    +    C  +  R+ +A++ CG++   + +FA C   +  DV  +Y NCL D C CNRGGDCECLCTS+A +A +C   G+ V WR+  +CP  CE
Sbjct:   16 FLFRLFVLQEYCGCLNGGWCQDEGRCDC--AQFQGLGDRCQIIPNHGQDRDGICRSWGQHHFETFDGMYYYYPGSCSYILAKDCHSSEPQYTVWV-----HNSRSC-------RGSVYSCPRSLSLFFPNEEEIYISGYQVLKGGHRLSLPQTVRNVFIERLADYILVKSTFG-FSLAWDGGSGVYLKMTEAHK-GRPCGLCGNYNDDGSDDLSSSRGIVSDDIAEFGNSWAVDLPQERPCPEVDDDFPGPCSSESDMDDAI---EKCSAL-LFFPFISCHENIDPNPFVVSCVSDMCVSDDE-----------ETFCRTLVEYTRACSHVGYPVREWRDSFPTCADRCEDSFVHRDCISCCPPTC--TFDKECLGTNLHCLDGCYCPDGLILQNGTCIAVSQCPCVYHGTAYPLGHVLEQGCTVCVCMGGLWNCTENNCTAECTVVGDTHVTTFDG-RIYMHLGSCQYVLVKSRGNTK------FTVTLQYTAC--GESQEHSCIHSVALV---------VDEDVSRQVTLTRDGEVVIGASMAVNLPYS--DETVNVRRLTSLFVGLRSVFGLRFQYDWQGGRIYLQLDSTWMGSTLGLCGTLNGNLRDDFLSPAGMIEGTPQLHVNAWKVSSACISPVNIPIIDPCEMNQQNVFYAAQCDVLLE-EVFRPC--HAYVSPSMYHQQCRY-QACRCGSSCLCTALSHYAYICSKHHVT--INFRAHVSE-CGMVC-LGGMMYHPCTSACGRTCQSV--SSAEVCDGDCAEGCSCTEGTFYDHTRQRCVLLSQCHCYFMGSVFQP----GEVSFSSSGPCLCRNGRMECVPEEREPERGDCPNGKVYYSCRGQSGRGPSGVGLACELTCRNLMLNLTCPPMTPCVPGCGCPAGLVVH-NGECYYPENCPCAWLGLEYLPGETVDTPCYRCVCHRGFFNCTYYP---CPAVCTVYSDRHYHTFDGLEYDYVSDCQVNLVKSVGDTE-----VSIMAQNKDCYESGIVCMKYLLIYVGLTKIYFSDNSGKPSSSTVVGRGYEFQLWGAGYYTVVHFPAQDLTVLWDRKTTVHIRAGPQWKGQMSGLCGNFDMVTVNDMTTAGHMEVSNAQAFGDSWAVG--------QCESDFVVHRP---CEGDLSRQPYAKRECGLLY--SDIFAPCHNVV--DVTWFYKNCLTDTCNCNRGGDCECLCTSIAAYAHKCCQNGVTVNWRSPTVCPYDCE 1153          

HSP 2 Score: 131.724 bits (330), Expect = 5.043e-30
Identity = 111/396 (28.03%), Postives = 189/396 (47.73%), Query Frame = 3
Query: 3309 EAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVAN-IACGFSLATCAKFV--------QIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGT-MKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDM---CNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVK-WR-TQNLCPIMCEGGKHYDACASPCPQTC----DTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCT 4439
            + +C ++G  H++T DG  + + GSC Y L     D  ++ P  T+ V N  +C  S+ +C + +        +I I G   +L  G+  ++P   + ++ IE+L  +  LV  + G  + WD  + VYL +  + +G   GLCGNY+ D  ++      +  +D  +F  S+  +         P+    P  + D    C++  D     E+   ++      F SC E +  D N +  +C+ D C  +   D E  C +L  +   C+ +G PV+ WR +   C   CE    +  C S CP TC    + +G+N        HC++GC CP+G+I  NG C+  + CPC Y+G +Y  G +++ + C  C C+   +NCTE+  +C   CT
Sbjct:   64 DGICRSWGQHHFETFDGMYYYYPGSCSYILAK---DCHSSEPQYTVWVHNSRSCRGSVYSCPRSLSLFFPNEEEIYISGYQ-VLKGGHRLSLPQTVR-NVFIERLADYI-LVKSTFGFSLAWDGGSGVYLKMTEAHKGRPCGLCGNYNDDGSDDLSSSRGIVSDDIAEFGNSWAVDL--------PQERPCPEVDDDFPGPCSSESDMDDAIEKCSALLFFP---FISCHENI--DPNPFVVSCVSDMCVSD---DEETFCRTLVEYTRACSHVGYPVREWRDSFPTCADRCEDSFVHRDCISCCPPTCTFDKECLGTNL-------HCLDGCYCPDGLILQNGTCIAVSQCPCVYHGTAYPLGHVLE-QGCTVCVCMGGLWNCTEN--NCTAECT 427          

HSP 3 Score: 55.8398 bits (133), Expect = 7.093e-7
Identity = 30/70 (42.86%), Postives = 37/70 (52.86%), Query Frame = 3
Query: 4230 THCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCT 4439
            T CV GC CP G++  NGEC  P  CPC + G  Y+ G  +    C +C C +  FNCT  Y  C   CT
Sbjct:  830 TPCVPGCGCPAGLVVHNGECYYPENCPCAWLGLEYLPGETVDTP-CYRCVCHRGFFNCT--YYPCPAVCT 896          
BLAST of SCO-spondin vs. Ensembl Zebrafish
Match: vwf (von Willebrand factor [Source:ZFIN;Acc:ZDB-GENE-070103-1])

HSP 1 Score: 318.931 bits (816), Expect = 2.738e-87
Identity = 322/1284 (25.08%), Postives = 535/1284 (41.67%), Query Frame = 3
Query:  756 ENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVV-VKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLR----QDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVAS-----FGNSFKGFG----CPDIANTLSTCKPDDQILANQQ--CSKIR--LKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQ-WRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLY--FDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY-ITGSCDNTPQSIVDPPAGD-------NDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKD-QLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPV------------------CPKNQVYMDSVSG-------CNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIP-PITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGN-NDTIPLFPKYDI-VIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYE-DAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGK---------HYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCS--CPNGMI--DLNGECVPPTTCP-CFYNGQSYVNGA--IIKMENCKKCQ 4379
            E    C  +   +  TFD  +Y + G CSY+L    D    ++SI   + +     G  K + +  G++  +  S +G L       PL P +     S+ +  G  +  +R    +  F +      NI+L  +  ++               GLCGN +    +++S  +   +     F NS+   G    C  +     +C    +   +Q   C  +R  + F  CA LV+   + S+C  ++C  S             + +C  +  YS +C+ +G  +  W + + C  +CP    +SDC   C  +C+N+       C+   V  CIC +G+V  G  C+    C C + G+ +PP +    DCNTC C    W CT + CP  C + G + + TFD   F F+ + C Y+  +      D ++N F  +    E+    +   A        ++ +   D+  +    + G     V +DG D  T      P  N  +R    + + V++     L+  +DG   + +++  A    + GLCG ++GN  +DF      +   +     S+ +   CD+      DP + +        + C+ +L+  +F  C     V+ E Y   CR +  +  D Q   C A+ + A+AC   G+             C         V+++C   C  TCR L+    + CD  C  GC CP   + +  G+CV    C+C +     +P    G + +I    CVC +G ++C + +   + +                  CP      +  S          +C N +    +    + C CP  TV +    C+    CPC + +R Y     IT+ C   +C  R W   SE    C+ VC A GD HY + DG  FSF G C Y L     D  N +     + V N ACG +   C+K + ++  G   ++  G      P+  + ++ ++    ++  L+   I   + WD  TR+ L +   ++G V GLCGN+DG   N+ +  + + E DA  F  S         +++ P    A S     C+ +  +    EQ C V+  T+ +F  C   +  D   Y+  C  D C C   GDC C C ++A +A +CA  G+PV WR+ +LCP+ CE             Y+ CAS CP TC       P  C  + CVEGC   CP G +  ++  +CV P+ C  C ++GQ   +G   I+  E+ + CQ
Sbjct:   24 EGSARCSLFSRQHIHTFDGVIYEFPGDCSYMLAG--DCRQRSFSILGDFSH-----GKRKGVTVFLGEMFELHLSVDGTLSQGAERLPL-PYA-----SSSVFAGYELGYVRLWSEEFGFSIRIDPLHNIQLTLEKRHS-----------NQTCGLCGNYNYLAEDEYSAQEGFLTDDPYDFANSWAMKGADEPCKRVLPPSQSCNSTGESTKDQMSACESMRSSVLFMHCAHLVDPAAFVSVCESDVCHCSAGK----------ECVCQAMLEYSRACASRGITLSNWHTQSQCSPKCPVGMEYSDCTPTCSTSCQNV--NIQEVCKEECVDGCICPAGKVLDGDRCVDVSQCSCTHAGRRYPPASYISQDCNTCVCRHGSWECTNEGCPGECLVTGQSHYKTFDNKFFTFSGI-CHYLLAK------DCQSNSFSAV---IETAQCADDQDAICTR----SITLRFKDLANQTVHLKHGGV---VSVDGMDVQT------PLINGPLRIQNTVLSSVRLRYGHDLHLDWDGRGRVLLRLKPAYAGQMCGLCGNYNGNQGDDFLTVGGLVETRVEAFGNSWKMNADCDDVQMQNSDPCSLNPKRVRFAEEACAVLLSM-KFEPC--HYMVNPEPYVKNCRYDVCACADGQECLCDAVSSYAVACAARGVLVNWRSHGYCELTC-----PDAQVYEMCGSVCNQTCRSLS-LPDTGCDGVCEEGCFCPRGLFLSDAGECVPPQHCSCHHNGEIFEPNDMIGDHHSI----CVCESGSMHCTSNEATGSTLSDLFFDEQSPSRGRRSLSCPPPLQRFECESARDAGIECAKTCQNLELDCVSLGCVSGCMCPPGTV-RYRKDCIPQEQCPCYHNSRPYESGQSITVDCNTCVCEQRQWK-CSERV--CDGVCRAIGDTHYISFDGLKFSFPGPCQYVLAQ---DYCNGLDGTFRVLVENSACGIAGYRCSKSITVLYMGGLIVMEHGEVRMKRPVLKETEVEIVRSGLYYIVLLGKHIS--ITWDTGTRISLQISGQYRGKVCGLCGNFDGSQNNDLLSSSNQMEVDAADFGNS---------WKVRPSCADAVSV-VSQCSTDLVKLVTVEQSCRVL--TSAIFRDCNSVV--DPEPYWDICTQDTCSCPSVGDCACFCNTIAAYAHECAQKGLPVNWRSNDLCPLSCEDLNKESGVQCEWRYNTCASACPSTCQ---HPEPLSCPIS-CVEGCHAVCPPGHLLDEVLRKCVEPSQCQVCVHDGQRVSHGKQFILNHEDPRLCQ 1208          

HSP 2 Score: 181.8 bits (460), Expect = 3.714e-45
Identity = 148/490 (30.20%), Postives = 215/490 (43.88%), Query Frame = 3
Query: 2997 NCKTKDNCTNPVCPKNQVYMDSVSGCN-SCTNY---DTCTDTSSIANSCGCPNDTVSKIDG-TCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQII---IGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLR------VLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQ-FAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNR--YYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGM-IDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTED 4412
            N  T+  C+ P CP    Y D    C+ SC N    + C +     + C CP   V  +DG  CV  S C C +  R Y P   I+  C   +C +  W   +E    C   C+  G  HYKT D + F+F G C Y L     D  +N     I  A  A     A C + + +    +  QT  L  G   ++        +I         V  S+ LR      + WD   RV L LKP++ G + GLCGNY+G+  ++++      E  ++ F  S+  NAD    ++         +  D C+ NP R  +AE+ C V+           E  H  VN   Y  NC YD C C  G   ECLC +++++A  CA  G+ V WR+   C + C   + Y+ C S C QTC ++  + P       C EGC CP G+ +   GECVPP  C C +NG+ +    +I  ++   C C     +CT +
Sbjct:  277 NWHTQSQCS-PKCPVGMEYSDCTPTCSTSCQNVNIQEVCKE--ECVDGCICPAGKV--LDGDRCVDVSQCSCTHAGRRYPPASYISQDCNTCVCRHGSWECTNE---GCPGECLVTGQSHYKTFDNKFFTFSGICHYLLAK---DCQSNSFSAVIETAQCA-DDQDAICTRSITLRFKDLANQTVHLKHGGVVSVDGMDVQTPLINGPLRIQNTVLSSVRLRYGHDLHLDWDGRGRVLLRLKPAYAGQMCGLCGNYNGNQGDDFLTVGGLVETRVEAFGNSWKMNADCDDVQM---------QNSDPCSLNPKRVRFAEEACAVLLSMK------FEPCHYMVNPEPYVKNCRYDVCACADGQ--ECLCDAVSSYAVACAARGVLVNWRSHGYCELTCPDAQVYEMCGSVCNQTCRSL--SLPDTGCDGVCEEGCFCPRGLFLSDAGECVPPQHCSCHHNGEIFEPNDMIG-DHHSICVCESGSMHCTSN 734          

HSP 3 Score: 113.62 bits (283), Expect = 1.782e-24
Identity = 131/495 (26.46%), Postives = 193/495 (38.99%), Query Frame = 3
Query: 1617 DCASECPVTCRNL-FQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIIL-----KATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY-ITGSCDNTPQSIVDPPAGDNDICST------ILNGPEFSGCMNSSKVDKEFYATYCRREQ---SSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNIL--QACIPLCQAGGT----VFQICSRTCQSTCRELNEATASKCDDDCFPGCE--CPPNYYKTGT-GQCVSESEC-TCWNPSRPKDPEIPAGTNITIN------CQTCVCINGRLNC 3002
            D   EC  TC+NL     S  C    V  C+C  G V Y   CI  E CPC ++ + +  G     DCNTC C    W C+E++C   C  +G T + +FDG KF+F    CQYV  +   N  D    V V       S  G  G        K +TV   G  I++     +   P L +++  +   G                       +Y  V +  H  + +D    I +++S   +  + GLCG FDG+  ND     N +     +   S+ +  SC +   S+V   + D     T      +L    F  C  +S VD E Y   C ++     S  D   +C+ I   A  C + G+   V + SN L   +C  L +  G      +  C+  C STC+     +   C   C  GC   CPP +       +CV  S+C  C +  +     +  G    +N      CQ C C +  L C
Sbjct:  774 DAGIECAKTCQNLELDCVSLGC----VSGCMCPPGTVRYRKDCIPQEQCPCYHNSRPYESGQSITVDCNTCVCEQRQWKCSERVCDGVCRAIGDTHYISFDGLKFSFPG-PCQYVLAQDYCNGLDGTFRVLV-----ENSACGIAGYRC----SKSITVLYMGGLIVMEHGEVRMKRPVLKETEVEIVRSG-----------------------LYYIVLLGKHISITWDTGTRISLQISGQYRGKVCGLCGNFDGSQNNDLLSSSNQMEVDAADFGNSWKVRPSCADA-VSVVSQCSTDLVKLVTVEQSCRVLTSAIFRDC--NSVVDPEPYWDICTQDTCSCPSVGDCACFCNTIAAYAHECAQKGL--PVNWRSNDLCPLSCEDLNKESGVQCEWRYNTCASACPSTCQHPEPLS---CPISCVEGCHAVCPPGHLLDEVLRKCVEPSQCQVCVHDGQ----RVSHGKQFILNHEDPRLCQICHCESNTLTC 1219          

HSP 4 Score: 98.9821 bits (245), Expect = 4.523e-20
Identity = 112/427 (26.23%), Postives = 168/427 (39.34%), Query Frame = 3
Query: 3264 SNRMW----NLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYL-------LSRGNNDTIPL-FPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEY-MHGTMKYEDAIQFAESF-IANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVK-WRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTED--YSDCITTCTPSQFRCDDGKCIESSKIC 4493
            S  MW    NL         A C  +   H  T DG ++ F G C Y L    GD             +I   FS     K V + +G    L       LS+G  + +PL +    +       + +L S+  G  +  D    + L L+        GLCGNY+   ++EY        +D   FA S+ +  AD       P   V P  +   CN+  +        C  M+ ++ +F  C   +  D   + S C  D C C+ G   EC+C ++  ++  CA  GI +  W TQ+ C   C  G  Y  C   C  +C  +  N    C    CV+GC CP G +     CV  + C C + G+ Y   + I  ++C  C C    + CT +    +C+ T   S ++  D K    S IC
Sbjct:    7 SRIMWIVILNLSDLLLVEGSARCSLFSRQHIHTFDGVIYEFPGDCSYMLA---GDCRQR-------SFSILGDFSHGK-RKGVTVFLGEMFELHLSVDGTLSQGA-ERLPLPYASSSVFAGYELGYVRLWSEEFGFSIRIDPLHNIQLTLEKRHSNQTCGLCGNYNYLAEDEYSAQEGFLTDDPYDFANSWAMKGAD------EPCKRVLPPSQS--CNSTGESTKDQMSACESMR-SSVLFMHCAHLV--DPAAFVSVCESDVCHCSAGK--ECVCQAMLEYSRACASRGITLSNWHTQSQCSPKCPVGMEYSDCTPTCSTSCQNV--NIQEVCK-EECVDGCICPAGKVLDGDRCVDVSQCSCTHAGRRYPPASYIS-QDCNTCVCRHGSWECTNEGCPGECLVT-GQSHYKTFDNKFFTFSGIC 403          

HSP 5 Score: 74.3294 bits (181), Expect = 1.407e-12
Identity = 106/408 (25.98%), Postives = 166/408 (40.69%), Query Frame = 3
Query:  768 TCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCT---SDTGCVKVI-VIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCG-----XXXXXXXXXXXXXXXVASFGNSFKGF-GCPDIANTLSTCKPD--DQILANQQCSKIRLK-FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDV--LCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPG-NK--------IWSDCASECPVTCRNLFQTPSAY-CQNSKVGRC--ICGSGEV--EYGYTCIKPESCP-CLYDGQEHPPGTVRQFD--------CNTCTCNSSLWHCTEKICPST 1877
             C + G  +Y +FD   +++ G C Y+L A    + +  +  ++ EN     +   C K I V+  G ++V   G           P             ++  T + ++R   + ++ L   +I + WD    I + I      G V GLCG       ++  S+      + A FGNS+K    C D  + +S C  D    +   Q C  +    F  C  +V+ + Y+ +C Q+ C+           PS+ D    C  ++AY+  C+ KG  + WRS+ LC   C   NK         ++ CAS CP TC    Q P    C  S V  C  +C  G +  E    C++P  C  C++DGQ    G  +QF         C  C C S+   C    CP T
Sbjct:  857 VCRAIGDTHYISFDGLKFSFPGPCQYVL-AQDYCNGLDGTFRVLVENSACGIAGYRCSKSITVLYMGGLIVMEHGE-----VRMKRP-------------VLKETEVEIVRSGLYYIVLL-GKHISITWDTGTRISLQISGQYR-GKVCGLCGNFDGSQNNDLLSSSNQMEVDAADFGNSWKVRPSCADAVSVVSQCSTDLVKLVTVEQSCRVLTSAIFRDCNSVVDPEPYWDICTQDTCS----------CPSVGDCACFCNTIAAYAHECAQKGLPVNWRSNDLCPLSCEDLNKESGVQCEWRYNTCASACPSTC----QHPEPLSCPISCVEGCHAVCPPGHLLDEVLRKCVEPSQCQVCVHDGQRVSHG--KQFILNHEDPRLCQICHCESNTLTCGP--CPVT 1225          

HSP 6 Score: 65.4698 bits (158), Expect = 7.587e-10
Identity = 87/388 (22.42%), Postives = 143/388 (36.86%), Query Frame = 3
Query: 3297 TANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWD-RSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTC--------DTIGSNA----PSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCP--CFYNGQSYVNGAIIKMEN--CKKCQCV-QAKFNCT 4406
            T  C   C+     H  +  G     + +C Y L+ + G           S  N  C  SL        +++     +   G    +P   +   V +  +   QL S+  G  + +   S    L +  + + N  GLCG+   D     +       D   + +++   ++   ++           E  +C A        E+ C V+  ++ VF+ C   +   V  Y   C   AC  N       LC  +  ++T C   G+ V WRT +LCP+ C     Y AC S C + C        D +G        S C  T   EGC CP G + +  +CV    C     ++G+++        E+  C  C C+ Q + NCT
Sbjct: 1944 TWTCPCSCMGSSTSHVVSFSGAALKVKSACSYLLLRSGGAELVLHTTACQSSPNQICMKSLELREGGTSVVLQDDMKVTVGGVLTAVPFRTERVTVTQIGSILHQLRSEQHGFTLTFTPHSNEFMLNMDIAMKPNTTGLCGSCSDDQSGLLLSDGSVTTDPDVYLQAWALGSECVQHQ-----------EIQLCPAG------LEKACDVL--SSEVFSHCHALV--PVQDYIQICRSVACQPNA------LCDLVTAYSTVCRQQGVCVDWRTSSLCPMSCSDSMEYAACRSGCLEQCGQSQFTPGDMMGDGLLKANGSVCLNTP-TEGCFCPEGSVLMEDKCVDREACSQCVEHSGKTHQFMESWNPEDNPCVLCVCLDQQRINCT 2303          
BLAST of SCO-spondin vs. Ensembl Xenopus
Match: ENSXETT00000006505.1 (SCO-spondin [Source:NCBI gene;Acc:100497129])

HSP 1 Score: 571.622 bits (1472), Expect = 1.563e-168
Identity = 460/1529 (30.09%), Postives = 702/1529 (45.91%), Query Frame = 3
Query:  648 VSYDECCADKTG-SWGS-QSGSCVSCK-----------ANFAGGNDVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXX-----XXXXXXXXXXVASFGNSFKGFGCPDIANTLSTCKPDDQIL-----ANQQCSKIR--LKFPGCADL------VNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY-ITGSCDNTPQSIVDPPAGDNDICSTILNGPEFS----------GCMNSSKVDKEFYATYCRREQ---SSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDD--DCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDS--VSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTI--------PLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDV--NRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCD-DGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISC---GCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSD-EENCKKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECICKE---PEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNC 5030
            +S +ECC+   G SW +  S  C SC                G +      F+TC ++G  ++RTFD + + + G C+Y L +  D    TW++ I  E C   T  V + +        + S NG+           P  V +  + + I       L   +F+ +    G +++K+D  NN+++++      G   GLCG  + +          +   + A F NS++         T S C+    +L      + +C+  R  L  P    L      V+   Y+  C+   C  S  ++        +  +C   ++Y+  C+ +   I WR    CE +CP  K +SDC S CP +C  +       C++  V  C C +G       C+K E CPC +  Q + PG   +  CN C C    WHCT+  C + C ++G   + TFD  +++F+   C Y+ V+  V+         +I   N     G++G+ + +   + +TV  + + I L         ++ +  ++G + T  LPF  PD  + VR +++ +  ++    + L+     + +I +     N + GLCG F+ N  +DFT  +  I  S  + A  + ++  C +      DP       C T     EF+           C +   V+ E +   C  +    + NK+ L  CSA+   A  C + G        S   Q   P+   GG ++  C+  C+ TC +L  A    C +   C  GC CP       +GQCV  + C C + +    P    G+ I  NC++CVC NG  NC          CP N VY     +  C+S     TC+DT    + C CP  T   +  +CV P DCPC +  + Y PND I   C   +C NR W+        C  VC A GDPHY T DG+ F+F G C Y L      +  N    T++  N+ CG S  TC K V ++IG     + RG   TI         ++    I +E+   FT  +S  +GL VLWD  TRVY+ L P+F+G V GLCGN+DGD +N++       E       +    + +CP E++ ++   P      C  N  R +WA + CGV+  +  +FA+C    HQ+V   +YY  C+YD CGC+ GGDCECLCT++AT+A QC   G+ ++WRTQ+LCP+ C+ G  Y+AC   CPQTC  +G     HC++  CVEGC CP G +   G C+ P+ CPC++ G  +  GA IK   CK C C   K+ C  +     + C  ++F C    +C+ ++ +CD   DC +  DE     C   + +C +NG C+P+  +CDG  +C D+SDE SC    C  ++  C+  R CI    +CDG  DCG  D SD      +C  T ++C+  + C+   + CDG DDCGD SDE GC C   E   P+ +                CI   K CDG  DC  G DE  C
Sbjct:  134 MSMEECCSHPWGHSWKNITSDFCFSCSYVSPTGEPYFSTALVGVSPQQRRLFSTCVTWGGFHFRTFDGKHFHFHGTCTYTLASSLDS---TWAVYISEELCPQPTLEVTLGLERVTVRRREVSVNGVT---------VPEGVPHLQNGINI-------LWLGDFLFIESGLG-VRVKFDGRNNVYVTVTLDQR-GRTRGLCGVYNEDPQDDFTEVGGNVSPHAAGFANSWRIQDSNTQVRTNSFCQFHFSMLIYHFMPSSRCATPRAHLAKPTICFLCLFSSQVDPSGYYETCMYTYCQHSGGASDR------AGAVCETFTSYARECAQQKIIIDWRRAGFCEKKCPNGKEYSDCMSSCPASCAAVGSYEDGQCRDECVSGCECPAGLYLEQGVCVKEEECPCFHRRQRYSPGDTIKQRCNQCVCRGGRWHCTQDKCAAQCSVVGDPHYVTFDRKRYSFHGT-CDYILVQDYVDGK------LLITAENV--ACGSKGSVSCL---RAITVTAHKTSIRLS--------TKGDYTVNGREVT--LPFLSPD--LSVRWVSSSFLLLQTFGAYVLWSLEFPAAHITLQPVFSNKVRGLCGTFNWNQNDDFTTPEGDIETSSFSFANKFKVSAECPDVGPFTFDP-------CGTYAQRREFAEEACAVILSPACHD--LVEWEPFHQLCLYDVCGCAPNKNCL--CSAVSAYARQCAQEGA-----IMSWRNQTFCPVQCTGGQMYMECTPPCRKTCADLRMAGTGSCQELEGCVAGCNCPEGLVLDESGQCVPPNMCQCHHGAETHQP----GSKIQQNCKSCVCENGVWNCTGSSCPEAAYCPGNMVYSPGSCLLTCDSLERNGTCSDT---LDGCVCPEGTA--LLDSCVLPEDCPCHHHGKLYHPNDTIVKDCNTCVCKNRHWSCTD---LQCSGVCTATGDPHYVTFDGRSFTFLGDCQYVL------ARENGGLFTVTAENVPCGTSGITCTKSVVVMIGNMIVHMLRGKEVTINGISVRPPKIYSGNGITLERAGLFTMFISQ-MGLTVLWDGGTRVYVKLDPAFRGRVSGLCGNFDGDTENDFTSRQGIVEPTADLFGNSWRMSLMCP-EVNADDFEHP------CTENSHRVTWARKKCGVLLQS--LFAAC----HQEVPCQQYYDWCVYDTCGCDSGGDCECLCTAIATYAEQCNQRGVYIRWRTQDLCPMQCDNGMVYEACGPACPQTCKNLGLAPDPHCNSLSCVEGCFCPAGKVLHEGRCLDPSDCPCYWGGMPFPTGAAIK-HGCKNCTCEAGKWQCPTEPCSSPSHCADNEFACHLSERCVPNAWVCDNEDDCGDGSDEICLLTCAPHEHRC-ANGQCVPLAHRCDGKADCVDHSDEWSCPAPSCGSNEFRCSNGR-CIPIAHVCDGELDCGFGDDSDESNCSSECSSTHFRCSRGR-CVPYIHHCDGHDDCGDFSDERGCYCDVGEFQCPDGL----------------CIPREKLCDGEKDCPRGTDELLC 1543          

HSP 2 Score: 54.299 bits (129), Expect = 2.929e-6
Identity = 36/102 (35.29%), Postives = 52/102 (50.98%), Query Frame = 3
Query: 4434 CTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNC-----------NVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCG-CL--PHQIVCNISRTC 4697
            C+  QF C    C++SS +CD   DC +  DE +C           ++C  +QF C S G C+ M ++CD  ++C D SDE  C  C+  P     + SRTC
Sbjct: 2277 CSVGQFACSTFGCVDSSFVCDGQEDCIDGSDEYHCGRFITFLPESASLCSARQFACAS-GECLAMERRCDLHRDCADGSDEDKCADCILSPWTFWSDCSRTC 2377          

HSP 3 Score: 53.1434 bits (126), Expect = 6.029e-6
Identity = 45/163 (27.61%), Postives = 65/163 (39.88%), Query Frame = 3
Query: 4443 SQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQN------------------------------------------CEDNSDEISCGC------LPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMT 4787
            + FRC  G+C+     CD   DC +  DE+ C  CD+ +FQC  +G CIP  K CDG ++                                          C D SDE+   C       P   +C I+R C+    +CDG  DC   +  DE +C++  +T
Sbjct: 1476 THFRCSRGRCVPYIHHCDGHDDCGDFSDERGC-YCDVGEFQC-PDGLCIPREKLCDGEKDCPRGTDELLCTGNIGIRAYWVFGYSWTSLLSILLHLCDGEPDCGDGSDELQAQCSTQIPPCPGHFIC-INRMCVNISLLCDGAPDCPQGE--DEVSCERSPVT 1633          
BLAST of SCO-spondin vs. Ensembl Xenopus
Match: ndufs8 (NADH:ubiquinone oxidoreductase core subunit S8 [Source:Xenbase;Acc:XB-GENE-945877])

HSP 1 Score: 370.163 bits (949), Expect = 3.134e-103
Identity = 339/1300 (26.08%), Postives = 552/1300 (42.46%), Query Frame = 3
Query:  762 FTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVAS-----FGNSFKGFGC---------PDIANTLSTCKPDDQILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQ-WRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVS--SHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY-ITGSCDNTPQSIVDP-------PAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQ-SSNKDQLSYCSAILNAAIACRRFG--IQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKD--------NCTNP----VCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETAN-CEAVCIAYGDPHYKTLDGQMFSFQGSCMYTL-MDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIII-GGQTYLLSRGNNDTIPLFPKYDI-VIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYE-DAIQFAESFIANADICPY-EISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGK----------HYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCS--CPNGMI--DLNGECVPPTTCP-CFYNGQSYVNGAIIKM-----ENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCD 4460
               C  +G ++ +TFD   Y + G CSY+L    D +  ++S+   Y N    +  V + + E  D+ +   G         + P     +     A    G      ++  F++    +GN+++           +  S +     GLCGN +    +DF   + + +     F NS+   G          P     +S+   +   +   Q  K    F  C  LV+ D Y ++C  ++C  ++  N            C     Y+ +C+  G     W + T+C+  CP    +++C S C  TC++L    +  CQ   +  C C  G+V  G  CI    C C++ G+ +PPG+  + DCN+CTC +  W C+ + CP  C + G + F +FD   F F+ + CQY+    ++++T     +  +  ++    + T   S  + +   +T+K+                    V +DG+D        +P     +R  T + + V+++     ++ +DG   + IK+S      + GLCG ++GN  +DF      I  S+ +   S+ + G C +  +   DP            ++C  +++   F  C N  +V+   Y   CR +  S +  +   CSA+   A AC R G  I +  P      + C P+  + G ++Q C   C  TCR L+      C + C  GC CPP  Y    G+CV +S+C+C+       P+     + ++    C C NG ++C T D        +C  P    +CP +      +    +C NY+    +    + C CP D + +    C+ P  CPC +  +EYAP   + I C   +C NR W      T N C+A C A G  HY T DG  + F G C Y L  D  G  +       I V N  CGFS   C K + I+   G+  L +   +   PL  +    V++   +F  L+ +   + V WD+  RVY+ LK +++  V GLCGN+DG   N+ +    + E D + F  S+  N     +  +SP           +C  N  ++  AE  C ++     +FA C + ++ +   Y+  C YD C C   GDC C C SLA +A  CA  GI V WR+ +LCP  CE              Y++C + CP TC       P +C    CVEGC   CP G I  +++  C+ P  CP C   G +  +G  I +     + C+ C C      C       ITT  P+    D
Sbjct:   27 LARCSLFGENHIQTFDGTFYDFYGDCSYMLAG--DCNKHSFSLLADYRNGKKKS--VSLYLGEYFDIHLFLDGTATQGEKHISMPYASNGIFLESEA----GYYKLSSQEHGFMVKIDASGNVQV-----------VLPSKHFNKTCGLCGNYNQFAEDDFMMQEGILTENSYDFANSWALHGGARRCRRTYPPSNTCNISSETAEKDFMQRCQMLKTSSAFMQCHHLVDPDPYIAICEDDMCECAEELNCP----------CQTFLEYARTCAQHGVITSNWPTHTICKPLCPFGMEYNECVSPCVKTCQSL--NINEVCQEQCIDGCSCPDGKVLDGDRCIPVFECSCIHSGKRYPPGSAIRRDCNSCTCQNGAWECSNEDCPGECFVTGQSHFKSFDNKHFTFSGI-CQYLLATDAMDSTFS-VTIETVQCADDIDAVCTRSASLRLLDMHNITIKLKHGG---------------GVSLDGQD------ILLPLVQGFLRIQTTVLSAVRLTYKEDLQVDWDGHGKLLIKLSPIYSGLISGLCGNYNGNQGDDFLTPSGLIETSVEDFGNSWKLNGDCTDLMKQDTDPCNLNPKRARFSEEVCFALMDS-AFQSCHN--EVNPAPYLKNCRYDVCSCSNGKECLCSALSTYAAACSRKGILIDWRTP------EFC-PIQCSEGKIYQQCGSPCNQTCRSLSHPDVD-CREFCMEGCYCPPGLYTNEDGECVPKSDCSCYYDGELFQPDDVFSNHYSM----CYCENGLMHCSTSDVPSVKRSLDCRPPLNKIICPADNPKATGIECAKTCQNYELECVSHGCISGCTCP-DGMVRHKSKCMFPQRCPCFHAGKEYAPGSSVEIDCNTCVCENRKWKC----TENICDATCSAIGVSHYLTFDGFRYKFPGDCQYVLAQDYCGGVTGT---FRILVGNEGCGFSGEKCTKRITILFRNGEIELTNEQIHIKKPLSDETSFDVLKSGNYFILLLGNQ--MSVTWDKGMRVYVTLKETYRDKVCGLCGNFDGIENNDLISSNNQIEMDPVNFGNSWKVNPLCADFGAVSP---------LSLCKDNLMKQMAAENACNIL--MGDLFAECAKVVNPE--PYWEICTYDTCTCESAGDCACFCDSLAAYAHVCAQRGINVHWRSSHLCPQSCEEKNQRDLDYVCEWRYNSCTTACPVTCQ---HPEPVNCP-LKCVEGCQAYCPPGKILDEVSESCIEPKDCPVCTIEGHTVPHGRKIILNHDDPQRCQLCHCEGKNLQCNACEISVITTVAPTTLPVD 1230          

HSP 2 Score: 115.161 bits (287), Expect = 8.023e-25
Identity = 110/403 (27.30%), Postives = 167/403 (41.44%), Query Frame = 3
Query: 3312 AVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVAN-IACGFSLATCAKF-VQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEY-MHGTMKYEDAIQFAESFIAN--ADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLG-IPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTC---TPSQFRCDDGKCIESSKIC 4493
            A C  +G+ H +T DG  + F G C Y L    GD + +   +     N      SL     F + + + G     ++G       +    I +E    + +L S   G  V  D S  V + L         GLCGNY+   ++++ M   +  E++  FA S+  +  A  C     P N    S E     A  D      Q C ++K T+  F  C   +  D + Y + C  D C C    +  C C +   +A  CA  G I   W T  +C  +C  G  Y+ C SPC +TC ++  N         C++GCSCP+G +     C+P   C C ++G+ Y  G+ I+  +C  C C    + C+ +  DC   C     S F+  D K    S IC
Sbjct:   28 ARCSLFGENHIQTFDGTFYDFYGDCSYMLA---GDCNKHSFSLLADYRNGKKKSVSLYLGEYFDIHLFLDGTA---TQGEKHISMPYASNGIFLESEAGYYKLSSQEHGFMVKIDASGNVQVVLPSKHFNKTCGLCGNYNQFAEDDFMMQEGILTENSYDFANSWALHGGARRCRRTYPPSNTCNISSE----TAEKDFM----QRCQMLK-TSSAFMQCHHLV--DPDPYIAICEDDMCEC--AEELNCPCQTFLEYARTCAQHGVITSNWPTHTICKPLCPFGMEYNECVSPCVKTCQSLNIN---EVCQEQCIDGCSCPDGKVLDGDRCIPVFECSCIHSGKRYPPGSAIR-RDCNSCTCQNGAWECSNE--DCPGECFVTGQSHFKSFDNKHFTFSGIC 405          

HSP 3 Score: 70.8626 bits (172), Expect = 2.377e-11
Identity = 92/376 (24.47%), Postives = 144/376 (38.30%), Query Frame = 3
Query: 3243 KCAKYICSNRMWNLLSEETANCEA----VCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFS-LATCAKFVQIIIGGQTYLLSRG-----NNDTIPLFPKYDIVIEQLTFFTQLVSD----SIGLRVLWDRSTRVYLF-LKPS-FQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRK--SWAEQMCGVMKDTNGVFASCIEAMHQDV--NRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTC-DTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTC 4307
            K  K +C N +  +  EET  C      +C+     H  T DG  F   G+C Y L        + +  + + + N  C  +   TC K V++     + LLS       N D +PL    D    ++T + ++V +     +G    +  +   ++  L P+ F     GLCG  D +  N++   T+        +  FI            E  V  S  +  C   PD+         C +M       +   EA H       Y++ C   +C    G D   +C  +A +   C   G+ + WRT + CP+ C     Y  C   C + C  T+     S  ST    EGC CP G + +NG+CV    C
Sbjct: 1926 KIPKPMCHNNLPAMKIEETCGCRWTCPCMCMGSSTRHIVTFDGLDFKLMGACSYVLF------HDEVHDVKVILHNAECNTTNHQTCMKSVEVKHNKYSILLSSNMQVSVNGDIVPLPYANDNF--EVTLYGEIVHEVKIPQLGFVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTVNDF---TLSDGSVTTDSSKFIK-----------EWTVVDSLGR-TCETKPDKACTQPISSECKIM------LSKTFEACHTIFPPKPYFTVCEEASC---HGQD---ICEVIAAYVHVCRINGVCINWRTPDFCPMECPRLMVYHHCHMGCNKECGKTLNGTLCSDSST----EGCFCPEGDVIVNGKCVNEKVC 2262          

HSP 4 Score: 53.1434 bits (126), Expect = 6.246e-6
Identity = 87/389 (22.37%), Postives = 141/389 (36.25%), Query Frame = 3
Query:  771 CHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLR--QDNFILLSLEAGN-IKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVASFGNS--FKGFGCPDIANTLSTCKPDD---QILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYD--GQEH---PPGTVRQFDCNTCTC-NSSLWHCTEKICPS----TCG 1883
            C      +  TFD   +   G CSY+L    +V  V   ++    N T+   C+K + ++     +  S N        N  + PL   N +  + + G  ++ ++  Q  F+     A N   L+ +                  +GLCG  D N  NDF+  D   +  +S   K +   D        KPD    Q ++++    +   F  C  +     YF++C +  C                  +C  ++AY   C   G CI WR+   C  +CP   ++  C   C   C          C +S    C C  G+V     C+  + C    D  G+EH            C+ C C  + + +CT   CP+    TCG
Sbjct: 1955 CMGSSTRHIVTFDGLDFKLMGACSYVLFH-DEVHDVKVILHNAECNTTNHQTCMKSVEVKHNKYSILLSSN---MQVSVNGDIVPLPYANDNFEVTLYGEIVHEVKIPQLGFVFTFTPANNEFVLQLNPAAFSLR----------TSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWTVVDSLGRTCETKPDKACTQPISSECKIMLSKTFEACHTIFPPKPYFTVCEEASCHGQD--------------ICEVIAAYVHVCRINGVCINWRTPDFCPMECPRLMVYHHCHMGCNKECGKTLN--GTLCSDSSTEGCFCPEGDVIVNGKCVNEKVCSQCTDRYGEEHQLLETWIPTNAPCSICMCLENRMINCTAMPCPTVKPLTCG 2313          
BLAST of SCO-spondin vs. Ensembl Xenopus
Match: ndufs8 (NADH:ubiquinone oxidoreductase core subunit S8 [Source:Xenbase;Acc:XB-GENE-945877])

HSP 1 Score: 368.237 bits (944), Expect = 1.619e-102
Identity = 338/1311 (25.78%), Postives = 553/1311 (42.18%), Query Frame = 3
Query:  762 FTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVAS-----FGNSFKGFG----CPDIANTLSTCKPDDQILANQQCSKIRLK--FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQ-WRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVS--SHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY-ITGSCDNTPQSIVDP-------PAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQ-SSNKDQLSYCSAILNAAIACRRFG--IQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCT---------------------------NPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETAN-CEAVCIAYGDPHYKTLDGQMFSFQGSCMYTL-MDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIII-GGQTYLLSRGNNDTIPLFPKYDI-VIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYE-DAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGK----------HYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCS--CPNGMI--DLNGECVPPTTCP-CFYNGQSYVNGAIIKM-----ENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCD 4460
               C  +G ++ +TFD   Y + G CSY+L    +      S +++ +        V + + E  D+ +   G         + P     +     A    G      ++  F++    +GN+++           +  S +     GLCGN +    +DF   + + +     F NS+   G    C       +TC    +    Q+C  ++    F  C  LV+ D Y ++C  ++C  ++  N            C     Y+ +C+  G     W + T+C+  CP    +++C S C  TC++L    +  CQ   +  C C  G+V  G  CI    C C++ G+ +PPG+  + DCN+CTC +  W C+ + CP  C + G + F +FD   F F+ + CQY+    ++++T     +  +  ++    + T   S  + +   +T+K+                    V +DG+D        +P     +R  T + + V+++     ++ +DG   + IK+S      + GLCG ++GN  +DF      I  S+ +   S+ + G C +  +   DP            ++C  +++   F  C N  +V+   Y   CR +  S +  +   CSA+   A AC R G  I +  P      + C P+  + G ++Q C   C  TCR L+      C + C  GC CPP  Y    G+CV +S+C+C+      D E+    ++  N  +  C NG ++C T D+C                              +CP +      +    +C NY+    +    + C CP D + +    C+ P  CPC +  +EYAP   + I C   +C NR W      T N C+A C A G  HY T DG  + F G C Y L  D  G  +       I V N  CGFS   C K + I+   G+  L +   +   PL  +    V++   +F  L+ +   + V WD+  RVY+ LK +++  V GLCGN+DG   N+ +    + E D + F  S+  N  +C   +SP +         +C  N  ++  AE  C ++     +FA C + ++ +   Y+  C YD C C   GDC C C SLA +A  CA  GI V WR+ +LCP  CE              Y++C + CP TC       P +C    CVEGC   CP G I  +++  C+ P  CP C   G +  +G  I +     + C+ C C      C       ITT  P+    D
Sbjct:   23 LARCSLFGENHIQTFDGTFYDFYGDCSYMLAGDCN----KHSFSLLGKVVNGKKKSVSLYLGEYFDIHLFLDGTATQGEKHISMPYASNGIFLESEA----GYYKLSSQEHGFMVKIDASGNVQV-----------VLPSKHFNKTCGLCGNYNQFAEDDFMMQEGILTENSYDFANSWALHGGARRCRRTYPPSNTCNISSETDFMQRCQMLKTSSAFMQCHHLVDPDPYIAICEDDMCECAEELNCP----------CQTFLEYARTCAQHGVITSNWPTHTICKPLCPFGMEYNECVSPCVKTCQSL--NINEVCQEQCIDGCSCPDGKVLDGDRCIPVFECSCIHSGKRYPPGSAIRRDCNSCTCQNGAWECSNEDCPGECFVTGQSHFKSFDNKHFTFSGI-CQYLLATDAMDSTFS-VTIETVQCADDIDAVCTRSASLRLLDMHNITIKLKHGG---------------GVSLDGQD------ILLPLVQGFLRIQTTVLSAVRLTYKEDLQVDWDGHGKLLIKLSPIYSGLISGLCGNYNGNQGDDFLTPSGLIETSVEDFGNSWKLNGDCTDLMKQDTDPCNLNPKRARFSEEVCFALMDS-AFQSCHN--EVNPAPYLKNCRYDVCSCSNGKECLCSALSTYAAACSRKGILIDWRTP------EFC-PIQCSEGKIYQQCGSPCNQTCRSLSHPDVD-CREFCMEGCYCPPGLYTNEDGECVPKSDCSCY-----YDGELFQPDDVFSNHYSIYCENGLMHCSTSDSCVLSIVLSYMYIFAFNTVKRSLDCRPPLNKIICPADNPKATGIECAKTCQNYELECVSHGCISGCTCP-DGMVRHKSKCMFPQRCPCFHAGKEYAPGSSVEIDCNTCVCENRKWKC----TENICDATCSAIGVSHYLTFDGFRYKFPGDCQYVLAQDYCGGVTGT---FRILVGNEGCGFSGEKCTKRITILFRNGEIELTNEQIHIKKPLSDETSFDVLKSGNYFILLLGNQ--MSVTWDKGMRVYVTLKETYRDKVCGLCGNFDGIENNDLISSNNQIEMDPVNFGNSWKVNP-LCFGAVSPLS---------LCKDNLMKQMAAENACNIL--MGDLFAECAKVVNPE--PYWEICTYDTCTCESAGDCACFCDSLAAYAHVCAQRGINVHWRSSHLCPQSCEEKNQRDLDYVCEWRYNSCTTACPVTCQ---HPEPVNCP-LKCVEGCQAYCPPGKILDEVSESCIEPKDCPVCTIEGHTVPHGRKIILNHDDPQRCQLCHCEGKNLQCNACEISVITTVAPTTLPVD 1235          

HSP 2 Score: 122.479 bits (306), Expect = 5.459e-27
Identity = 113/421 (26.84%), Postives = 176/421 (41.81%), Query Frame = 3
Query: 3270 RMWNLLSEETANCE----AVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVAN-IACGFSLATCAKF-VQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEY-MHGTMKYEDAIQFAESFIAN--ADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLG-IPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTC---TPSQFRCDDGKCIESSKIC 4493
            ++W L+++ T   +    A C  +G+ H +T DG  + F G C Y L    GD + +   +   V N      SL     F + + + G     ++G       +    I +E    + +L S   G  V  D S  V + L         GLCGNY+   ++++ M   +  E++  FA S+  +  A  C     P N    S E D             Q C ++K T+  F  C   +  D + Y + C  D C C    +  C C +   +A  CA  G I   W T  +C  +C  G  Y+ C SPC +TC ++  N         C++GCSCP+G +     C+P   C C ++G+ Y  G+ I+  +C  C C    + C+ +  DC   C     S F+  D K    S IC
Sbjct:    6 QIWMLVAQITGKLDWSVLARCSLFGENHIQTFDGTFYDFYGDCSYMLA---GDCNKHSFSLLGKVVNGKKKSVSLYLGEYFDIHLFLDGTA---TQGEKHISMPYASNGIFLESEAGYYKLSSQEHGFMVKIDASGNVQVVLPSKHFNKTCGLCGNYNQFAEDDFMMQEGILTENSYDFANSWALHGGARRCRRTYPPSNTCNISSETDF-----------MQRCQMLK-TSSAFMQCHHLV--DPDPYIAICEDDMCEC--AEELNCPCQTFLEYARTCAQHGVITSNWPTHTICKPLCPFGMEYNECVSPCVKTCQSLNIN---EVCQEQCIDGCSCPDGKVLDGDRCIPVFECSCIHSGKRYPPGSAIR-RDCNSCTCQNGAWECSNE--DCPGECFVTGQSHFKSFDNKHFTFSGIC 398          

HSP 3 Score: 68.1662 bits (165), Expect = 1.535e-10
Identity = 90/374 (24.06%), Postives = 146/374 (39.04%), Query Frame = 3
Query: 3243 KCAKYICSNRMWNLLSEETANCEA----VCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFS-LATCAKFVQIIIGGQTYLLS---RGNNDTIPLFPKYDIVIEQLTFFTQLVSD----SIGLRVLWDRSTRVYLF-LKPS-FQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRK--SWAEQMCGVMKDTNGVFASCIEAMHQDV--NRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTC-DTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTC 4307
            K  K +C N +  +  EET  C      +C+     H  T DG  F   G+C Y L        + +  + + + N  C  +   TC K V++     + LLS   + +++ +PL    D    ++T + ++V +     +G    +  +   ++  L P+ F     GLCG  D +  N++   T+        +  FI            E  V  S  +  C   PD+         C +M       +   EA H       Y++ C   +C    G D   +C  +A +   C   G+ + WRT + CP+ C     Y  C   C + C  T+     S  ST    EGC CP G + +NG+CV    C
Sbjct: 1888 KIPKPMCHNNLPAMKIEETCGCRWTCPCMCMGSSTRHIVTFDGLDFKLMGACSYVLF------HDEVHDVKVILHNAECNTTNHQTCMKSVEVKHNKYSILLSSNMQVSDNIVPLPYANDNF--EVTLYGEIVHEVKIPQLGFVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTVNDF---TLSDGSVTTDSSKFIK-----------EWTVVDSLGR-TCETKPDKACTQPISSECKIM------LSKTFEACHTIFPPKPYFTVCEEASC---HGQD---ICEVIAAYVHVCRINGVCINWRTPDFCPMECPRLMVYHHCHMGCNKECGKTLNGTLCSDSST----EGCFCPEGDVIVNGKCVNEKVC 2222          

HSP 4 Score: 55.4546 bits (132), Expect = 1.160e-6
Identity = 84/380 (22.11%), Postives = 141/380 (37.11%), Query Frame = 3
Query:  771 CHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLR--QDNFILLSLEAGN-IKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVASFGNS--FKGFGCPDIANTLSTCKPDD---QILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYD--GQEHPPGTVRQFDCNTCTC-NSSLWHCTEKICPST 1877
            C      +  TFD   +   G CSY+L    +V  V   ++    N T+   C+K + ++     +  S N  +  +D+   + PL   N +  + + G  ++ ++  Q  F+     A N   L+ +                  +GLCG  D N  NDF+  D   +  +S   K +   D        KPD    Q ++++    +   F  C  +     YF++C +  C                  +C  ++AY   C   G CI WR+   C  +CP   ++  C   C   C          C +S    C C  G+V     C+  + C    D  G+EH         C+ C C  + + +CT   CP+ 
Sbjct: 1917 CMGSSTRHIVTFDGLDFKLMGACSYVLFH-DEVHDVKVILHNAECNTTNHQTCMKSVEVKHNKYSILLSSN--MQVSDN---IVPLPYANDNFEVTLYGEIVHEVKIPQLGFVFTFTPANNEFVLQLNPAAFSLR----------TSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWTVVDSLGRTCETKPDKACTQPISSECKIMLSKTFEACHTIFPPKPYFTVCEEASCHGQD--------------ICEVIAAYVHVCRINGVCINWRTPDFCPMECPRLMVYHHCHMGCNKECGKTLN--GTLCSDSSTEGCFCPEGDVIVNGKCVNEKVCSQCTDRYGEEHQTWIPTNAPCSICMCLENRMINCTAMPCPTV 2264          
BLAST of SCO-spondin vs. Ensembl Xenopus
Match: ndufs8 (NADH:ubiquinone oxidoreductase core subunit S8 [Source:Xenbase;Acc:XB-GENE-945877])

HSP 1 Score: 365.155 bits (936), Expect = 1.542e-101
Identity = 341/1317 (25.89%), Postives = 555/1317 (42.14%), Query Frame = 3
Query:  762 FTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVAS-----FGNSFKGFGC---------PDIANTLSTCKPDDQILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQ-WRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVS--SHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY-ITGSCDNTPQSIVDP-------PAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQ-SSNKDQLSYCSAILNAAIACRRFG--IQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKD----------------------NCTNP----VCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETAN-CEAVCIAYGDPHYKTLDGQMFSFQGSCMYTL-MDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIII-GGQTYLLSRGNNDTIPLFPKYDI-VIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYE-DAIQFAESFIAN---ADICPY-EISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGK----------HYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCS--CPNGMI--DLNGECVPPTTCP-CFYNGQSYVNGAIIKM-----ENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCD 4460
               C  +G ++ +TFD   Y + G CSY+L    D +  ++S+   Y N    +  V + + E  D+ +   G         + P     +     A    G      ++  F++    +GN+++           +  S +     GLCGN +    +DF   + + +     F NS+   G          P     +S+   +   +   Q  K    F  C  LV+ D Y ++C  ++C  ++  N            C     Y+ +C+  G     W + T+C+  CP    +++C S C  TC++L    +  CQ   +  C C  G+V  G  CI    C C++ G+ +PPG+  + DCN+CTC +  W C+ + CP  C + G + F +FD   F F+ + CQY+    ++++T     +  +  ++    + T   S  + +   +T+K+                    V +DG+D        +P     +R  T + + V+++     ++ +DG   + IK+S      + GLCG ++GN  +DF      I  S+ +   S+ + G C +  +   DP            ++C  +++   F  C N  +V+   Y   CR +  S +  +   CSA+   A AC R G  I +  P      + C P+  + G ++Q C   C  TCR L+      C + C  GC CPP  Y    G+CV +S+C+C+       P+     + ++    C C NG ++C T D                      +C  P    +CP +      +    +C NY+    +    + C CP D + +    C+ P  CPC +  +EYAP   + I C   +C NR W      T N C+A C A G  HY T DG  + F G C Y L  D  G  +       I V N  CGFS   C K + I+   G+  L +   +   PL  +    V++   +F  L+ +   + V WD+  RVY+ LK +++  V GLCGN+DG   N+ +    + E D + F  S+  N   AD   +  +SP +         +C  N  ++  AE  C ++     +FA C + ++ +   Y+  C YD C C   GDC C C SLA +A  CA  GI V WR+ +LCP  CE              Y++C + CP TC       P +C    CVEGC   CP G I  +++  C+ P  CP C   G +  +G  I +     + C+ C C      C       ITT  P+    D
Sbjct:   38 LARCSLFGENHIQTFDGTFYDFYGDCSYMLAG--DCNKHSFSLLADYRNGKKKS--VSLYLGEYFDIHLFLDGTATQGEKHISMPYASNGIFLESEA----GYYKLSSQEHGFMVKIDASGNVQV-----------VLPSKHFNKTCGLCGNYNQFAEDDFMMQEGILTENSYDFANSWALHGGARRCRRTYPPSNTCNISSETAEKDFMQRCQMLKTSSAFMQCHHLVDPDPYIAICEDDMCECAEELNCP----------CQTFLEYARTCAQHGVITSNWPTHTICKPLCPFGMEYNECVSPCVKTCQSL--NINEVCQEQCIDGCSCPDGKVLDGDRCIPVFECSCIHSGKRYPPGSAIRRDCNSCTCQNGAWECSNEDCPGECFVTGQSHFKSFDNKHFTFSGI-CQYLLATDAMDSTFS-VTIETVQCADDIDAVCTRSASLRLLDMHNITIKLKHGG---------------GVSLDGQD------ILLPLVQGFLRIQTTVLSAVRLTYKEDLQVDWDGHGKLLIKLSPIYSGLISGLCGNYNGNQGDDFLTPSGLIETSVEDFGNSWKLNGDCTDLMKQDTDPCNLNPKRARFSEEVCFALMDS-AFQSCHN--EVNPAPYLKNCRYDVCSCSNGKECLCSALSTYAAACSRKGILIDWRTP------EFC-PIQCSEGKIYQQCGSPCNQTCRSLSHPDVD-CREFCMEGCYCPPGLYTNEDGECVPKSDCSCYYDGELFQPDDVFSNHYSM----CYCENGLMHCSTSDVPSGYFPESFFNQPPARVKRSLDCRPPLNKIICPADNPKATGIECAKTCQNYELECVSHGCISGCTCP-DGMVRHKSKCMFPQRCPCFHAGKEYAPGSSVEIDCNTCVCENRKWKC----TENICDATCSAIGVSHYLTFDGFRYKFPGDCQYVLAQDYCGGVTGT---FRILVGNEGCGFSGEKCTKRITILFRNGEIELTNEQIHIKKPLSDETSFDVLKSGNYFILLLGNQ--MSVTWDKGMRVYVTLKETYRDKVCGLCGNFDGIENNDLISSNNQIEMDPVNFGNSWKVNPLCADAAKFGAVSPLS---------LCKDNLMKQMAAENACNIL--MGDLFAECAKVVNPE--PYWEICTYDTCTCESAGDCACFCDSLAAYAHVCAQRGINVHWRSSHLCPQSCEEKNQRDLDYVCEWRYNSCTTACPVTCQ---HPEPVNCP-LKCVEGCQAYCPPGKILDEVSESCIEPKDCPVCTIEGHTVPHGRKIILNHDDPQRCQLCHCEGKNLQCNACEISVITTVAPTTLPVD 1258          

HSP 2 Score: 115.931 bits (289), Expect = 5.670e-25
Identity = 115/430 (26.74%), Postives = 174/430 (40.47%), Query Frame = 3
Query: 3255 YICSNRMWNLLSEETANCE--------AVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVAN-IACGFSLATCAKF-VQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEY-MHGTMKYEDAIQFAESFIAN--ADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLG-IPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTC---TPSQFRCDDGKCIESSKIC 4493
            Y+ +   W  L   T   E        A C  +G+ H +T DG  + F G C Y L    GD + +   +     N      SL     F + + + G     ++G       +    I +E    + +L S   G  V  D S  V + L         GLCGNY+   ++++ M   +  E++  FA S+  +  A  C     P N    S E     A  D      Q C ++K T+  F  C   +  D + Y + C  D C C    +  C C +   +A  CA  G I   W T  +C  +C  G  Y+ C SPC +TC ++  N         C++GCSCP+G +     C+P   C C ++G+ Y  G+ I+  +C  C C    + C+ +  DC   C     S F+  D K    S IC
Sbjct:   12 YLLTVLRWIFLLRTTLFWEGKLDWSVLARCSLFGENHIQTFDGTFYDFYGDCSYMLA---GDCNKHSFSLLADYRNGKKKSVSLYLGEYFDIHLFLDGTA---TQGEKHISMPYASNGIFLESEAGYYKLSSQEHGFMVKIDASGNVQVVLPSKHFNKTCGLCGNYNQFAEDDFMMQEGILTENSYDFANSWALHGGARRCRRTYPPSNTCNISSE----TAEKDFM----QRCQMLK-TSSAFMQCHHLV--DPDPYIAICEDDMCEC--AEELNCPCQTFLEYARTCAQHGVITSNWPTHTICKPLCPFGMEYNECVSPCVKTCQSLNIN---EVCQEQCIDGCSCPDGKVLDGDRCIPVFECSCIHSGKRYPPGSAIR-RDCNSCTCQNGAWECSNE--DCPGECFVTGQSHFKSFDNKHFTFSGIC 416          

HSP 3 Score: 70.4774 bits (171), Expect = 3.556e-11
Identity = 92/376 (24.47%), Postives = 144/376 (38.30%), Query Frame = 3
Query: 3243 KCAKYICSNRMWNLLSEETANCEA----VCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFS-LATCAKFVQIIIGGQTYLLSRG-----NNDTIPLFPKYDIVIEQLTFFTQLVSD----SIGLRVLWDRSTRVYLF-LKPS-FQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRK--SWAEQMCGVMKDTNGVFASCIEAMHQDV--NRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTC-DTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTC 4307
            K  K +C N +  +  EET  C      +C+     H  T DG  F   G+C Y L        + +  + + + N  C  +   TC K V++     + LLS       N D +PL    D    ++T + ++V +     +G    +  +   ++  L P+ F     GLCG  D +  N++   T+        +  FI            E  V  S  +  C   PD+         C +M       +   EA H       Y++ C   +C    G D   +C  +A +   C   G+ + WRT + CP+ C     Y  C   C + C  T+     S  ST    EGC CP G + +NG+CV    C
Sbjct: 1919 KIPKPMCHNNLPAMKIEETCGCRWTCPCMCMGSSTRHIVTFDGLDFKLMGACSYVLF------HDEVHDVKVILHNAECNTTNHQTCMKSVEVKHNKYSILLSSNMQVSVNGDIVPLPYANDNF--EVTLYGEIVHEVKIPQLGFVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTVNDF---TLSDGSVTTDSSKFIK-----------EWTVVDSLGR-TCETKPDKACTQPISSECKIM------LSKTFEACHTIFPPKPYFTVCEEASC---HGQD---ICEVIAAYVHVCRINGVCINWRTPDFCPMECPRLMVYHHCHMGCNKECGKTLNGTLCSDSST----EGCFCPEGDVIVNGKCVNEKVC 2255          

HSP 4 Score: 52.7582 bits (125), Expect = 8.377e-6
Identity = 87/389 (22.37%), Postives = 141/389 (36.25%), Query Frame = 3
Query:  771 CHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLR--QDNFILLSLEAGN-IKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVASFGNS--FKGFGCPDIANTLSTCKPDD---QILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYD--GQEH---PPGTVRQFDCNTCTC-NSSLWHCTEKICPS----TCG 1883
            C      +  TFD   +   G CSY+L    +V  V   ++    N T+   C+K + ++     +  S N        N  + PL   N +  + + G  ++ ++  Q  F+     A N   L+ +                  +GLCG  D N  NDF+  D   +  +S   K +   D        KPD    Q ++++    +   F  C  +     YF++C +  C                  +C  ++AY   C   G CI WR+   C  +CP   ++  C   C   C          C +S    C C  G+V     C+  + C    D  G+EH            C+ C C  + + +CT   CP+    TCG
Sbjct: 1948 CMGSSTRHIVTFDGLDFKLMGACSYVLFH-DEVHDVKVILHNAECNTTNHQTCMKSVEVKHNKYSILLSSN---MQVSVNGDIVPLPYANDNFEVTLYGEIVHEVKIPQLGFVFTFTPANNEFVLQLNPAAFSLR----------TSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWTVVDSLGRTCETKPDKACTQPISSECKIMLSKTFEACHTIFPPKPYFTVCEEASCHGQD--------------ICEVIAAYVHVCRINGVCINWRTPDFCPMECPRLMVYHHCHMGCNKECGKTLN--GTLCSDSSTEGCFCPEGDVIVNGKCVNEKVCSQCTDRYGEEHQLLETWIPTNAPCSICMCLENRMINCTAMPCPTVKPLTCG 2306          
BLAST of SCO-spondin vs. Ensembl Xenopus
Match: ndufs8 (NADH:ubiquinone oxidoreductase core subunit S8 [Source:Xenbase;Acc:XB-GENE-945877])

HSP 1 Score: 364.385 bits (934), Expect = 2.411e-101
Identity = 339/1314 (25.80%), Postives = 553/1314 (42.09%), Query Frame = 3
Query:  762 FTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVAS-----FGNSFKGFGC---------PDIANTLSTCKPDDQILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQ-WRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVS--SHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY-ITGSCDNTPQSIVDP-------PAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQ-SSNKDQLSYCSAILNAAIACRRFG--IQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKD----------------------NCTNP----VCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETAN-CEAVCIAYGDPHYKTLDGQMFSFQGSCMYTL-MDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIII-GGQTYLLSRGNNDTIPLFPKYDI-VIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYE-DAIQFAESFIANADICPY-EISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGK----------HYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCS--CPNGMI--DLNGECVPPTTCP-CFYNGQSYVNGAIIKM-----ENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCD 4460
               C  +G ++ +TFD   Y + G CSY+L    D +  ++S+   Y N    +  V + + E  D+ +   G         + P     +     A    G      ++  F++    +GN+++           +  S +     GLCGN +    +DF   + + +     F NS+   G          P     +S+   +   +   Q  K    F  C  LV+ D Y ++C  ++C  ++  N            C     Y+ +C+  G     W + T+C+  CP    +++C S C  TC++L    +  CQ   +  C C  G+V  G  CI    C C++ G+ +PPG+  + DCN+CTC +  W C+ + CP  C + G + F +FD   F F+ + CQY+    ++++T     +  +  ++    + T   S  + +   +T+K+                    V +DG+D        +P     +R  T + + V+++     ++ +DG   + IK+S      + GLCG ++GN  +DF      I  S+ +   S+ + G C +  +   DP            ++C  +++   F  C N  +V+   Y   CR +  S +  +   CSA+   A AC R G  I +  P      + C P+  + G ++Q C   C  TCR L+      C + C  GC CPP  Y    G+CV +S+C+C+       P+     + ++    C C NG ++C T D                      +C  P    +CP +      +    +C NY+    +    + C CP D + +    C+ P  CPC +  +EYAP   + I C   +C NR W      T N C+A C A G  HY T DG  + F G C Y L  D  G  +       I V N  CGFS   C K + I+   G+  L +   +   PL  +    V++   +F  L+ +   + V WD+  RVY+ LK +++  V GLCGN+DG   N+ +    + E D + F  S+  N     +  +SP +         +C  N  ++  AE  C ++     +FA C + ++ +   Y+  C YD C C   GDC C C SLA +A  CA  GI V WR+ +LCP  CE              Y++C + CP TC       P +C    CVEGC   CP G I  +++  C+ P  CP C   G +  +G  I +     + C+ C C      C       ITT  P+    D
Sbjct:   27 LARCSLFGENHIQTFDGTFYDFYGDCSYMLAG--DCNKHSFSLLADYRNGKKKS--VSLYLGEYFDIHLFLDGTATQGEKHISMPYASNGIFLESEA----GYYKLSSQEHGFMVKIDASGNVQV-----------VLPSKHFNKTCGLCGNYNQFAEDDFMMQEGILTENSYDFANSWALHGGARRCRRTYPPSNTCNISSETAEKDFMQRCQMLKTSSAFMQCHHLVDPDPYIAICEDDMCECAEELNCP----------CQTFLEYARTCAQHGVITSNWPTHTICKPLCPFGMEYNECVSPCVKTCQSL--NINEVCQEQCIDGCSCPDGKVLDGDRCIPVFECSCIHSGKRYPPGSAIRRDCNSCTCQNGAWECSNEDCPGECFVTGQSHFKSFDNKHFTFSGI-CQYLLATDAMDSTFS-VTIETVQCADDIDAVCTRSASLRLLDMHNITIKLKHGG---------------GVSLDGQD------ILLPLVQGFLRIQTTVLSAVRLTYKEDLQVDWDGHGKLLIKLSPIYSGLISGLCGNYNGNQGDDFLTPSGLIETSVEDFGNSWKLNGDCTDLMKQDTDPCNLNPKRARFSEEVCFALMDS-AFQSCHN--EVNPAPYLKNCRYDVCSCSNGKECLCSALSTYAAACSRKGILIDWRTP------EFC-PIQCSEGKIYQQCGSPCNQTCRSLSHPDVD-CREFCMEGCYCPPGLYTNEDGECVPKSDCSCYYDGELFQPDDVFSNHYSM----CYCENGLMHCSTSDVPSGYFPESFFNQPPARVKRSLDCRPPLNKIICPADNPKATGIECAKTCQNYELECVSHGCISGCTCP-DGMVRHKSKCMFPQRCPCFHAGKEYAPGSSVEIDCNTCVCENRKWKC----TENICDATCSAIGVSHYLTFDGFRYKFPGDCQYVLAQDYCGGVTGT---FRILVGNEGCGFSGEKCTKRITILFRNGEIELTNEQIHIKKPLSDETSFDVLKSGNYFILLLGNQ--MSVTWDKGMRVYVTLKETYRDKVCGLCGNFDGIENNDLISSNNQIEMDPVNFGNSWKVNPLCADFGAVSPLS---------LCKDNLMKQMAAENACNIL--MGDLFAECAKVVNPE--PYWEICTYDTCTCESAGDCACFCDSLAAYAHVCAQRGINVHWRSSHLCPQSCEEKNQRDLDYVCEWRYNSCTTACPVTCQ---HPEPVNCPLK-CVEGCQAYCPPGKILDEVSESCIEPKDCPVCTIEGHTVPHGRKIILNHDDPQRCQLCHCEGKNLQCNACEISVITTVAPTTLPVD 1244          

HSP 2 Score: 115.161 bits (287), Expect = 9.384e-25
Identity = 110/403 (27.30%), Postives = 167/403 (41.44%), Query Frame = 3
Query: 3312 AVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVAN-IACGFSLATCAKF-VQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEY-MHGTMKYEDAIQFAESFIAN--ADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLG-IPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTC---TPSQFRCDDGKCIESSKIC 4493
            A C  +G+ H +T DG  + F G C Y L    GD + +   +     N      SL     F + + + G     ++G       +    I +E    + +L S   G  V  D S  V + L         GLCGNY+   ++++ M   +  E++  FA S+  +  A  C     P N    S E     A  D      Q C ++K T+  F  C   +  D + Y + C  D C C    +  C C +   +A  CA  G I   W T  +C  +C  G  Y+ C SPC +TC ++  N         C++GCSCP+G +     C+P   C C ++G+ Y  G+ I+  +C  C C    + C+ +  DC   C     S F+  D K    S IC
Sbjct:   28 ARCSLFGENHIQTFDGTFYDFYGDCSYMLA---GDCNKHSFSLLADYRNGKKKSVSLYLGEYFDIHLFLDGTA---TQGEKHISMPYASNGIFLESEAGYYKLSSQEHGFMVKIDASGNVQVVLPSKHFNKTCGLCGNYNQFAEDDFMMQEGILTENSYDFANSWALHGGARRCRRTYPPSNTCNISSE----TAEKDFM----QRCQMLK-TSSAFMQCHHLV--DPDPYIAICEDDMCEC--AEELNCPCQTFLEYARTCAQHGVITSNWPTHTICKPLCPFGMEYNECVSPCVKTCQSLNIN---EVCQEQCIDGCSCPDGKVLDGDRCIPVFECSCIHSGKRYPPGSAIR-RDCNSCTCQNGAWECSNE--DCPGECFVTGQSHFKSFDNKHFTFSGIC 405          

HSP 3 Score: 70.4774 bits (171), Expect = 3.028e-11
Identity = 92/376 (24.47%), Postives = 144/376 (38.30%), Query Frame = 3
Query: 3243 KCAKYICSNRMWNLLSEETANCEA----VCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFS-LATCAKFVQIIIGGQTYLLSRG-----NNDTIPLFPKYDIVIEQLTFFTQLVSD----SIGLRVLWDRSTRVYLF-LKPS-FQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRK--SWAEQMCGVMKDTNGVFASCIEAMHQDV--NRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTC-DTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTC 4307
            K  K +C N +  +  EET  C      +C+     H  T DG  F   G+C Y L        + +  + + + N  C  +   TC K V++     + LLS       N D +PL    D    ++T + ++V +     +G    +  +   ++  L P+ F     GLCG  D +  N++   T+        +  FI            E  V  S  +  C   PD+         C +M       +   EA H       Y++ C   +C    G D   +C  +A +   C   G+ + WRT + CP+ C     Y  C   C + C  T+     S  ST    EGC CP G + +NG+CV    C
Sbjct: 1903 KIPKPMCHNNLPAMKIEETCGCRWTCPCMCMGSSTRHIVTFDGLDFKLMGACSYVLF------HDEVHDVKVILHNAECNTTNHQTCMKSVEVKHNKYSILLSSNMQVSVNGDIVPLPYANDNF--EVTLYGEIVHEVKIPQLGFVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTVNDF---TLSDGSVTTDSSKFIK-----------EWTVVDSLGR-TCETKPDKACTQPISSECKIM------LSKTFEACHTIFPPKPYFTVCEEASC---HGQD---ICEVIAAYVHVCRINGVCINWRTPDFCPMECPRLMVYHHCHMGCNKECGKTLNGTLCSDSST----EGCFCPEGDVIVNGKCVNEKVC 2239          

HSP 4 Score: 52.7582 bits (125), Expect = 7.137e-6
Identity = 87/389 (22.37%), Postives = 141/389 (36.25%), Query Frame = 3
Query:  771 CHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLR--QDNFILLSLEAGN-IKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVASFGNS--FKGFGCPDIANTLSTCKPDD---QILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYD--GQEH---PPGTVRQFDCNTCTC-NSSLWHCTEKICPS----TCG 1883
            C      +  TFD   +   G CSY+L    +V  V   ++    N T+   C+K + ++     +  S N        N  + PL   N +  + + G  ++ ++  Q  F+     A N   L+ +                  +GLCG  D N  NDF+  D   +  +S   K +   D        KPD    Q ++++    +   F  C  +     YF++C +  C                  +C  ++AY   C   G CI WR+   C  +CP   ++  C   C   C          C +S    C C  G+V     C+  + C    D  G+EH            C+ C C  + + +CT   CP+    TCG
Sbjct: 1932 CMGSSTRHIVTFDGLDFKLMGACSYVLFH-DEVHDVKVILHNAECNTTNHQTCMKSVEVKHNKYSILLSSN---MQVSVNGDIVPLPYANDNFEVTLYGEIVHEVKIPQLGFVFTFTPANNEFVLQLNPAAFSLR----------TSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWTVVDSLGRTCETKPDKACTQPISSECKIMLSKTFEACHTIFPPKPYFTVCEEASCHGQD--------------ICEVIAAYVHVCRINGVCINWRTPDFCPMECPRLMVYHHCHMGCNKECGKTLN--GTLCSDSSTEGCFCPEGDVIVNGKCVNEKVCSQCTDRYGEEHQLLETWIPTNAPCSICMCLENRMINCTAMPCPTVKPLTCG 2290          
BLAST of SCO-spondin vs. Ensembl Mouse
Match: Sspo (SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311])

HSP 1 Score: 469.159 bits (1206), Expect = 7.486e-135
Identity = 403/1462 (27.56%), Postives = 601/1462 (41.11%), Query Frame = 3
Query:  660 ECCADKTGS--WGSQSGSCVSCKANFAGGN------------------DVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYE-NCTSDTGCVKVIVIEAGDVVVKSSG----NGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXX-----XXXXXXXXVASFGNSFK--------------GFGCPDI-ANTLSTCKPDD-QILANQQCSKI-RLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDV-GCQYVAVEPSVNNTDDRANVFVIIQS---NTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYIT---GSC---DNTPQ--SIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQ---SSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITIN------CQTCVCI-NGRLNCKTKDNCTN--PVCPKNQVYMDS--VSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVL----------WDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDV--NRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDC---ITTCTPSQFRC-DDGKCIESSKICDKVTDCSNSEDEKNC--NVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENC 4769
            ECCA   G   W S S  C+SC      GN                          TC ++   +Y+TFD   Y + G+C+Y+L    D    TW++++    +C     C  V V+   + V+   G     G          L  +S+      L++ G    V+R D    +S+   +                   + G   GLCG  +  P               A+FGNS+K               +GC  +   TL+  +    Q  A   C ++    F  C   V  D Y   C+   C  +   N         + +C   + Y+ +C+ +   + WR    CE  CPG +++SDC S CP +C  + Q     C    V  C C +G    G  C+    CPC +  Q + PG   +  CN C C    WHC + +CP+ C + G   + TFDG  F F    GC Y  V+ SV     +  + V+++    +T S L              ++V +  + I L+ +          V +DGED    LP+ I  +  ++   ++ +  +     + L+     + YI +       + GLCG F    ++DF      I  S+   A  +     G C   D +P   S         +    IL+G  F  C     VD+E +   C       +  +D L  C  +      C + G+  +  + +  L    P+   GG V+Q C+  C   C E  +    K    C  GC CPP       GQCV  S C C             G   TIN      C  C+C   G  NC T  +C     +CP+  +Y+    +  C+S     +C   S+  + C CP  TV  +D  CV P  CPC +  + Y PN  I   C   +C  + W+   +    C   C A G PHY T DG +F+F G+C Y L+   G         ++SV N+ CG S  TC K + + +      + RG   T+       I + ++     L     GL +L          WD  TRV + L P F G V GLCGN+D D  N+        E   +          +CP          P      C  N  R +WA   C V+     +FA C    H +V   +YY  C+YDACGC+ GGDCECLC+++AT+A +CA     V+WR+Q LCP+ CEGG+ Y+ C S CP TC    S    HC    CVEGC CP G +   G C+    CPC + G  +  G +++ ++C  C C  ++++C    + C      C   +  C ++G C+    +CD   DC +  DE+ C  +VC   Q  C S G C+P++  CDG  +C D +DE  C C    + C   R C+    +C+G+ DC   D +DEE+C
Sbjct:  138 ECCAQPWGHSWWNSSSQMCLSCSGQHRPGNASSEGLLQPLAGAVGQLWSQRQRPSATCATWSGFHYQTFDGHHYHFLGQCTYLLAGAMDS---TWAVHLRPSVHCPQHRHCWLVQVVMGPEEVLIQDGEVSVKGQPVPVGEPQLLHGMSLQWQGDWLVLSGGLGVVVRLDRSSSISISVDH------------------EFWGRTQGLCGLYNGRPEDDFVEPGGGLATLAATFGNSWKLPGSEPGCLDAVEVAWGCESLLGGTLTDLEAVKLQAQAQDMCHQLLEGPFWQCHGQVQPDEYHETCLFAYCVGATAGNGPE---GQLEAVCATFANYAQACARQHIYVHWRKPGFCERVCPGGQLYSDCVSSCPPSCSAVAQGEEGSCGKECVSGCECPTGLFWDGALCVPAAHCPCYHRRQRYAPGDTVKQQCNPCVCQDGRWHCAQALCPAECAVGGDGHYFTFDGRSFFFRGTPGCHYSLVQDSV-----KGQLLVVLEHGACDTGSCL------------HALSVFLGNTHIQLRYSG--------AVLVDGED--VDLPW-IGVEGFNISWASSTFLLLHWPGAWVLWGVAEPAAYITLDPRHAYQVQGLCGTFTWKQQDDFLTPAGDIETSVTAFASKFQVSGDGRCPLVDKSPLFCSSYSQHLTFTEAACAILHGHAFQECHG--LVDREPFRLRCLEAVCGCAPGRDCL--CPVLSAYTRHCAQEGVLLQ--WRNETL---CPVSCPGGQVYQECAPVCGHHCGEPEDC---KELGICVAGCNCPPGLLWDLEGQCVPPSMCHCQF----------GGHRYTINTTTVRDCSHCICQERGLWNC-TAHHCPRQWALCPRELIYVPGACLLTCDSPRANHSCWAGST--DGCVCPPGTV-LLDKHCVSPDLCPCRHNGQWYPPNATIQEDCNICVCQGQRWHCTGQ---RCSGWCQASGAPHYVTFDGLVFTFPGACEYLLVREAGGR------FSVSVQNLPCGASGLTCTKALVVRLDSTVVHMLRGQAVTVN---GVSIRLPKVYTGPGLSLHHAGLFLLLTTRLGLTLLWDGGTRVLVQLSPHFHGRVAGLCGNFDSDASNDLRSRQGVLEPTAELTAHSWRLNPLCP---------EPGDLPHPCTVNAHRANWARARCEVILQP--IFAPC----HTEVPPQQYYEWCVYDACGCDTGGDCECLCSAIATYADECARHRHHVRWRSQELCPLQCEGGQVYEPCGSTCPPTCHDHHSELRWHCQVITCVEGCFCPEGTLLHGGACMKLAACPCEWQGSFFPPGTVLQ-KDCGNCTCQGSQWHCDRGGAPCEDMEPGCAEGETLCRENGHCVPLEWLCDNQDDCGDGSDEEGCATSVCGEGQMSCQS-GHCLPLSLICDGQDDCGDGTDEQGCLCPHGSLACADGR-CLPPALLCNGHPDC--LDAADEESC 1489          

HSP 2 Score: 65.4698 bits (158), Expect = 9.099e-10
Identity = 58/215 (26.98%), Postives = 89/215 (41.40%), Query Frame = 3
Query: 4242 EGCSCPNGMID-LNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCI--TTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDE--KNCNV----------------------------------CDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCG--CLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEE 4763
            +GC CP+G +   +G C+PP       NG                  C+ A      D   C+   +C   +  C DG C+ + ++CD V DC +  DE   +C++                                  C L +FQC ++G C P   +CD  ++C D SDE+ CG  C+ +Q+ C  S  C+   ++CDG   C   D SDE+
Sbjct: 1451 QGCLCPHGSLACADGRCLPPAL---LCNGHP---------------DCLDAA-----DEESCLGPVSCISGEVSCVDGTCVRTIQLCDGVWDCPDGADEGPSHCSLPSLPTPPGGIGQNPSTSSLDTAPSPVGSTSPASPCSLLEFQC-NSGECTPRGWRCDQEEDCTDGSDELDCGGPCMLYQVPCAHSPHCVSPGQLCDGVTQC--PDGSDED 1639          

HSP 3 Score: 62.003 bits (149), Expect = 1.083e-8
Identity = 42/107 (39.25%), Postives = 48/107 (44.86%), Query Frame = 3
Query: 1581 CETQCPGNKIW---SDCASE---CPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCG 1883
            C  QCPGN ++     C  E   CP  C  L Q P   C  S    C C  G   +  +C+    CPC   GQ + PG V   DCN CTC S    CT K CP  CG
Sbjct: 2852 CTAQCPGNMVFRSAEQCLEEGGPCPQLC--LAQDPGVECTGSCAPSCNCPPGLFLHNASCLPRSQCPCQLHGQLYAPGAVAHLDCNNCTCISGEMVCTSKRCPVACG 2956          

HSP 4 Score: 56.9954 bits (136), Expect = 3.114e-7
Identity = 40/132 (30.30%), Postives = 60/132 (45.45%), Query Frame = 3
Query: 4428 TTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNC-NVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISR-------------TCIEEKKICDGNYDCGVNDKS----DEENC 4769
            + C+  +F+C+ G+C      CD+  DC++  DE +C   C L Q  C  +  C+   + CDG   C D SDE    C         +R             TCI+   +CDGN DC + D++    DE+ C
Sbjct: 1566 SPCSLLEFQCNSGECTPRGWRCDQEEDCTDGSDELDCGGPCMLYQVPCAHSPHCVSPGQLCDGVTQCPDGSDEDPDVCEEQSASGGANRTGAPCPEFSCPDGTCIDFLLVCDGNPDCELADETEPSLDEQGC 1697          

HSP 5 Score: 54.6842 bits (130), Expect = 1.800e-6
Identity = 38/123 (30.89%), Postives = 55/123 (44.72%), Query Frame = 3
Query: 2766 CQSTCRELNEATA-SKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSC 3131
            C+ TC E+N   A S C +   PGC C   Y+++ TG CV E  C CW+   P  P    G+     C++C C++G+  C    +C    C + +V M     C      DT +       SC
Sbjct: 4925 CEKTCPEMNMTQAWSNCTEAQAPGCVCQLGYFRSQTGLCVPEDHCECWHHGSPHLP----GSEWQEACESCRCLHGKSVCIR--HCPELSCAQGEVIMQEPGSCCPICQQDTLSTEEEEPVSC 5041          
BLAST of SCO-spondin vs. Ensembl Mouse
Match: Sspo (SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311])

HSP 1 Score: 468.389 bits (1204), Expect = 1.105e-134
Identity = 403/1462 (27.56%), Postives = 601/1462 (41.11%), Query Frame = 3
Query:  660 ECCADKTGS--WGSQSGSCVSCKANFAGGN------------------DVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYE-NCTSDTGCVKVIVIEAGDVVVKSSG----NGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXX-----XXXXXXXXVASFGNSFK--------------GFGCPDI-ANTLSTCKPDD-QILANQQCSKI-RLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDV-GCQYVAVEPSVNNTDDRANVFVIIQS---NTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYIT---GSC---DNTPQ--SIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQ---SSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITIN------CQTCVCI-NGRLNCKTKDNCTN--PVCPKNQVYMDS--VSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVL----------WDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDV--NRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDC---ITTCTPSQFRC-DDGKCIESSKICDKVTDCSNSEDEKNC--NVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENC 4769
            ECCA   G   W S S  C+SC      GN                          TC ++   +Y+TFD   Y + G+C+Y+L    D    TW++++    +C     C  V V+   + V+   G     G          L  +S+      L++ G    V+R D    +S+   +                   + G   GLCG  +  P               A+FGNS+K               +GC  +   TL+  +    Q  A   C ++    F  C   V  D Y   C+   C  +   N         + +C   + Y+ +C+ +   + WR    CE  CPG +++SDC S CP +C  + Q     C    V  C C +G    G  C+    CPC +  Q + PG   +  CN C C    WHC + +CP+ C + G   + TFDG  F F    GC Y  V+ SV     +  + V+++    +T S L              ++V +  + I L+ +          V +DGED    LP+ I  +  ++   ++ +  +     + L+     + YI +       + GLCG F    ++DF      I  S+   A  +     G C   D +P   S         +    IL+G  F  C     VD+E +   C       +  +D L  C  +      C + G+  +  + +  L    P+   GG V+Q C+  C   C E  +    K    C  GC CPP       GQCV  S C C             G   TIN      C  C+C   G  NC T  +C     +CP+  +Y+    +  C+S     +C   S+  + C CP  TV  +D  CV P  CPC +  + Y PN  I   C   +C  + W+   +    C   C A G PHY T DG +F+F G+C Y L+   G         ++SV N+ CG S  TC K + + +      + RG   T+       I + ++     L     GL +L          WD  TRV + L P F G V GLCGN+D D  N+        E   +          +CP          P      C  N  R +WA   C V+     +FA C    H +V   +YY  C+YDACGC+ GGDCECLC+++AT+A +CA     V+WR+Q LCP+ CEGG+ Y+ C S CP TC    S    HC    CVEGC CP G +   G C+    CPC + G  +  G +++ ++C  C C  ++++C    + C      C   +  C ++G C+    +CD   DC +  DE+ C  +VC   Q  C S G C+P++  CDG  +C D +DE  C C    + C   R C+    +C+G+ DC   D +DEE+C
Sbjct:  138 ECCAQPWGHSWWNSSSQMCLSCSGQHRPGNASSEGLLQPLAGAVGQLWSQRQRPSATCATWSGFHYQTFDGHHYHFLGQCTYLLAGAMDS---TWAVHLRPSVHCPQHRHCWLVQVVMGPEEVLIQDGEVSVKGQPVPVGEPQLLHGMSLQWQGDWLVLSGGLGVVVRLDRSSSISISVDH------------------EFWGRTQGLCGLYNGRPEDDFVEPGGGLATLAATFGNSWKLPGSEPGCLDAVEVAWGCESLLGGTLTDLEAVKLQAQAQDMCHQLLEGPFWQCHGQVQPDEYHETCLFAYCVGATAGNGPE---GQLEAVCATFANYAQACARQHIYVHWRKPGFCERVCPGGQLYSDCVSSCPPSCSAVAQGEEGSCGKECVSGCECPTGLFWDGALCVPAAHCPCYHRRQRYAPGDTVKQQCNPCVCQDGRWHCAQALCPAECAVGGDGHYFTFDGRSFFFRGTPGCHYSLVQDSV-----KGQLLVVLEHGACDTGSCL------------HALSVFLGNTHIQLRYSG--------AVLVDGED--VDLPW-IGVEGFNISWASSTFLLLHWPGAWVLWGVAEPAAYITLDPRHAYQVQGLCGTFTWKQQDDFLTPAGDIETSVTAFASKFQVSGDGRCPLVDKSPLFCSSYSQHLTFTEAACAILHGHAFQECHG--LVDREPFRLRCLEAVCGCAPGRDCL--CPVLSAYTRHCAQEGVLLQ--WRNETL---CPVSCPGGQVYQECAPVCGHHCGEPEDC---KELGICVAGCNCPPGLLWDLEGQCVPPSMCHCQF----------GGHRYTINTTTVRDCSHCICQERGLWNC-TAHHCPRQWALCPRELIYVPGACLLTCDSPRANHSCWAGST--DGCVCPPGTV-LLDKHCVSPDLCPCRHNGQWYPPNATIQEDCNICVCQGQRWHCTGQ---RCSGWCQASGAPHYVTFDGLVFTFPGACEYLLVREAGGR------FSVSVQNLPCGASGLTCTKALVVRLDSTVVHMLRGQAVTVN---GVSIRLPKVYTGPGLSLHHAGLFLLLTTRLGLTLLWDGGTRVLVQLSPHFHGRVAGLCGNFDSDASNDLRSRQGVLEPTAELTAHSWRLNPLCP---------EPGDLPHPCTVNAHRANWARARCEVILQP--IFAPC----HTEVPPQQYYEWCVYDACGCDTGGDCECLCSAIATYADECARHRHHVRWRSQELCPLQCEGGQVYEPCGSTCPPTCHDHHSELRWHCQVITCVEGCFCPEGTLLHGGACMKLAACPCEWQGSFFPPGTVLQ-KDCGNCTCQGSQWHCDRGGAPCEDMEPGCAEGETLCRENGHCVPLEWLCDNQDDCGDGSDEEGCATSVCGEGQMSCQS-GHCLPLSLICDGQDDCGDGTDEQGCLCPHGSLACADGR-CLPPALLCNGHPDC--LDAADEESC 1489          

HSP 2 Score: 65.4698 bits (158), Expect = 9.651e-10
Identity = 58/215 (26.98%), Postives = 89/215 (41.40%), Query Frame = 3
Query: 4242 EGCSCPNGMID-LNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCI--TTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDE--KNCNV----------------------------------CDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCG--CLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEE 4763
            +GC CP+G +   +G C+PP       NG                  C+ A      D   C+   +C   +  C DG C+ + ++CD V DC +  DE   +C++                                  C L +FQC ++G C P   +CD  ++C D SDE+ CG  C+ +Q+ C  S  C+   ++CDG   C   D SDE+
Sbjct: 1451 QGCLCPHGSLACADGRCLPPAL---LCNGHP---------------DCLDAA-----DEESCLGPVSCISGEVSCVDGTCVRTIQLCDGVWDCPDGADEGPSHCSLPSLPTPPGGIGQNPSTSSLDTAPSPVGSTSPASPCSLLEFQC-NSGECTPRGWRCDQEEDCTDGSDELDCGGPCMLYQVPCAHSPHCVSPGQLCDGVTQC--PDGSDED 1639          

HSP 3 Score: 62.003 bits (149), Expect = 1.083e-8
Identity = 42/107 (39.25%), Postives = 48/107 (44.86%), Query Frame = 3
Query: 1581 CETQCPGNKIW---SDCASE---CPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCG 1883
            C  QCPGN ++     C  E   CP  C  L Q P   C  S    C C  G   +  +C+    CPC   GQ + PG V   DCN CTC S    CT K CP  CG
Sbjct: 2863 CTAQCPGNMVFRSAEQCLEEGGPCPQLC--LAQDPGVECTGSCAPSCNCPPGLFLHNASCLPRSQCPCQLHGQLYAPGAVAHLDCNNCTCISGEMVCTSKRCPVACG 2967          

HSP 4 Score: 56.9954 bits (136), Expect = 3.037e-7
Identity = 40/132 (30.30%), Postives = 60/132 (45.45%), Query Frame = 3
Query: 4428 TTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNC-NVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISR-------------TCIEEKKICDGNYDCGVNDKS----DEENC 4769
            + C+  +F+C+ G+C      CD+  DC++  DE +C   C L Q  C  +  C+   + CDG   C D SDE    C         +R             TCI+   +CDGN DC + D++    DE+ C
Sbjct: 1566 SPCSLLEFQCNSGECTPRGWRCDQEEDCTDGSDELDCGGPCMLYQVPCAHSPHCVSPGQLCDGVTQCPDGSDEDPDVCEEQSASGGANRTGAPCPEFSCPDGTCIDFLLVCDGNPDCELADETEPSLDEQGC 1697          

HSP 5 Score: 54.299 bits (129), Expect = 1.862e-6
Identity = 38/123 (30.89%), Postives = 55/123 (44.72%), Query Frame = 3
Query: 2766 CQSTCRELNEATA-SKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSC 3131
            C+ TC E+N   A S C +   PGC C   Y+++ TG CV E  C CW+   P  P    G+     C++C C++G+  C    +C    C + +V M     C      DT +       SC
Sbjct: 4934 CEKTCPEMNMTQAWSNCTEAQAPGCVCQLGYFRSQTGLCVPEDHCECWHHGSPHLP----GSEWQEACESCRCLHGKSVCIR--HCPELSCAQGEVIMQEPGSCCPICQQDTLSTEEEEPVSC 5050          
BLAST of SCO-spondin vs. Ensembl Mouse
Match: Sspo (SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311])

HSP 1 Score: 436.802 bits (1122), Expect = 2.381e-124
Identity = 357/1233 (28.95%), Postives = 529/1233 (42.90%), Query Frame = 3
Query: 1260 VASFGNSFK--------------GFGCPDI-ANTLSTCKPDD-QILANQQCSKI-RLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDV-GCQYVAVEPSVNNTDDRANVFVIIQS---NTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYIT---GSC---DNTPQ--SIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQ---SSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITIN------CQTCVCI-NGRLNCKTKDNCTN--PVCPKNQVYMDS--VSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVL----------WDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQF-AESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDV--NRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDC---ITTCTPSQFRC-DDGKCIESSKICDKVTDCSNSEDEKNC--NVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENC 4769
             A+FGNS+K               +GC  +   TL+  +    Q  A   C ++    F  C   V  D Y   C+   C  +   N         + +C   + Y+ +C+ +   + WR    CE  CPG +++SDC S CP +C  + Q     C    V  C C +G    G  C+    CPC +  Q + PG   +  CN C C    WHC + +CP+ C + G   + TFDG  F F    GC Y  V+ SV     +  + V+++    +T S L              ++V +  + I L+ +          V +DGED    LP+ I  +  ++   ++ +  +     + L+     + YI +       + GLCG F    ++DF      I  S+   A  +     G C   D +P   S         +    IL+G  F  C     VD+E +   C       +  +D L  C  +      C + G+  +  + +  L    P+   GG V+Q C+  C   C E  +    K    C  GC CPP       GQCV  S C C             G   TIN      C  C+C   G  NC T  +C     +CP+  +Y+    +  C+S     +C   S+  + C CP  TV  +D  CV P  CPC +  + Y PN  I   C   +C  + W+   +    C   C A G PHY T DG +F+F G+C Y L+   G         ++SV N+ CG S  TC K + + +      + RG   T+       I + ++     L     GL +L          WD  TRV + L P F G V GLCGN+D D  N+        E   +  A S+  N       + PE    P         N  R +WA   C V+     +FA C    H +V   +YY  C+YDACGC+ GGDCECLC+++AT+A +CA     V+WR+Q LCP+ CEGG+ Y+ C S CP TC    S    HC    CVEGC CP G +   G C+    CPC + G  +  G +++ ++C  C C  ++++C    + C      C   +  C ++G C+    +CD   DC +  DE+ C  +VC   Q  C S G C+P++  CDG  +C D +DE  C C    + C   R C+    +C+G+ DC   D +DEE+C
Sbjct:  224 AATFGNSWKLPGSEPGCLDAVEVAWGCESLLGGTLTDLEAVKLQAQAQDMCHQLLEGPFWQCHGQVQPDEYHETCLFAYCVGATAGNGPE---GQLEAVCATFANYAQACARQHIYVHWRKPGFCERVCPGGQLYSDCVSSCPPSCSAVAQGEEGSCGKECVSGCECPTGLFWDGALCVPAAHCPCYHRRQRYAPGDTVKQQCNPCVCQDGRWHCAQALCPAECAVGGDGHYFTFDGRSFFFRGTPGCHYSLVQDSV-----KGQLLVVLEHGACDTGSCL------------HALSVFLGNTHIQLRYSG--------AVLVDGED--VDLPW-IGVEGFNISWASSTFLLLHWPGAWVLWGVAEPAAYITLDPRHAYQVQGLCGTFTWKQQDDFLTPAGDIETSVTAFASKFQVSGDGRCPLVDKSPLFCSSYSQHLTFTEAACAILHGHAFQECHG--LVDREPFRLRCLEAVCGCAPGRDCL--CPVLSAYTRHCAQEGVLLQ--WRNETL---CPVSCPGGQVYQECAPVCGHHCGEPEDC---KELGICVAGCNCPPGLLWDLEGQCVPPSMCHCQF----------GGHRYTINTTTVRDCSHCICQERGLWNC-TAHHCPRQWALCPRELIYVPGACLLTCDSPRANHSCWAGST--DGCVCPPGTV-LLDKHCVSPDLCPCRHNGQWYPPNATIQEDCNICVCQGQRWHCTGQ---RCSGWCQASGAPHYVTFDGLVFTFPGACEYLLVREAGGR------FSVSVQNLPCGASGLTCTKALVVRLDSTVVHMLRGQAVTVN---GVSIRLPKVYTGPGLSLHHAGLFLLLTTRLGLTLLWDGGTRVLVQLSPHFHGRVAGLCGNFDSDASNDLRSRQGVLEPTAELTAHSWRLNP------LCPEPGDLPHP------VNAHRANWARARCEVILQP--IFAPC----HTEVPPQQYYEWCVYDACGCDTGGDCECLCSAIATYADECARHRHHVRWRSQELCPLQCEGGQVYEPCGSTCPPTCHDHHSELRWHCQVITCVEGCFCPEGTLLHGGACMKLAACPCEWQGSFFPPGTVLQ-KDCGNCTCQGSQWHCDRGGAPCEDMEPGCAEGETLCRENGHCVPLEWLCDNQDDCGDGSDEEGCATSVCGEGQMSCQS-GHCLPLSLICDGQDDCGDGTDEQGCLCPHGSLACADGR-CLPPALLCNGHPDC--LDAADEESC 1364          

HSP 2 Score: 76.6406 bits (187), Expect = 3.194e-13
Identity = 77/318 (24.21%), Postives = 115/318 (36.16%), Query Frame = 3
Query: 2139 DSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSH---FKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY--------------ITGSCDN------TPQSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYAT----YCRREQSSN--KDQL-SYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNC 3002
            +S      D  D     P T+ D  +          +  V S      +  D S SI I V         GLCG ++G  E+DF E    +         S+              +   C++      T    V   A   D+C  +L GP F  C    + D E++ T    YC    + N  + QL + C+   N A AC R  I           + C      GG ++  C  +C  +C  + +     C  +C  GCECP   +  G   CV  + C C++  +   P    G  +   C  CVC +GR +C
Sbjct:  130 NSSAGSLEDPADELGVWPLTLNDPILFPGMSLQWQGDWLVLSGGLGVVVRLDRSSSISISVDHEFWGRTQGLCGLYNGRPEDDFVEPGGGLATLAATFGNSWKLPGSEPGCLDAVEVAWGCESLLGGTLTDLEAVKLQAQAQDMCHQLLEGP-FWQCHGQVQPD-EYHETCLFAYCVGATAGNGPEGQLEAVCATFANYAQACARQHIYVHWRKPGFCERVC-----PGGQLYSDCVSSCPPSCSAVAQGEEGSCGKECVSGCECPTGLFWDGA-LCVPAAHCPCYHRRQRYAP----GDTVKQQCNPCVCQDGRWHC 435          

HSP 3 Score: 65.4698 bits (158), Expect = 8.354e-10
Identity = 58/215 (26.98%), Postives = 89/215 (41.40%), Query Frame = 3
Query: 4242 EGCSCPNGMID-LNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCI--TTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDE--KNCNV----------------------------------CDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCG--CLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEE 4763
            +GC CP+G +   +G C+PP       NG                  C+ A      D   C+   +C   +  C DG C+ + ++CD V DC +  DE   +C++                                  C L +FQC ++G C P   +CD  ++C D SDE+ CG  C+ +Q+ C  S  C+   ++CDG   C   D SDE+
Sbjct: 1326 QGCLCPHGSLACADGRCLPPAL---LCNGHP---------------DCLDAA-----DEESCLGPVSCISGEVSCVDGTCVRTIQLCDGVWDCPDGADEGPSHCSLPSLPTPPGGIGQNPSTSSLDTAPSPVGSTSPASPCSLLEFQC-NSGECTPRGWRCDQEEDCTDGSDELDCGGPCMLYQVPCAHSPHCVSPGQLCDGVTQC--PDGSDED 1514          

HSP 4 Score: 62.003 bits (149), Expect = 9.781e-9
Identity = 42/107 (39.25%), Postives = 48/107 (44.86%), Query Frame = 3
Query: 1581 CETQCPGNKIW---SDCASE---CPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCG 1883
            C  QCPGN ++     C  E   CP  C  L Q P   C  S    C C  G   +  +C+    CPC   GQ + PG V   DCN CTC S    CT K CP  CG
Sbjct: 2718 CTAQCPGNMVFRSAEQCLEEGGPCPQLC--LAQDPGVECTGSCAPSCNCPPGLFLHNASCLPRSQCPCQLHGQLYAPGAVAHLDCNNCTCISGEMVCTSKRCPVACG 2822          

HSP 5 Score: 56.9954 bits (136), Expect = 2.860e-7
Identity = 40/132 (30.30%), Postives = 60/132 (45.45%), Query Frame = 3
Query: 4428 TTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNC-NVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISR-------------TCIEEKKICDGNYDCGVNDKS----DEENC 4769
            + C+  +F+C+ G+C      CD+  DC++  DE +C   C L Q  C  +  C+   + CDG   C D SDE    C         +R             TCI+   +CDGN DC + D++    DE+ C
Sbjct: 1441 SPCSLLEFQCNSGECTPRGWRCDQEEDCTDGSDELDCGGPCMLYQVPCAHSPHCVSPGQLCDGVTQCPDGSDEDPDVCEEQSASGGANRTGAPCPEFSCPDGTCIDFLLVCDGNPDCELADETEPSLDEQGC 1572          

HSP 6 Score: 54.299 bits (129), Expect = 2.074e-6
Identity = 36/112 (32.14%), Postives = 52/112 (46.43%), Query Frame = 3
Query: 2766 CQSTCRELNEATA-SKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDT 3098
            C+ TC E+N   A S C +   PGC C   Y+++ TG CV E  C CW+   P  P    G+     C++C C++G+  C    +C    C + +V M     C      DT
Sbjct: 4791 CEKTCPEMNMTQAWSNCTEAQAPGCVCQLGYFRSQTGLCVPEDHCECWHHGSPHLP----GSEWQEACESCRCLHGKSVCIR--HCPELSCAQGEVIMQEPGSCCPICQQDT 4896          
BLAST of SCO-spondin vs. Ensembl Mouse
Match: Muc5ac (mucin 5, subtypes A and C, tracheobronchial/gastric [Source:MGI Symbol;Acc:MGI:104697])

HSP 1 Score: 398.282 bits (1022), Expect = 4.696e-112
Identity = 364/1291 (28.20%), Postives = 557/1291 (43.14%), Query Frame = 3
Query:  771 CHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVA----SFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRLK---FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQ-WRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEV-----EYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNG--SDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYIT-GSCDNTPQSIVDP-------PAGDNDICSTILN--GPEFSGCMNSSKVDKEFYATYCRREQSS-NKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFP--GCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMD--------SVSGC-NSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLM-DTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQL-----VSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKY-EDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMC-----EGG--KHYDACASPCPQTCDTIGSNAPSHC-STTHCVEGC--SCP-------NGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKME-NCKKCQCVQAKFNCTEDYSDCITTCTPSQFR 4454
            C ++G  +Y+TFD Q++ + G C+Y+ +A    +   ++I +      S+T  +  + ++   +VV+ + + +L     NN    L  + +   + +    + V+ +   + +  E  ++ L+ D                   GLCG+ + +P ++    +NV      FGN  K  G P          P     A     ++ LK   F GCA LV+  +Y   C Q++C        +LD    SD +C  L+ YS  C+  G   Q WR   LC   CP N    +C S C  TC N     S  C++  +  C C  G V     + G  C+    C CLY+G  + PGT    DC  CTC+   W C +  C  TC +MG +   TFDG ++  +   C YV  +P        +N F ++    +  L TE  +      K VT+ + G  ++I++KAT          VF++     T+LP +  +          I  E  +    ++         +++   L+    GLCG F+    +DF      +  +      ++ T  +C N      DP              CS + N  GP FS C   + V+   + + C  +  +  K +   C+A+ +   AC   G+     +   I       C    T +Q    TCQ TCR LNE   + C     P  GC CP   +    G+CV  + C C+     K   +P G ++  +   C C  G L C      T PVC    +Y D        + +GC  SC   D    +S     C CPN  V+  +G CV   DCPC++    Y P + I + C    C NRMW    +    C A C  YGD HY T DGQ +SF G C YTL+ D  G + ++     +   NI CG +  TC+K ++I +G     LS    + +    + D+  E   F  Q+     V   IGL +LWD+ T ++L L P F+G V GLCGN+D +  N++   +     D ++F  S+  +   CP  + P         +D C ANP RKSWA++ C ++      F++C    H +  +YY  C+ DAC C+ GGDCEC CT++A +A  C  +G+ V WRT ++CP+ C     EG    HY  C +PC +TC     N    C      +EGC   CP        G +     C    T PC  NG+ Y  GA +  + NC  C C ++   CT +   C+ T    QF 
Sbjct:   80 CSTWGNFHYKTFDGQVFYFPGLCNYVFSAHCGDAYEDFNIQLRRVQ-ESNTTTLSRVTMKLDGLVVELTKSSVLV----NNHPVQLPFSQSGVLIELSNGYLKVVARLGLLFVWNEDDSLLLELDTKYT-----------NKTCGLCGDFNGSPKSNEFLSNNVRLTPLEFGNLQKMDG-PTEQCQDPLPVPQKNCSARSGICEMILKGELFSGCAALVDISSYVEACRQDVCLCE-----SLDP---SDCICHTLAEYSRQCAHAGGQPQDWRGPNLCSQTCPLNMQHQECGSPCVDTCSNPQH--SQVCEDHCIAGCFCPEGMVLDDINQMG--CVPVSQCACLYNGTLYAPGTNYSTDCTKCTCSGGQWSCQDIPCAGTCSVMGGSHMSTFDGRQYTVHG-DCTYVLSKPC------DSNAFTVLVELRKCGL-TESETCL----KTVTLNLGGGQTEIMVKATG--------EVFVN--QIYTQLPVSTANATFFRPSTFFIVGETNLGLQLEIQLSPIMQTSVRLKPGLRGLTCGLCGNFNSMQADDFQTISGVVEGTAAAFFNTFKTQAACPNVKNIFQDPCSLSVENEKYAQHWCSLLTNASGP-FSQCH--ATVNPSTFFSNCMYDTCNCEKSEDCMCAALSSYVRACAAKGVLLS-DWRDGICTKPTITCPKSMT-YQYHISTCQPTCRALNEKDVT-CHVSFIPVDGCTCPKGTFLDDLGKCVQATSCPCYY----KGSTVPNGESVQDSGAICTCTQGALTCIGGPAPT-PVCDAPMIYFDCHNATPGDTGAGCQKSCHTLDMTCYSSECVPGCVCPNGLVADGNGGCVVTEDCPCVHNEATYRPGETIQVGCNNCTCENRMWQCTDKP---CLATCAVYGDGHYITFDGQRYSFNGDCEYTLLQDNCGGNGSSQDAFRVITENIPCGTTGTTCSKSIKIFLGNYELKLSDSKMEVV----QKDVGQEPPYFVHQMGNYLVVETDIGLVLLWDKKTSIFLRLSPEFKGRVCGLCGNFDDNAINDFTTRSQSVVSDMLEFGNSWKLSPS-CPDVLVP---------KDPCTANPYRKSWAQKQCSIINSE--TFSAC--HAHVEPAKYYEACVNDACACDSGGDCECFCTTVAAYAQACHEVGVCVSWRTPDICPLFCDYYNPEGQCEWHYQPCGAPCMRTCQ----NPTGQCLQDLRGLEGCYPKCPPTAPIFDEGTMQCVSNCT--VTFPCRVNGKLYRPGASVPSDKNCDSCICTESGVRCTHNAGACVCTYNGQQFH 1281          

HSP 2 Score: 125.561 bits (314), Expect = 4.362e-28
Identity = 113/408 (27.70%), Postives = 170/408 (41.67%), Query Frame = 3
Query: 3225 NDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRG----NNDTIPL-FPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQ-NEYMHGTMKYEDAIQFAESFIANADICPYEISPENNV-APSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFL-GIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCST--THCVEGCSCPNGMI--DLNGE-CVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTE 4409
            N V  I   K I   R +N       +   VC  +G+ HYKT DGQ+F F G C Y      GD+  +     I +  +    S  T    V + + G    L++     NN  + L F +  ++IE    + ++V+  +GL  +W+    + L L   +     GLCG+++G  + NE++                  N  + P E      +  P+++       P +   A      M     +F+ C  A   D++ Y   C  D C C      +C+C +LA ++ QCA   G P  WR  NLC   C     +  C SPC  TC       P H      HC+ GC CP GM+  D+N   CVP + C C YNG  Y  G     + C KC C   +++C +
Sbjct:   54 NRVTIIPPLKTIPVVRAFN-----PGHTRRVCSTWGNFHYKTFDGQVFYFPGLCNYVFSAHCGDAYED---FNIQLRRVQ--ESNTTTLSRVTMKLDGLVVELTKSSVLVNNHPVQLPFSQSGVLIELSNGYLKVVA-RLGLLFVWNEDDSLLLELDTKYTNKTCGLCGDFNGSPKSNEFLSN----------------NVRLTPLEFGNLQKMDGPTEQCQDPLPVPQKNCSARSGICEMILKGELFSGC--AALVDISSYVEACRQDVCLCESLDPSDCICHTLAEYSRQCAHAGGQPQDWRGPNLCSQTCPLNMQHQECGSPCVDTCSN-----PQHSQVCEDHCIAGCFCPEGMVLDDINQMGCVPVSQCACLYNGTLYAPGTNYSTD-CTKCTCSGGQWSCQD 426          

HSP 3 Score: 88.9669 bits (219), Expect = 6.412e-17
Identity = 113/454 (24.89%), Postives = 172/454 (37.89%), Query Frame = 3
Query:  582 QLYCYQSDQCFAFKKSDFLGKAVSYDECCADKTGSWGSQSGSCVSCKANFAGGNDVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAG----DVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXV-----ASFGNSFKG-FGCPDIANTLS---TCKPDDQILANQQCSKI---RLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQ-WRSDTLCET---QCPGNKIWSDCASECPVTCRNLFQTPSAYCQNS--KVGRCICGSGE-VEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPS 1874
            Q+ C    QC             +Y   C   T S G  S   + C                TC   G  +  TFD + YT  G C+Y+L+ P D +A T  + +     T    C+K + +  G    +++VK++G   +     N   T L V+  ++    P T   V   +  + L ++   I                    G   GLCGN ++  ++DF     V     A+F N+FK    CP++ N      +   +++  A   CS +      F  C   VN  T+FS C+ + C   ++           D +C  LS+Y  +C+ KG  +  WR D +C      CP +  +    S C  TCR L +     C  S   V  C C  G  ++    C++  SCPC Y G   P G   Q     CTC      C     P+
Sbjct:  384 QMGCVPVSQCACLYNGTLYAPGTNYSTDCTKCTCSGGQWSCQDIPCAG--------------TCSVMGGSHMSTFDGRQYTVHGDCTYVLSKPCDSNAFTVLVELRKCGLTESETCLKTVTLNLGGGQTEIMVKATGEVFV-----NQIYTQLPVSTANATFFRPSTFFIVGETNLGLQLEIQLSPI--------MQTSVRLKPGLRGLTCGLCGNFNSMQADDFQTISGVVEGTAAAFFNTFKTQAACPNVKNIFQDPCSLSVENEKYAQHWCSLLTNASGPFSQCHATVNPSTFFSNCMYDTCNCEKS----------EDCMCAALSSYVRACAAKGVLLSDWR-DGICTKPTITCPKSMTYQYHISTCQPTCRALNEK-DVTCHVSFIPVDGCTCPKGTFLDDLGKCVQATSCPCYYKGSTVPNGESVQDSGAICTCTQGALTCIGGPAPT 798          

HSP 4 Score: 80.1073 bits (196), Expect = 3.226e-14
Identity = 107/416 (25.72%), Postives = 165/416 (39.66%), Query Frame = 3
Query:  762 FTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPS--DVSAVTWSINIVYENC---TSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCG-----XXXXXXXXXXXXXXXVASFGNSFK-GFGCPDIANTLSTC--KPDDQILANQQCSKIRLK-FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLC---------ETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVG------RC-----ICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFD--CNTCTCNSSLWHCTEKICPSTCGIMGTQF 1901
              TC  YG  +Y TFD Q Y++ G C Y L   +     +   +  ++ EN    T+ T C K I I  G+  +K S        DS      + V   D   +    P +V +  N++++  + G + L WD          +  + G V GLCG       ++  +   S   ++  FGNS+K    CPD+      C   P  +  A +QCS I  + F  C   V    Y+  CV + C          D     +  CT ++AY+ +C + G C+ WR+  +C         E QC  +  +  C + C  TC+N    P+  C     G      +C     I   G ++    C    + PC  +G+ + PG     D  C++C C  S   CT       C   G QF
Sbjct:  899 LATCAVYGDGHYITFDGQRYSFNGDCEYTLLQDNCGGNGSSQDAFRVITENIPCGTTGTTCSKSIKIFLGNYELKLS--------DSK-----MEVVQKD---VGQEPPYFVHQMGNYLVVETDIG-LVLLWD-KKTSIFLRLSPEFKGRVCGLCGNFDDNAINDFTTRSQSVVSDMLEFGNSWKLSPSCPDVLVPKDPCTANPYRKSWAQKQCSIINSETFSACHAHVEPAKYYEACVNDAC--------ACDSGGDCECFCTTVAAYAQACHEVGVCVSWRTPDICPLFCDYYNPEGQCEWH--YQPCGAPCMRTCQN----PTGQCLQDLRGLEGCYPKCPPTAPIFDEGTMQCVSNCTV--TFPCRVNGKLYRPGASVPSDKNCDSCICTESGVRCTHNAGACVCTYNGQQF 1280          

HSP 5 Score: 70.8626 bits (172), Expect = 1.934e-11
Identity = 96/395 (24.30%), Postives = 161/395 (40.76%), Query Frame = 3
Query: 1854 TEKICPSTCGIMGTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDD-RANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSE-NDFTEKDNSIRESIVNIAK-SYITGSCDNTPQSIVDPP---AGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQ---SSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQ--CVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCK 3005
            T ++C ST G     + TFDG  F F  + C YV      +  +D    +  + +SNT ++               VT+K++G  + L         ++++V ++  +H  +LPF+   ++  + +L+N Y +V         ++   S+ +++     N   GLCG F+G+ + N+F    N++R + +       + G  +     +  P    +  + IC  IL G  FSGC  ++ VD   Y   CR++     S       C  +   +  C   G Q +     N+     PL        Q C   C  TC   N   +  C+D C  GC CP         Q  CV  S+C C        P    GTN + +C  C C  G+ +C+
Sbjct:   76 TRRVC-STWGNF--HYKTFDGQVFYFPGL-CNYVFSAHCGDAYEDFNIQLRRVQESNTTTL-------------SRVTMKLDGLVVEL---------TKSSVLVN--NHPVQLPFS---QSGVLIELSNGYLKVVARLGLLFVWNEDDSLLLELDTKYTNKTCGLCGDFNGSPKSNEFL--SNNVRLTPLEFGNLQKMDGPTEQCQDPLPVPQKNCSARSGICEMILKGELFSGC--AALVDISSYVEACRQDVCLCESLDPSDCICHTLAEYSRQCAHAGGQPQDWRGPNLCSQTCPL----NMQHQECGSPCVDTCS--NPQHSQVCEDHCIAGCFCPEGMVLDDINQMGCVPVSQCACLYNGTLYAP----GTNYSTDCTKCTCSGGQWSCQ 425          
BLAST of SCO-spondin vs. Ensembl Mouse
Match: Muc5ac (mucin 5, subtypes A and C, tracheobronchial/gastric [Source:MGI Symbol;Acc:MGI:104697])

HSP 1 Score: 394.045 bits (1011), Expect = 7.403e-111
Identity = 364/1291 (28.20%), Postives = 557/1291 (43.14%), Query Frame = 3
Query:  771 CHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVA----SFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRLK---FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQ-WRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEV-----EYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNG--SDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYIT-GSCDNTPQSIVDP-------PAGDNDICSTILN--GPEFSGCMNSSKVDKEFYATYCRREQSS-NKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFP--GCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMD--------SVSGC-NSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLM-DTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQL-----VSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKY-EDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMC-----EGG--KHYDACASPCPQTCDTIGSNAPSHC-STTHCVEGC--SCP-------NGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKME-NCKKCQCVQAKFNCTEDYSDCITTCTPSQFR 4454
            C ++G  +Y+TFD Q++ + G C+Y+ +A    +   ++I +      S+T  +  + ++   +VV+ + + +L     NN    L  + +   + +    + V+ +   + +  E  ++ L+ D                   GLCG+ + +P ++    +NV      FGN  K  G P          P     A     ++ LK   F GCA LV+  +Y   C Q++C        +LD    SD +C  L+ YS  C+  G   Q WR   LC   CP N    +C S C  TC N     S  C++  +  C C  G V     + G  C+    C CLY+G  + PGT    DC T TC+   W C +  C  TC +MG +   TFDG ++  +   C YV  +P        +N F ++    +  L TE  +      K VT+ + G  ++I++KAT          VF++     T+LP +  +          I  E  +    ++         +++   L+    GLCG F+    +DF      +  +      ++ T  +C N      DP              CS + N  GP FS C   + V+   + + C  +  +  K +   C+A+ +   AC   G+     +   I       C    T +Q    TCQ TCR LNE   + C     P  GC CP   +    G+CV  + C C+     K   +P G ++  +   C C  G L C      T PVC    +Y D        + +GC  SC   D    +S     C CPN  V+  +G CV   DCPC++    Y P + I + C    C NRMW    +    C A C  YGD HY T DGQ +SF G C YTL+ D  G + ++     +   NI CG +  TC+K ++I +G     LS    + +    + D+  E   F  Q+     V   IGL +LWD+ T ++L L P F+G V GLCGN+D +  N++   +     D ++F  S+  +   CP  + P         +D C ANP RKSWA++ C ++      F++C    H +  +YY  C+ DAC C+ GGDCEC CT++A +A  C  +G+ V WRT ++CP+ C     EG    HY  C +PC +TC     N    C      +EGC   CP        G +     C    T PC  NG+ Y  GA +  + NC  C C ++   CT +   C+ T    QF 
Sbjct:   80 CSTWGNFHYKTFDGQVFYFPGLCNYVFSAHCGDAYEDFNIQLRRVQ-ESNTTTLSRVTMKLDGLVVELTKSSVLV----NNHPVQLPFSQSGVLIELSNGYLKVVARLGLLFVWNEDDSLLLELDTKYT-----------NKTCGLCGDFNGSPKSNEFLSNNVRLTPLEFGNLQKMDG-PTEQCQDPLPVPQKNCSARSGICEMILKGELFSGCAALVDISSYVEACRQDVCLCE-----SLDP---SDCICHTLAEYSRQCAHAGGQPQDWRGPNLCSQTCPLNMQHQECGSPCVDTCSNPQH--SQVCEDHCIAGCFCPEGMVLDDINQMG--CVPVSQCACLYNGTLYAPGTNYSTDC-TNTCSGGQWSCQDIPCAGTCSVMGGSHMSTFDGRQYTVHG-DCTYVLSKPC------DSNAFTVLVELRKCGL-TESETCL----KTVTLNLGGGQTEIMVKATG--------EVFVN--QIYTQLPVSTANATFFRPSTFFIVGETNLGLQLEIQLSPIMQTSVRLKPGLRGLTCGLCGNFNSMQADDFQTISGVVEGTAAAFFNTFKTQAACPNVKNIFQDPCSLSVENEKYAQHWCSLLTNASGP-FSQC--HATVNPSTFFSNCMYDTCNCEKSEDCMCAALSSYVRACAAKGVLLS-DWRDGICTKPTITCPKSMT-YQYHISTCQPTCRALNEKDVT-CHVSFIPVDGCTCPKGTFLDDLGKCVQATSCPCYY----KGSTVPNGESVQDSGAICTCTQGALTCIGGPAPT-PVCDAPMIYFDCHNATPGDTGAGCQKSCHTLDMTCYSSECVPGCVCPNGLVADGNGGCVVTEDCPCVHNEATYRPGETIQVGCNNCTCENRMWQCTDKP---CLATCAVYGDGHYITFDGQRYSFNGDCEYTLLQDNCGGNGSSQDAFRVITENIPCGTTGTTCSKSIKIFLGNYELKLSDSKMEVV----QKDVGQEPPYFVHQMGNYLVVETDIGLVLLWDKKTSIFLRLSPEFKGRVCGLCGNFDDNAINDFTTRSQSVVSDMLEFGNSWKLSPS-CPDVLVP---------KDPCTANPYRKSWAQKQCSIINSE--TFSAC--HAHVEPAKYYEACVNDACACDSGGDCECFCTTVAAYAQACHEVGVCVSWRTPDICPLFCDYYNPEGQCEWHYQPCGAPCMRTCQ----NPTGQCLQDLRGLEGCYPKCPPTAPIFDEGTMQCVSNCT--VTFPCRVNGKLYRPGASVPSDKNCDSCICTESGVRCTHNAGACVCTYNGQQFH 1280          

HSP 2 Score: 123.635 bits (309), Expect = 1.707e-27
Identity = 117/429 (27.27%), Postives = 172/429 (40.09%), Query Frame = 3
Query: 3225 NDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRG----NNDTIPL-FPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQ-NEYMHGTMKYEDAIQFAESFIANADICPYEISPENNV-APSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFL-GIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCST--THCVEGCSCPNGMI--DLNGE-CVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCDDGKC 4472
            N V  I   K I   R +N       +   VC  +G+ HYKT DGQ+F F G C Y      GD+  +     I +  +    S  T    V + + G    L++     NN  + L F +  ++IE    + ++V+  +GL  +W+    + L L   +     GLCG+++G  + NE++                  N  + P E      +  P+++       P +   A      M     +F+ C  A   D++ Y   C  D C C      +C+C +LA ++ QCA   G P  WR  NLC   C     +  C SPC  TC       P H      HC+ GC CP GM+  D+N   CVP + C C YNG  Y  G                    T   +DC  TC+  Q+ C D  C
Sbjct:   54 NRVTIIPPLKTIPVVRAFN-----PGHTRRVCSTWGNFHYKTFDGQVFYFPGLCNYVFSAHCGDAYED---FNIQLRRVQ--ESNTTTLSRVTMKLDGLVVELTKSSVLVNNHPVQLPFSQSGVLIELSNGYLKVVA-RLGLLFVWNEDDSLLLELDTKYTNKTCGLCGDFNGSPKSNEFLSN----------------NVRLTPLEFGNLQKMDGPTEQCQDPLPVPQKNCSARSGICEMILKGELFSGC--AALVDISSYVEACRQDVCLCESLDPSDCICHTLAEYSRQCAHAGGQPQDWRGPNLCSQTCPLNMQHQECGSPCVDTCSN-----PQHSQVCEDHCIAGCFCPEGMVLDDINQMGCVPVSQCACLYNGTLYAPG--------------------TNYSTDCTNTCSGGQWSCQDIPC 428          

HSP 3 Score: 89.3521 bits (220), Expect = 4.988e-17
Identity = 112/456 (24.56%), Postives = 171/456 (37.50%), Query Frame = 3
Query:  582 QLYCYQSDQCFAFKKSDFLGKAVSYDECCAD--KTGSWGSQSGSCVSCKANFAGGNDVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAG----DVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXV-----ASFGNSFKG-FGCPDIANTLS---TCKPDDQILANQQCSKI---RLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQ-WRSDTLC---ETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNS--KVGRCICGSGE-VEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPS 1874
            Q+ C    QC             +Y   C +    G W  Q   C                   TC   G  +  TFD + YT  G C+Y+L+ P D +A T  + +     T    C+K + +  G    +++VK++G   +     N   T L V+  ++    P T   V   +  + L ++   I                    G   GLCGN ++  ++DF     V     A+F N+FK    CP++ N      +   +++  A   CS +      F  C   VN  T+FS C+ + C   ++           D +C  LS+Y  +C+ KG  +  WR D +C      CP +  +    S C  TCR L +     C  S   V  C C  G  ++    C++  SCPC Y G   P G   Q     CTC      C     P+
Sbjct:  384 QMGCVPVSQCACLYNGTLYAPGTNYSTDCTNTCSGGQWSCQDIPCAG-----------------TCSVMGGSHMSTFDGRQYTVHGDCTYVLSKPCDSNAFTVLVELRKCGLTESETCLKTVTLNLGGGQTEIMVKATGEVFV-----NQIYTQLPVSTANATFFRPSTFFIVGETNLGLQLEIQLSPI--------MQTSVRLKPGLRGLTCGLCGNFNSMQADDFQTISGVVEGTAAAFFNTFKTQAACPNVKNIFQDPCSLSVENEKYAQHWCSLLTNASGPFSQCHATVNPSTFFSNCMYDTCNCEKS----------EDCMCAALSSYVRACAAKGVLLSDWR-DGICTKPTITCPKSMTYQYHISTCQPTCRALNEK-DVTCHVSFIPVDGCTCPKGTFLDDLGKCVQATSCPCYYKGSTVPNGESVQDSGAICTCTQGALTCIGGPAPT 797          

HSP 4 Score: 80.8777 bits (198), Expect = 1.785e-14
Identity = 107/416 (25.72%), Postives = 165/416 (39.66%), Query Frame = 3
Query:  762 FTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPS--DVSAVTWSINIVYENC---TSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCG-----XXXXXXXXXXXXXXXVASFGNSFK-GFGCPDIANTLSTC--KPDDQILANQQCSKIRLK-FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLC---------ETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVG------RC-----ICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFD--CNTCTCNSSLWHCTEKICPSTCGIMGTQF 1901
              TC  YG  +Y TFD Q Y++ G C Y L   +     +   +  ++ EN    T+ T C K I I  G+  +K S        DS      + V   D   +    P +V +  N++++  + G + L WD          +  + G V GLCG       ++  +   S   ++  FGNS+K    CPD+      C   P  +  A +QCS I  + F  C   V    Y+  CV + C          D     +  CT ++AY+ +C + G C+ WR+  +C         E QC  +  +  C + C  TC+N    P+  C     G      +C     I   G ++    C    + PC  +G+ + PG     D  C++C C  S   CT       C   G QF
Sbjct:  898 LATCAVYGDGHYITFDGQRYSFNGDCEYTLLQDNCGGNGSSQDAFRVITENIPCGTTGTTCSKSIKIFLGNYELKLS--------DSK-----MEVVQKD---VGQEPPYFVHQMGNYLVVETDIG-LVLLWD-KKTSIFLRLSPEFKGRVCGLCGNFDDNAINDFTTRSQSVVSDMLEFGNSWKLSPSCPDVLVPKDPCTANPYRKSWAQKQCSIINSETFSACHAHVEPAKYYEACVNDAC--------ACDSGGDCECFCTTVAAYAQACHEVGVCVSWRTPDICPLFCDYYNPEGQCEWH--YQPCGAPCMRTCQN----PTGQCLQDLRGLEGCYPKCPPTAPIFDEGTMQCVSNCTV--TFPCRVNGKLYRPGASVPSDKNCDSCICTESGVRCTHNAGACVCTYNGQQF 1279          

HSP 5 Score: 65.855 bits (159), Expect = 6.035e-10
Identity = 96/395 (24.30%), Postives = 161/395 (40.76%), Query Frame = 3
Query: 1854 TEKICPSTCGIMGTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDD-RANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSE-NDFTEKDNSIRESIVNIAK-SYITGSCDNTPQSIVDPP---AGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQ---SSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQ--CVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCK 3005
            T ++C ST G     + TFDG  F F  + C YV      +  +D    +  + +SNT ++               VT+K++G  + L         ++++V ++  +H  +LPF+   ++  + +L+N Y +V         ++   S+ +++     N   GLCG F+G+ + N+F    N++R + +       + G  +     +  P    +  + IC  IL G  FSGC  ++ VD   Y   CR++     S       C  +   +  C   G Q +     N+     PL        Q C   C  TC   N   +  C+D C  GC CP         Q  CV  S+C C        P    GTN + +C T  C  G+ +C+
Sbjct:   76 TRRVC-STWGNF--HYKTFDGQVFYFPGL-CNYVFSAHCGDAYEDFNIQLRRVQESNTTTL-------------SRVTMKLDGLVVEL---------TKSSVLVN--NHPVQLPFS---QSGVLIELSNGYLKVVARLGLLFVWNEDDSLLLELDTKYTNKTCGLCGDFNGSPKSNEFL--SNNVRLTPLEFGNLQKMDGPTEQCQDPLPVPQKNCSARSGICEMILKGELFSGC--AALVDISSYVEACRQDVCLCESLDPSDCICHTLAEYSRQCAHAGGQPQDWRGPNLCSQTCPL----NMQHQECGSPCVDTCS--NPQHSQVCEDHCIAGCFCPEGMVLDDINQMGCVPVSQCACLYNGTLYAP----GTNYSTDC-TNTCSGGQWSCQ 424          

HSP 6 Score: 52.373 bits (124), Expect = 8.133e-6
Identity = 46/178 (25.84%), Postives = 70/178 (39.33%), Query Frame = 3
Query: 1383 FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDT--LCETQCPGNKIWSDCASECPVTC-RNLFQTPSAYCQNS--KVGRCICGSGEVEYGYT----------CIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICP 1871
            F  C D++    ++  C+ + C         LD+    +V+C+ L  Y+  C+ +G CI WRS T   C   CP N+++  C    P  C R+   +PS   Q +  K   C C      +             C+ P        G+   PG     DC  C C  +   C +K CP
Sbjct: 2253 FKLCHDVIPPLQFYQGCLFDYCH-------MLDL----EVVCSGLELYASLCAAQGVCIPWRSQTNNTCSFTCPDNQVYQPCGPSNPHYCYRDDSISPSLTLQEAGPKTEGCFCPDSTTLFSTNDSICVPSCQWCLGPR-------GEPVEPGHTISIDCQDCICKEATLTCQKKACP 2412          
BLAST of SCO-spondin vs. UniProt/SwissProt
Match: sp|Q2PC93|SSPO_CHICK (SCO-spondin OS=Gallus gallus OX=9031 GN=SSPO PE=2 SV=1)

HSP 1 Score: 559.681 bits (1441), Expect = 7.016e-164
Identity = 453/1539 (29.43%), Postives = 682/1539 (44.31%), Query Frame = 3
Query:  606 QCFA-FKKSDFLGK----AVSYDECCADKTG-SWGSQSGS-CVSCKANFAGGN-----------DVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAG-NIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXX-----XXXXXXXXXVASFGNSFK------GFGCPDIANTLSTCKPDD--QILANQQCSKIRL-KFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY-------ITGSCDNTPQSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSS-NKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKC---DDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYM--DSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTI--------PLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDV--NRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITT--CTPSQFRC-DDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDE---ISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENC-KKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNC 5030
            QC A ++  D LG      VS  ECC    G SW + S + C +C      G+             +     +C  +    YR+FD + + +QG C+Y L A +D    TW+++I         G   V+ +  G   V + G+ I      N    P    +    +        V    +F+  ++E+G  + LK D    +++++   +  G   GLCG  +++P       +       ASFGNS++         C D       C      Q  A   C  +    F  C + V+   ++  C++  C +          PS    +C  L+ Y   C+ + + I+WR   LCE QC   + +SDC S CP +C         +C++     C C  G +     CI   +CPCL+ G  + PG   +  CN CTC    W CT+  C + C ++G   + TFD  +F+F    C+Y  V+  V  T       + I +  E+  G +  S      + +++ V G+   L +T          V +DG      LPF      + VR+ ++ +  ++      L+   + + YI +  A  N + GLCG ++ +  +DF      +   +   A  Y       +       P S   P          IL+G  F  C +   VD+E +   C  +  +    +   C A+   A  C + G        S     C      GG V+Q CS  C  TC +L    AS C   D+ C  GC CP        GQCV    C C + S+      PAG+ I   C  C+C  G  +C          CP + VY+    +  C+S     TCT    IA+ C CP  TV  +D  CV P +CPC +  R Y PND I   C   +C  + W   SE   +C   C+A GDPHY T DG+ FSF G C Y L+      +N +   T++  N+ CG S  TC K V + +G     + RG + T+         ++    + +++   F  L+S    L VLWD  TRVY+ L+P  +G V GLCGN+D D +N+        E   +   +    + +CP        V  +  Q  C  NP R +WA + C ++  T  +FA C    H +V    +Y  C++DACGC+ GGDCECLCT++AT+A +C+  GI ++WR+Q+LCP+ C+GG+ Y AC  PCPQTC  +G   P HC T  C+EGC CP G +   G C+ P  CPCF+ G ++ + A+++ + C+ C C    + C      C     C  S+F C   G+C+  + +CD   DC +  DE     C   Q +C ++G C+P   +CDG  +C D SDE       C P +  C   R CI    +C+G  DCG  D SDE  C   C + E++C   + C+   ++C+G DDCGD SDE GC C                  +  + QC+     CDG+ DC +G DE  C
Sbjct:  121 QCHASWQCQDALGAHNLSTVSMAECCRQPWGHSWRNGSSALCFACSRQPLTGDVPLPTAPRGPAARHRGPTASCTVWAGSRYRSFDGRHFGFQGECAYSLAASTDS---TWAVSIT-------PGSPPVLHMTFGLDTVVAQGHNI----SVNGVAVPEGRQHLHGGI-------SVTWLGDFV--AVESGLGVHLKLDGRGTVYVTVSAELR-GSTKGLCGPYNDDPIDDFLRVEGDVAPLAASFGNSWRIPDANPELSCSDAVEPSPGCAMGSTAQRAAEAMCGMLLTDPFRQCHEAVDPHGFYEACLELHCREGGTG------PSPPPAVCDTLATYVRDCAQRRAYIEWRRPGLCEQQCGHGQRYSDCVSSCPASCMAAGTAEEGHCRDDCASGCECTPGLLLDRGACIPQSACPCLHRGHIYAPGQSIRQRCNQCTCRGGRWLCTQDRCAAECAVLGDLHYITFDRRRFSFPGA-CEYTLVQDFVEGT-------LRITAEQEACGGHQPLSCL----RALSITVPGASARLHSTG--------EVVVDGR--VVPLPFA--SAALTVRRASSSFLLLQTFGAHLLWGLETPAAYITLQPAFANKVRGLCGTYNWDQRDDFATPAGDVEVGVTAFANKYRVSTDCPVLSPVPFEPCSTYAPRRELAAAACAILHGASFQPCHH--LVDREPFHQLCLYDVCACPAGKHCLCPALAAYARECAQEGAALSWRNESFCGTQC-----RGGQVYQECSSPCGRTCADLRLDGASSCPSLDNICVSGCNCPEGPVLDDGGQCVPPGVCPCQHSSQ----LYPAGSKIRQGCNACMCTAGTWSCTDAPCPDAAFCPGDLVYVFGSCLRTCDSAEPNGTCT---GIADGCVCPPGTVF-LDERCVPPEECPCQHNGRLYHPNDTIVRDCNTCVCRQQRWQCSSE---DCMGTCVATGDPHYITFDGRAFSFLGDCEYVLVR----EANGL--FTVTAENVPCGTSGVTCTKSVVVEMGNTVVHMLRGRDVTVNGVSVRPPKVYSGNGLTLQRAGIFLLLLSRLG-LAVLWDGGTRVYIRLQPQHRGRVVGLCGNFDRDAENDLASQQGVLEPTAELFGNSWRVSLLCP-------EVDGTTAQHPCTDNPHRATWARKRCSIL--TQRLFAPC----HDEVPCQHFYDWCIFDACGCDSGGDCECLCTAIATYAEECSQRGIHIRWRSQDLCPMQCDGGQEYSACGPPCPQTCRNLGLELPEHCDTMSCLEGCFCPEGKVLHEGSCIDPAECPCFWQGIAFPDSAVVQ-QGCRNCSCTAGLWQCVPTAEPCPAQPHCPDSEFPCRSGGRCVPGAWLCDNEDDCGDGSDEVCALHCAPHQHRC-ADGQCVPWGARCDGLSDCGDGSDERGCPPPPCAPPEFRCASGR-CIPRAHVCNGELDCGFADDSDEAGCSPSCSVGEFQCAAGR-CVPYPHRCNGHDDCGDFSDERGCVC-------------PAGHFQCPDAQCLPPAALCDGMQDCGDGTDEAFC 1550          

HSP 2 Score: 72.4034 bits (176), Expect = 5.452e-11
Identity = 60/229 (26.20%), Postives = 81/229 (35.37%), Query Frame = 3
Query: 4431 TCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCN------------------------VCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISC--GCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNCEIF 5039
            TC P Q  C DG C+   K+CD + DC +  DE +                          VC   +F C S G C+P    CD   +C DNSDE+ C   C+     C +   CI    +CDG   C  +    ++NC   Q+    C    +C   NN+                                          C+N T+ CDG  DC  G DE  CE +
Sbjct: 1555 TCAPGQLPCPDGSCVSQVKLCDGIWDCRDGWDESSVRCMVSWAPPAPTQLPTVPANGTAAPVCGPYEFPCRS-GQCVPRGWVCDSEADCPDNSDELGCNRSCVLGHFPCALGAHCIHYDHLCDGIPHCPDHSDESDDNCGSTQIP--PCPGHFVC---NNRV-----------------------------------------CVNATRVCDGALDCPQGEDELACEGY 1736          

HSP 3 Score: 56.6102 bits (135), Expect = 2.712e-6
Identity = 32/92 (34.78%), Postives = 44/92 (47.83%), Query Frame = 3
Query: 4176 CPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQF 4451
            CP  C  +G+       T  C  GC CP G++  NG CVPP+ C C + G  Y  G I  ++ C  C CV  +  C+ +   C   CT S +
Sbjct: 2980 CPWICQDLGAGV---ACTAQCQPGCHCPAGLLLQNGTCVPPSHCLCHHRGHLYQPGDINALDTCNNCTCVTGQMVCSTE--TCPVPCTWSNW 3066          

HSP 4 Score: 55.4546 bits (132), Expect = 6.280e-6
Identity = 40/147 (27.21%), Postives = 62/147 (42.18%), Query Frame = 3
Query: 2766 CQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSI-----------ANSCGCPNDTVSKIDGTC 3173
            C+ +CR++ + T + C     PGC C P +Y+  +G CV  + C C +  +   P    G+     C  C C++G+ NC   D CT   CP+ +V +     C      +   + SS+              C  PN  VS   G C
Sbjct: 5049 CEQSCRDILDETPANCTPSPSPGCTCEPGHYRNSSGHCVPSTLCECLHQGQLHQP----GSEWQEQCARCRCVDGKANC--TDGCTPLSCPEGEVKVREPGRCCPVCRMEWPEEPSSMCRRFTELRNITKGPCSLPNVEVSFCSGRC 5189          
BLAST of SCO-spondin vs. UniProt/SwissProt
Match: sp|Q700K0|SSPO_RAT (SCO-spondin OS=Rattus norvegicus OX=10116 GN=Sspo PE=2 SV=1)

HSP 1 Score: 480.715 bits (1236), Expect = 7.537e-138
Identity = 408/1457 (28.00%), Postives = 615/1457 (42.21%), Query Frame = 3
Query:  663 CCADKTGS--WGSQSGSCVSCKANFAGGN------------------DVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYE-NCTSDTGCVKVIVIEAGDVVVKSSG----NGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQD--NFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXX-----XXXXXXXXVASFGNSFK--GF--GCPDIANTLSTCKPD-DQILANQQCSKIRLK------------FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFN-DVGCQYVAVEPSVNNTDDRANVFVIIQSNT-ESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYIT---GSC---DNTPQS---IVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSS---NKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITI-NCQTCVCI-NGRLNCKTKDNCTN--PVCPKNQVYMDS--VSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVL----------WDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDV--NRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITT---CTPSQFRC-DDGKCIESSKICDKVTDCSNSEDEKNCN--VCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENC 4769
            CCA   G   W S S  C+SC      GN                          TC ++   +Y+TFD Q Y + G+C+Y+L    D    TW++++    +C     C  V VI   + V+   G     G       +  L  +S+      L++ G    V+R D  + I++S++                      + G   GLCG  +  P               A+FGNS++  G+  GC D       C+   +  L   +  K++ +            F  C   V  D Y   C+   C  +   +   +       +C   + Y+ +C+ +   + WR    CE  CPG +++SDC S CP +C  + Q     C    V  C C +G    G  C+    CPC Y  Q + PG   +  CN C C    WHC +  CP+ C + G   + TFDG  F+F  + GCQY  V+ SV     +  + V+++    E+       SA++ +  I  ++ +G+                 V +DG+D    LP+ I  +  +V   ++ +  ++    + L+     ++YI +       + GLCG F    ++DF      I  S+   A  +     G C   DNTP S            +     L+G  F  C     V++E +   C     S    +D L  CS +   A  C + G+  +     N     +P    GG V+Q C+  C   C E  +    K    C  GC CPP       GQCV  S C C    +         T  T+ +C  C+C   G  NC    +C     +CP+  +Y     +  C+S     +C   S+  + C CP+ TV  +D  CV P  CPC +  + Y PN  I   C   +C N+ W+   +    C   C A G PHY T DG +F+F G+C Y L+   G         ++S+ N+ CG S  TC K + + +      + RG   T+       I + ++     L     GL +L          WD  TRV + L P F G V GLCGN+DGD+ N+        E   +          +CP          P      C+ N  R +WA   C V+     +FA C    H +V   +YY  C+YDACGC+ GGDCECLC+++AT+A +CA     V+WR+Q LCP+ CEGG+ Y+ C S CP TC         HC    CVEGC CP G +   G CV  T CPC + G  +  GA+++ ++C  C C +++++C    + C      C   +  C + G C+    +CD   DC +  DE+ C+  VC   Q  C S G C+P++  CDG  +C D +DE  C C    + C   R C+    +CDG+ DC   D +DEE+C
Sbjct:  139 CCAQPWGHSWWNSSSQMCLSCSGQHRPGNASSEGLLQPLAGAVGQLWSQRQRPSATCATWSGFHYQTFDGQHYHFLGQCTYLLAGAMDS---TWAVHLRPSVHCPQPRQCWLVQVIMGPEEVLIQDGEVSVKGQPVPVGESQLLHGMSLQWQGDWLVLSGGLGVVVRLDRSSSIIISVD--------------------HEFWGRTQGLCGLYNGRPEDDFVEPGGGLAMLAATFGNSWRLPGYEPGCLDTVEVARGCEGLLEGTLTGLEAGKLQAQAQDLCHQLLEDPFSQCHGQVPPDEYHETCLFAYCVGATAGSGPEEQ---VKAVCATFANYAQACARQHIYVHWRKPGFCERLCPGGQLYSDCISSCPPSCSAVAQGEEGSCGKECVSGCECPTGLFWDGALCVPAAHCPCYYRRQRYAPGDTVKQQCNPCVCQDGRWHCAQAPCPAECAVGGDGHYCTFDGRSFSFRGNPGCQYSLVQDSV-----KGQLLVVLEHGACETGSCLHALSAFLGKTHI-QLRYSGA-----------------VLVDGQD--VDLPW-IGAEGFNVSHASSTFLLLRWPGAWVLWGVADPAVYITLDPRHAYQVQGLCGTFTWKQQDDFLTPAGDIETSVTAFASKFQVSGDGRCPLVDNTPLSSCSTYSQRLAFAEAACAALHGHAFQECHG--LVEREPFRLRCLESMCSCAPGRDCL--CSVLSAYAHHCAQEGVLLQW---RNETLCSVPC--PGGQVYQECAPACGHYCGEPEDC---KELGSCVAGCNCPPGLLWDLEGQCVPPSMCPC----QLGGHRYAFNTTTTLKDCSHCICQERGLWNC-IAHHCPRQWALCPQELIYAPGACLLTCDSLGANHSCLAGST--DGCVCPSGTV-LLDKHCVSPDLCPCRHNGQWYPPNATIQEDCNICVCQNQRWHCTGQ---RCSGWCQASGAPHYVTFDGLVFTFPGACEYLLVREAGGR------FSVSIQNLPCGASGLTCTKALAVRLDSTVVHMLRGQAVTVN---GVSIKLPKVYTGPGLSLHHAGLFLLLTTRLGLTLLWDGGTRVLVQLSPHFHGRVTGLCGNFDGDVSNDLRSRQGVLEPTAELTAHSWRLNPLCP---------EPGDLPHPCSVNAHRVNWARAHCEVILQP--IFAPC----HTEVPPQQYYEWCVYDACGCDTGGDCECLCSAIATYADECARHRHHVRWRSQELCPLQCEGGQVYEPCGSTCPPTCHDHHPELRWHCQAITCVEGCFCPEGTLLHGGTCVELTDCPCEWQGSFFPPGAVLQ-KDCGNCTCQESQWHCNPSGAPCEEMEPGCAEGEALCRESGHCVPLEWLCDNQDDCGDGSDEEGCDTSVCGEGQMSCQS-GRCLPLSLICDGQDDCGDGTDEQGCLCPQGFLACADGR-CLPPALLCDGHPDC--LDAADEESC 1491          

HSP 2 Score: 62.003 bits (149), Expect = 7.578e-8
Identity = 41/107 (38.32%), Postives = 50/107 (46.73%), Query Frame = 3
Query: 1581 CETQCPGNKIW---SDCASE---CPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCG 1883
            C  QCPGN ++     C  E   CP  C  L Q P   C  S    C C  G   +  +C+    CPC   GQ + PG V + DCN CTC+S    CT + CP  CG
Sbjct: 2867 CTAQCPGNMVFRSAEKCLEEGGPCPQLC--LAQDPGVECTGSCAPGCSCPPGLFLHNASCLPRSQCPCQLHGQLYAPGAVARLDCNNCTCSSGEMVCTSERCPVACG 2971          

HSP 3 Score: 57.3806 bits (137), Expect = 1.905e-6
Identity = 40/132 (30.30%), Postives = 61/132 (46.21%), Query Frame = 3
Query: 4428 TTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNC-NVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGC-------------LPHQIVCNISRTCIEEKKICDGNYDCGVNDKS----DEENC 4769
            + C+ S+F+C+ G+C      CD+  DC++  DE +C   C L Q  C     C+   + CDG   C D SDE    C             +P       + TCI+   +CDG+ DC + D++    DE+ C
Sbjct: 1568 SPCSLSEFQCNSGECTPRGWRCDREEDCTDGSDELDCGGPCKLYQMPCAHGPHCLSPGQLCDGVAQCPDGSDEDPDVCEERSASGGPNGTAVPCPEFSCPNGTCIDFLLVCDGSPDCELADETEPSLDEQGC 1699          

HSP 4 Score: 55.8398 bits (133), Expect = 4.677e-6
Identity = 37/123 (30.08%), Postives = 58/123 (47.15%), Query Frame = 3
Query: 2736 GTVFQICS-RTCQSTCRELNEATA-SKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDT 3098
            G + Q+   R C+ TC E+N+  A S C +   PGC C   ++++ TG CV E  C CW+   P  P    G+     C++C C++G+  C    +C    C + +V +     C      DT
Sbjct: 4923 GEILQLGELRPCEKTCLEMNKTQAWSNCTEAQVPGCVCQLGHFRSHTGLCVPEDHCECWHHGSPHLP----GSEWQEACESCRCLHGKSVC--TQHCPELSCAQGEVVVQEPGSCCPICQQDT 5039          
BLAST of SCO-spondin vs. UniProt/SwissProt
Match: sp|Q8CG65|SSPO_MOUSE (SCO-spondin OS=Mus musculus OX=10090 GN=Sspo PE=2 SV=2)

HSP 1 Score: 436.802 bits (1122), Expect = 1.666e-123
Identity = 357/1233 (28.95%), Postives = 529/1233 (42.90%), Query Frame = 3
Query: 1260 VASFGNSFK--------------GFGCPDI-ANTLSTCKPDD-QILANQQCSKI-RLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDV-GCQYVAVEPSVNNTDDRANVFVIIQS---NTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYIT---GSC---DNTPQ--SIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQ---SSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITIN------CQTCVCI-NGRLNCKTKDNCTN--PVCPKNQVYMDS--VSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVL----------WDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQF-AESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDV--NRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDC---ITTCTPSQFRC-DDGKCIESSKICDKVTDCSNSEDEKNC--NVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENC 4769
             A+FGNS+K               +GC  +   TL+  +    Q  A   C ++    F  C   V  D Y   C+   C  +   N         + +C   + Y+ +C+ +   + WR    CE  CPG +++SDC S CP +C  + Q     C    V  C C +G    G  C+    CPC +  Q + PG   +  CN C C    WHC + +CP+ C + G   + TFDG  F F    GC Y  V+ SV     +  + V+++    +T S L              ++V +  + I L+ +          V +DGED    LP+ I  +  ++   ++ +  +     + L+     + YI +       + GLCG F    ++DF      I  S+   A  +     G C   D +P   S         +    IL+G  F  C     VD+E +   C       +  +D L  C  +      C + G+  +  + +  L    P+   GG V+Q C+  C   C E  +    K    C  GC CPP       GQCV  S C C             G   TIN      C  C+C   G  NC T  +C     +CP+  +Y+    +  C+S     +C   S+  + C CP  TV  +D  CV P  CPC +  + Y PN  I   C   +C  + W+   +    C   C A G PHY T DG +F+F G+C Y L+   G         ++SV N+ CG S  TC K + + +      + RG   T+       I + ++     L     GL +L          WD  TRV + L P F G V GLCGN+D D  N+        E   +  A S+  N       + PE    P         N  R +WA   C V+     +FA C    H +V   +YY  C+YDACGC+ GGDCECLC+++AT+A +CA     V+WR+Q LCP+ CEGG+ Y+ C S CP TC    S    HC    CVEGC CP G +   G C+    CPC + G  +  G +++ ++C  C C  ++++C    + C      C   +  C ++G C+    +CD   DC +  DE+ C  +VC   Q  C S G C+P++  CDG  +C D +DE  C C    + C   R C+    +C+G+ DC   D +DEE+C
Sbjct:  224 AATFGNSWKLPGSEPGCLDAVEVAWGCESLLGGTLTDLEAVKLQAQAQDMCHQLLEGPFWQCHGQVQPDEYHETCLFAYCVGATAGNGPE---GQLEAVCATFANYAQACARQHIYVHWRKPGFCERVCPGGQLYSDCVSSCPPSCSAVAQGEEGSCGKECVSGCECPTGLFWDGALCVPAAHCPCYHRRQRYAPGDTVKQQCNPCVCQDGRWHCAQALCPAECAVGGDGHYFTFDGRSFFFRGTPGCHYSLVQDSV-----KGQLLVVLEHGACDTGSCL------------HALSVFLGNTHIQLRYSG--------AVLVDGED--VDLPW-IGVEGFNISWASSTFLLLHWPGAWVLWGVAEPAAYITLDPRHAYQVQGLCGTFTWKQQDDFLTPAGDIETSVTAFASKFQVSGDGRCPLVDKSPLFCSSYSQHLTFTEAACAILHGHAFQECHG--LVDREPFRLRCLEAVCGCAPGRDCL--CPVLSAYTRHCAQEGVLLQ--WRNETL---CPVSCPGGQVYQECAPVCGHHCGEPEDC---KELGICVAGCNCPPGLLWDLEGQCVPPSMCHCQF----------GGHRYTINTTTVRDCSHCICQERGLWNC-TAHHCPRQWALCPRELIYVPGACLLTCDSPRANHSCWAGST--DGCVCPPGTV-LLDKHCVSPDLCPCRHNGQWYPPNATIQEDCNICVCQGQRWHCTGQ---RCSGWCQASGAPHYVTFDGLVFTFPGACEYLLVREAGGR------FSVSVQNLPCGASGLTCTKALVVRLDSTVVHMLRGQAVTVN---GVSIRLPKVYTGPGLSLHHAGLFLLLTTRLGLTLLWDGGTRVLVQLSPHFHGRVAGLCGNFDSDASNDLRSRQGVLEPTAELTAHSWRLNP------LCPEPGDLPHP------VNAHRANWARARCEVILQP--IFAPC----HTEVPPQQYYEWCVYDACGCDTGGDCECLCSAIATYADECARHRHHVRWRSQELCPLQCEGGQVYEPCGSTCPPTCHDHHSELRWHCQVITCVEGCFCPEGTLLHGGACMKLAACPCEWQGSFFPPGTVLQ-KDCGNCTCQGSQWHCDRGGAPCEDMEPGCAEGETLCRENGHCVPLEWLCDNQDDCGDGSDEEGCATSVCGEGQMSCQS-GHCLPLSLICDGQDDCGDGTDEQGCLCPHGSLACADGR-CLPPALLCNGHPDC--LDAADEESC 1364          

HSP 2 Score: 76.6406 bits (187), Expect = 2.234e-12
Identity = 77/318 (24.21%), Postives = 115/318 (36.16%), Query Frame = 3
Query: 2139 DSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSH---FKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY--------------ITGSCDN------TPQSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYAT----YCRREQSSN--KDQL-SYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNC 3002
            +S      D  D     P T+ D  +          +  V S      +  D S SI I V         GLCG ++G  E+DF E    +         S+              +   C++      T    V   A   D+C  +L GP F  C    + D E++ T    YC    + N  + QL + C+   N A AC R  I           + C      GG ++  C  +C  +C  + +     C  +C  GCECP   +  G   CV  + C C++  +   P    G  +   C  CVC +GR +C
Sbjct:  130 NSSAGSLEDPADELGVWPLTLNDPILFPGMSLQWQGDWLVLSGGLGVVVRLDRSSSISISVDHEFWGRTQGLCGLYNGRPEDDFVEPGGGLATLAATFGNSWKLPGSEPGCLDAVEVAWGCESLLGGTLTDLEAVKLQAQAQDMCHQLLEGP-FWQCHGQVQPD-EYHETCLFAYCVGATAGNGPEGQLEAVCATFANYAQACARQHIYVHWRKPGFCERVC-----PGGQLYSDCVSSCPPSCSAVAQGEEGSCGKECVSGCECPTGLFWDGA-LCVPAAHCPCYHRRQRYAP----GDTVKQQCNPCVCQDGRWHC 435          

HSP 3 Score: 65.4698 bits (158), Expect = 5.843e-9
Identity = 58/215 (26.98%), Postives = 89/215 (41.40%), Query Frame = 3
Query: 4242 EGCSCPNGMID-LNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCI--TTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDE--KNCNV----------------------------------CDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCG--CLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEE 4763
            +GC CP+G +   +G C+PP       NG                  C+ A      D   C+   +C   +  C DG C+ + ++CD V DC +  DE   +C++                                  C L +FQC ++G C P   +CD  ++C D SDE+ CG  C+ +Q+ C  S  C+   ++CDG   C   D SDE+
Sbjct: 1326 QGCLCPHGSLACADGRCLPPAL---LCNGHP---------------DCLDAA-----DEESCLGPVSCISGEVSCVDGTCVRTIQLCDGVWDCPDGADEGPSHCSLPSLPTPPGGIGQNPSTSSLDTAPSPVGSTSPASPCSLLEFQC-NSGECTPRGWRCDQEEDCTDGSDELDCGGPCMLYQVPCAHSPHCVSPGQLCDGVTQC--PDGSDED 1514          

HSP 4 Score: 62.003 bits (149), Expect = 6.842e-8
Identity = 42/107 (39.25%), Postives = 48/107 (44.86%), Query Frame = 3
Query: 1581 CETQCPGNKIW---SDCASE---CPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCG 1883
            C  QCPGN ++     C  E   CP  C  L Q P   C  S    C C  G   +  +C+    CPC   GQ + PG V   DCN CTC S    CT K CP  CG
Sbjct: 2718 CTAQCPGNMVFRSAEQCLEEGGPCPQLC--LAQDPGVECTGSCAPSCNCPPGLFLHNASCLPRSQCPCQLHGQLYAPGAVAHLDCNNCTCISGEMVCTSKRCPVACG 2822          

HSP 5 Score: 56.9954 bits (136), Expect = 2.000e-6
Identity = 40/132 (30.30%), Postives = 60/132 (45.45%), Query Frame = 3
Query: 4428 TTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNC-NVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISR-------------TCIEEKKICDGNYDCGVNDKS----DEENC 4769
            + C+  +F+C+ G+C      CD+  DC++  DE +C   C L Q  C  +  C+   + CDG   C D SDE    C         +R             TCI+   +CDGN DC + D++    DE+ C
Sbjct: 1441 SPCSLLEFQCNSGECTPRGWRCDQEEDCTDGSDELDCGGPCMLYQVPCAHSPHCVSPGQLCDGVTQCPDGSDEDPDVCEEQSASGGANRTGAPCPEFSCPDGTCIDFLLVCDGNPDCELADETEPSLDEQGC 1572          
BLAST of SCO-spondin vs. UniProt/SwissProt
Match: sp|A2VEC9|SSPO_HUMAN (SCO-spondin OS=Homo sapiens OX=9606 GN=SSPO PE=2 SV=2)

HSP 1 Score: 427.172 bits (1097), Expect = 1.876e-120
Identity = 420/1500 (28.00%), Postives = 637/1500 (42.47%), Query Frame = 3
Query:  510 CQENYAGMQCDEDNPIIIQSQHPSQLYCYQSDQCFAFKKSDFLGKAVSYDECCADKTGS--WGSQSGSCVSCKANFAGGN------------------DVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVY-ENCTSDTGCVKV------IVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXX-----XXXVASFGNSFK----GFGCPDIANTLSTC-KPDDQILANQQCSKIRLK------------FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPG-TVRQFDCNTCTCNSSLWHCTEKICPSTCGIMGT-QFDTFDGAKFAF-NDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYIT---GSCDNTPQSIVDPPAGDN------DICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCIN-GRLNCKTKDNCTNPVCPKNQVYMDSVS--GCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTI--------PLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDV--NRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDC---ITTCTPSQFRC-DDGKCIESSKICDKVTDCSNSEDEKNCNV--CDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENC 4769
            C   + G  C E       ++   + +C+   QC   +       A S +ECCA   G   W   S +C SC +    G+                    +     TC S+   +YRTFD + Y + GRC+Y+L   +D    TW++++   + C     C +V      ++I+AG+V VK    G L     +  L  LS+      L++ G    V+R D         G+I +  D+              G   GLCG  +  P +DF           A+FGNS++      GC D       C  P   I A+ +   +R +            F  C   V+   Y   C+   C  +   +           +C   ++Y  +C+ +   I+WR    CE  CPG +++SDC S CP +C  + Q     C+   V  C C  G    G  C+    CPC Y  Q + PG TVRQ  CN C C    WHC + +CP+ C + G   + TFDG  ++F    GC+Y  V+  V     +  + ++++         +  S            ++   + L+ T  QL DS   V ++G+D    LP+ I  + + VR+ ++ +  ++      L+       YI +     + + GLCG F  N ++DF      +  SI   A  +     G C +   +++ P    +      +    IL+   F  C     VDKE +   C        D  S C   + +A A RR   +   P   N  Q   P+   GG  ++ C+  C   C +  +         C  GC CP        GQCV  S C C   +R   P    G+     C  C+C   G  NC  +   +   CP+  VY        C+S +   +C   S+  + C CP  TV  +D  CV P  CPC +  + Y PN  I   C   +C  R W+   +  +     C A G PHY T DG  F++ G+C Y L+             T+S  N+ CG S  TC K + + + G    + RG   T+         ++    + + +   F  L+S  +GL +LWD  TRV + L P F+G V GLCG++DGD  N+        E   + A      + +CP          P      C  N  R  WA   CG +     +F  C    H +V   ++Y  CLYDACGC+ GGDCECLC+++AT+A +CA  G  V+WR+Q LC + CEGG+ Y+AC   CP TC         HC    CVEGC CP G +   G C+ P +CPC +   S+  G++++ ++C  C C + +++C  D   C   +  C   +  C ++G C+    +CD   DC +  DE+ C    C   Q  C S+G C+P+   CD   +C D +DE S  C    + C   R C+    +CDG+ DC   D +DEE+C
Sbjct:   94 CCPGWGGAHCTE-----ALAKASPEGHCFAMWQC-QLQAGSANASAGSLEECCARPWGQSWWDGSSQACRSCSSRHLPGSASSPALLQPLAGAVGQLWSQHQRPSATCASWSGFHYRTFDGRHYHFLGRCTYLLAGAADS---TWAVHLTPGDRCPQPGHCQRVTMGPEEVLIQAGNVSVK----GQLVPEGQSWLLHGLSLQWLGDWLVLSGGLGVVVRLD-------RTGSISISVDHELW-----------GQTQGLCGLYNGWPEDDFMEPGGGLAMLAATFGNSWRLPGSESGCLDAVEVAQGCDSPLGLIDADVEPGHLRAEAQDVCHQLLEGPFGQCHAQVSPAEYHEACLFAYCAGAMAGSGQ---EGRQQAVCATFASYVQACARRHIHIRWRKPGFCERLCPGGQLYSDCVSLCPPSCEAVGQGEEESCREECVSGCECPRGLFWNGTLCVPAAHCPCYYCRQRYVPGDTVRQL-CNPCVCRDGRWHCAQALCPAECAVGGDGHYLTFDGRSYSFWGGQGCRYSLVQDYV-----KGQLLILLEHG-----ACDAGSC-----------LHAISVSLEDTHIQLRDSGA-VLVNGQD--VGLPW-IGAEGLSVRRASSAFLLLRWPGAQVLWGLSDPVAYITLDPRHAHQVQGLCGTFTQNQQDDFLTPAGDVETSIAAFASKFQVAGKGRCPSEDSALLSPCTTHSQRHAFAEAACAILHSSVFQEC--HRLVDKEPFYLRCL-AAVCGCDPGSDCLCPVLSAYA-RRCAQEGASPPWRN--QTLCPVMCPGGQEYRECAPACGQHCGKPEDCGEL---GSCVAGCNCPLGLLWDPEGQCVPPSLCPCQLGARRYAP----GSATMKECNRCICQERGLWNCTARHCPSQAFCPRELVYAPGACLLTCDSPSANHSCPAGST--DGCVCPPGTVL-LDERCVPPDLCPCRHSGQWYLPNATIQEDCNVCVCRGRQWHCTGQRRS---GRCQASGAPHYVTFDGLAFTYPGACEYLLVREASGL------FTVSAQNLPCGASGLTCTKALAVRLEGTVVHMLRGRAVTVNGVSVTPPKVYTGPGLSLRRAGLFL-LLSTHLGLTLLWDGGTRVLVQLSPQFRGRVAGLCGDFDGDASNDLRSRQGVLEPTAELAAHSWRLSPLCP---------EPGDLPHPCTMNTHRAGWARARCGAL--LQPLFTLC----HAEVPPQQHYEWCLYDACGCDSGGDCECLCSAIATYADECARHGHHVRWRSQELCSLQCEGGQVYEACGPTCPPTCHEQHPEPGWHCQVVACVEGCFCPEGTLLHGGACLEPASCPCEWGRNSFPPGSVLQ-KDCGNCTCQEGQWHCGGDGGHCEELVPACAEGEALCQENGHCVPHGWLCDNQDDCGDGSDEEGCAAPGCGEGQMTC-SSGHCLPLALLCDRQDDCGDGTDEPSYPCPQGLLACADGR-CLPPALLCDGHPDC--LDAADEESC 1487          

HSP 2 Score: 67.0106 bits (162), Expect = 1.884e-9
Identity = 32/80 (40.00%), Postives = 45/80 (56.25%), Query Frame = 3
Query: 4173 PCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTED 4412
            PCP+ C T G   P    T  C  GC+CP G+   N  C+P + CPC  +GQ Y +GA+ ++++C  C CV  K  CT +
Sbjct: 2905 PCPRLCLTQG---PGIECTGFCAPGCTCPPGLFLHNASCLPRSQCPCQLHGQLYASGAMARLDSCNNCTCVSGKMACTSE 2981          

HSP 3 Score: 59.3066 bits (142), Expect = 4.726e-7
Identity = 35/108 (32.41%), Postives = 55/108 (50.93%), Query Frame = 3
Query: 2766 CQSTCRELNEA-TASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPK-NQVYMDSVSGCNSC 3083
            C+ TC E+N   T S C      GC C P ++++  G CV E  C CW+  RP  P    G+     C++C+C++GR  C    +C+   C +  ++ ++  S C SC
Sbjct: 4943 CEQTCLEMNATKTQSNCSSARASGCVCQPGHFRSQAGPCVPEDHCECWHLGRPHLP----GSEWQEACESCLCLSGRPVC--TQHCSPLTCAQGEEMVLEPGSCCPSC 5044          

HSP 4 Score: 58.5362 bits (140), Expect = 8.022e-7
Identity = 42/131 (32.06%), Postives = 58/131 (44.27%), Query Frame = 3
Query: 4434 CTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNC-NVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDE--ISCGCLPH------------QIVCNISRTCIEEKKICDGNYDCG----VNDKSDEENC 4769
            C P +FRC  G+C      CD+  DC++  DE+ C   C      C     C+   + CDG + C D SDE   +CG LP             +  C  + TCI  + +CDG  DCG    V    +E+ C
Sbjct: 1566 CGPFEFRCGSGECTPRGWRCDQEEDCADGSDERGCGGPCAPHHAPCARGPHCVSPEQLCDGVRQCPDGSDEGPDACGGLPALGGPNRTGLPCPEYTCP-NGTCIGFQLVCDGQPDCGRPGQVGPSPEEQGC 1695          

HSP 5 Score: 57.7658 bits (138), Expect = 1.408e-6
Identity = 57/201 (28.36%), Postives = 73/201 (36.32%), Query Frame = 3
Query: 2703 LQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRP---------KDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDT-----SSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYIC 3263
            LQ C P C  G  V   C+ +C   C  L +  A    + C PGC CP        G CV  + C C   S P         +  E+P GT +T NC  CVC  G  +C   D    P     QV    +  C         T T     S+ A+ C C         G CV    C C ++ R + P       C   +C
Sbjct: 4815 LQPC-PECPPG-QVLSACATSCPCLCWHL-QPGAICVQEPCQPGCGCPGGQL-LHNGTCVPPTACPCTQHSLPWGLTLTLEEQAQELPPGTVLTRNCTRCVCHGGAFSCSLVDCQVPPGETWQQVAPGELGLCEQTCLEMNATKTQSNCSSARASGCVCQPGHFRSQAGPCVPEDHCECWHLGRPHLPGSEWQEACESCLC 5011          

HSP 6 Score: 56.6102 bits (135), Expect = 2.710e-6
Identity = 41/133 (30.83%), Postives = 55/133 (41.35%), Query Frame = 3
Query: 1506 CTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIW---SDCASE---CPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFD-CNTCTCNSSLWHCTEKICPSTCG 1883
            C+ L+    +C    S  +  +   C  QCP N ++     C  E   CP  C  L Q P   C       C C  G   +  +C+    CPC   GQ +  G + + D CN CTC S    CT + CP  CG
Sbjct: 2858 CSSLAPGDTTCPGPHSQTRDCNTQPCTAQCPENMLFRSAEQCHQEGGPCPRLC--LTQGPGIECTGFCAPGCTCPPGLFLHNASCLPRSQCPCQLHGQLYASGAMARLDSCNNCTCVSGKMACTSERCPVACG 2988          

HSP 7 Score: 55.0694 bits (131), Expect = 8.072e-6
Identity = 59/251 (23.51%), Postives = 86/251 (34.26%), Query Frame = 3
Query: 2712 CIPLCQAGGTVFQI-CSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKD-----------NCTNPV--------------------------------------CPKNQVYMDSVSGCNSCTNYDTCTDTSSIAN----SCGCPNDTVSKIDGTCVQPSDCPCIYMN-------------REYAPNDVITIKCAKYIC 3263
            C   C+A  TVF + C+  C  +C +L +         C PGC CPP       G+CV  S C C  PS     E+     + ++CQ C C+N  L C  ++           +C+ P                                       CP  QV     + C  C  +        +       CGCP   +   +GTCV P+ CPC   +             +E  P  V+T  C + +C
Sbjct: 4666 CPESCEAQDTVFTLDCANQCPHSCADLWDRVQC-LQGPCRPGCRCPPGQL-VQDGRCVPISSCRCGLPSANASWELAPAQAVQLDCQNCTCVNESLVCPHQECPVLGPWSAWSSCSAPCGGGTMERHRTCEGGPGVAPCQAQDTEQRQECNLQPCPECPPGQVLSACATSC-PCLCWHLQPGAICVQEPCQPGCGCPGGQLLH-NGTCVPPTACPCTQHSLPWGLTLTLEEQAQELPPGTVLTRNCTRCVC 4912          
BLAST of SCO-spondin vs. UniProt/SwissProt
Match: sp|P98167|SSPO_BOVIN (SCO-spondin OS=Bos taurus OX=9913 GN=SSPO PE=2 SV=2)

HSP 1 Score: 398.282 bits (1022), Expect = 3.339e-111
Identity = 400/1453 (27.53%), Postives = 607/1453 (41.78%), Query Frame = 3
Query:  645 AVSYDECCADKTG-SW-GSQSGSCVSCKANFAGGNDVN------------------NENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAG--DVVVKSSG---NGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXX-----XXXVASFGNSFK----GFGCPDIANTLSTCK-PDDQILANQQCSKIRLK------------FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPG-TVRQFDCNTCTCNSSLWHCTEKICPSTCGIMGT-QFDTFDGAKFAFND-VGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYIT---GSCDNTPQSIVDPPAGDN------DICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNP--VCPKNQVYMDSVS--GCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNN---DTIPLFPKYDIVIEQLTFFTQ----LVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDV--NRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITT---CTPSQFRC-DDGKCIESSKICDKVTDCSNSEDEKNC--NVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENC 4769
            A S +ECCA   G SW   +S +C SC  +   G+  +                       TC ++   +YRTFD + + + GRC+Y+L   +D    TW++++         G  ++  +  G  +V+++      NG L    ++  L  LS+      L++ G    V+R D    +S+                         G   GLCG  +  P +DF           A+FGNS++      GC D       C+ P        +  ++R +            F  C   V    Y   C+   C  +   +   +     + +C  L++Y+  C+ +   ++WR    CE  CPG +++SDCAS CP +C  + +     C    V  C C  G    G  C+    CPC    + + PG TVRQ  CN C C    W C +  C + C + G   + TFDG  F+F    GC+++ V+      D      +I+  + +   G+                ++   + L  T  QL DS   V +DG+D    LP++     + V + ++ +  ++      L+     + YI +     + + GLCG F  N ++DF      +  SI   A  +     G+C     + + P +         ++   IL+GP F  C     VD+E +   C                +L  A   RR   +  +P   N  Q   P+   GG  +Q C+  C   C E  +       D+C  GC CP        GQCV  + C C   +    P    G+    +C  CVC    L   T  +C  P   CP+  VY+       C+S     TC   S     C CP  TV  ++  CV P  CPC +  + Y PN  I   C   +C  + W+   +    C+  C A G PHY T DG   +F G+C Y L+              +S  N+ CG S  TC K + + + G    + RG     + + + P        L+  T     L+S  +GL +LWD  TRV + L P  +G V GLCG++DGD  N+        E   + A        +CP          P      C  N  R  WA   CGV+     +FA C    H +V   ++Y  C+YDACGC+ GGDCECLC+++AT+A +CA  GI V+WR+Q LCP+ CE G+ Y+AC   CP TC          C    CVEGC CP G +   G C+ P  CPC + G  +  G +++ +    C C ++++ C +D   C+     C   +  C + G C+    +CD   DC +  DE+ C   VC   Q  C S G C+P+   CDG  +C D  DE  C C    + C     C+   ++CDG+ DC   D +DEE+C
Sbjct:  125 AGSLEECCAQPWGHSWRDGRSQTCHSCSNHSRLGSTPSPAILQPLAGAVAQLWSQRQRPSATCATWSGFHYRTFDGRHFHFLGRCTYLLAGAADA---TWAVHLQPMGHCPQPGHCQLARVMMGPEEVLIRGENVTVNGRLVPEGASQLLPGLSLQWQGDWLVLSGGLGVVVRLDRSSSVSISVDQ------------------ELQGQTQGLCGVYNGQPEDDFLEPGRGLAALAATFGNSWRLPDSELGCLDAVEAAQGCEDPLRGTETGTEAGQLRAEAQDVCHQLLEGPFRECHTQVPPAEYHEACLFAYCAGAPAGSGRAER---LEAVCATLASYAQDCAARRIAVRWRKPGFCERLCPGGQLYSDCASACPPSCSAVGEGSEWSCGEECVSGCECPPGLFWDGALCVPAARCPCYRRRRRYEPGDTVRQL-CNPCECRDGRWLCAQAPCAAECAVGGDGHYVTFDGRSFSFRGRAGCRFILVQ------DFAKRQLLIVLEHGDCDAGS---------------CLHAISVSLGDTLVQLRDSGV-VLVDGQD--VALPWSAAG-GLSVSRASSSFLLLRWPGARILWGVSDPAAYITLDPHHAHQVQGLCGTFTRNQQDDFLTPAGDVETSITAFASKFQVAGGGTCSLEACTPLSPCSTHTERQVFAEVACAILHGPTFQEC--HGLVDREAFHLRCLAAVCGCTPGRDCLCPVL--AAYARRCAQEGALPSWRN--QTFCPVLCPGGQEYQECAPACDRNCGEPEDCGEL---DNCVAGCNCPLGLLWDPEGQCVPPNLCPCQLGAHRYAP----GSATMKDCNHCVCQERGLWNCTAHHCAPPRTFCPRELVYVPGACLLTCDSLDADRTCPPGS--PGGCVCPPGTV-LLEERCVPPELCPCRHGGQWYLPNAAIQEDCNLCVCQGQQWHCTGQR---CDGRCRASGAPHYVTFDGLALTFPGACEYLLVREASGQ------FMVSAQNLPCGASGLTCTKALTVRLQGTVVHMLRGRAVMVNGVSVTPPKVYSGPGLSLHTAGLFLLLSTRLGLTLLWDGGTRVPVQLSPQLRGRVAGLCGDFDGDASNDLRSRQGVLEPTAELAAHSWRLGPLCP---------EPGDLPHPCAVNAHRAGWARARCGVV--LQPLFARC----HVEVPPQQHYEQCVYDACGCDSGGDCECLCSAIATYADECARHGIHVRWRSQELCPLQCERGQVYEACGPTCPATCHDHRPEPGWPCRAVACVEGCFCPEGTLLHGGVCLEPAACPCEWGGSFFPPGTVLQKDCGNNCTCRESQWLCGDDGGRCVEPGPGCAEGETPCRESGHCVPHGWLCDNQDDCGDGSDEEGCATRVCGEGQVSCCS-GRCLPLVLLCDGQDDCGDGMDEQGCPCPQDSLTCADGH-CLPPARLCDGHPDC--PDGADEESC 1483          

HSP 2 Score: 62.7734 bits (151), Expect = 3.471e-8
Identity = 29/80 (36.25%), Postives = 41/80 (51.25%), Query Frame = 3
Query: 4173 PCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTED 4412
            PCP  C   G   P    T  C  GC+CP G+   N  C+PP+ CPC   GQ Y  GA+ ++++C  C C+  +  C  +
Sbjct: 2883 PCPGLCLARG---PGVECTGVCTAGCACPTGLFLHNSSCLPPSQCPCQLRGQLYAPGAVARLDSCSNCTCISGEMVCASE 2959          

HSP 3 Score: 59.6918 bits (143), Expect = 3.674e-7
Identity = 35/108 (32.41%), Postives = 47/108 (43.52%), Query Frame = 3
Query: 1581 CETQCPGNKIWSDC------ASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFD-CNTCTCNSSLWHCTEKICPSTCG 1883
            C  QCPG+ ++            CP  C  L + P   C       C C +G   +  +C+ P  CPC   GQ + PG V + D C+ CTC S    C  + CP  CG
Sbjct: 2861 CTAQCPGDMVFRSAEQCRWEGGPCPGLC--LARGPGVECTGVCTAGCACPTGLFLHNSSCLPPSQCPCQLRGQLYAPGAVARLDSCSNCTCISGEMVCASEPCPVACG 2966          
BLAST of SCO-spondin vs. TrEMBL
Match: A0A267FQZ0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032551g1 PE=4 SV=1)

HSP 1 Score: 1132.86 bits (2929), Expect = 0.000e+0
Identity = 665/1654 (40.21%), Postives = 922/1654 (55.74%), Query Frame = 3
Query:  204 SCNKYIGLMMENYNLDEKSVPIAEQYQDPSIPVSKQQSLSMQLYV---SSGMPEPQCNFTLQNIVSEENCCVGYENFPYCNISVCYSDNGGCYNGGICMSPNQCKCQENYAGMQCDEDNPIIIQSQHPSQLYCYQSDQCFAFKKSDFLGKAVSYDECCADKTGSWGSQSGSCVSCKANFAGGNDVNNE--NFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDV-----------VVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGD-VTGLCGXXXXXXXXXXXXXXXVASFGNSFKGFGCPDIANTLSTCK-PDDQILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKI-CPSTCGIMGTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPA------GDNDICSTILNGPEFSGCMNSSKVD-KEFYATYCRREQS----SNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECP-PNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNN-DTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDV-NRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQ--AKFNCTEDYSDCI---TTCTPSQFRCD-DGKCIESSKICDKVTDCSNSEDEKNCN-VCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKC-QMTEYKCNNSQI----CILLNNKXXXXXXXXXXXXEHGCECICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNC 5030
            SC   + + ME   +D+ SVPI       +    +++ LS+Q Y+   +     P C F     + +  CCVGY+    C   VC+ D GGC NGG C+ PN C+C  NY G  CDED   I    +P++ YCY  D C   KK+ F    V++  CC+D TGS+G Q G C+SCK +    N+   E   F TC SYG + YRTFD   + YQGRC+Y+L A S    + W   I   NC     C K I +   D+           V K SG     T  +N  L   S  N  + +        V R+   + L++ +  +KLKWDN N++F+++  S++    + GLCG+ D + +NDF +  N A+FGN +K   C DIAN    C+ P+DQ  A   C  I   F  C   ++       CVQ++C   +   T+    + S VLC+HLSAYS  CS +G CI WR  T+C   CP    WS+CAS CP TC N  Q  SA C++S V RC CGSG V Y  TCI+P  CPC Y+  E+ PG+    DC+TC C +  W CT    CP  C I G+   TFDGAK  FN +GC Y  +EP     D R  V V ++ + E +L    +S ++N PK++TVK  G  I LK+ +   G ++ +V IDG D T  LP+      I VR+LT+ Y  VK+ +H  +YFDG +++ +K +  L   + GLCG FD  +END   K + +    V +A+SY++GSC  T   +  P +      G +D    +LN   F  C +S KVD   +Y  +C++E++     N  +L YC+A ++AA AC+  G Q +   T + L  C P C +GG  F IC+RTC+S+    + ++ S C+  CFPGC+C   N Y+   G CV +SECTC +          +G  I+  C  C C NG   C         VCPK+QVY++++  C  C NYD C    S +  CGCP D V K DG+CV    CPCIY+  EY P  ++ I C  Y C +R W  ++E+   CEAVC+AYGDPHY T D + +SFQGSC Y LM +  +++  +PPI +S  NI CG    TC KFV++ +G  TY+L RG   D +P+   Y +  E+ T FTQLVSD +GLR+LWDRSTRVY+F+KP F   V GLCGN+DG+  N++    +   + I+FA +F    D C        + +P    +MC AN  R+ +AE +CG +K   GVF++C + + QDV   +Y NC+YDACGC+ GGDCEC+CT L+ FAT CA  G+ V+WR Q+ CPIMC GG+ Y  C  PC +TC  +G     HC  + C+EGC+CPNG ++ + EC+P   CPCFY G+ Y  G++I                 NCT D S C     TCT +Q+ C+  G CI  S+ CD   DC   +DEKNCN  C    F+CI+   C+ M+ KCDG   C D SDE++CGC P +I CN +  C+ ++K CDG YDCG+ D +DE++CKKC +++E+KC  +      CI   N CDG DDCGDGSDE GC+C+C E + ++C            C+CIN T+ CDG  DC +G DE++C
Sbjct:   66 SCGNMVEMTMEGLTIDKSSVPILTDAALANRTTHEKRQLSLQTYIRDFAYSKATPNCTFYKLTNIEKTQCCVGYDG-SNCQTVVCFVDRGGCLNGGKCVKPNVCQCATNYLGTNCDEDLNAI--KNNPNEQYCYSDDACLT-KKTGFGSSRVAFGRCCSDGTGSFGYQKG-CMSCKTSTVARNNTGVEVVPFDTCVSYGPNSYRTFDGLTFEYQGRCTYLL-AGSTNPTMKWWCTITLLNCDKFETCRKQITMRFDDINQYVALGYNVQVFKLSGTSGATTLTANVTLEENSEPNEWNGV-------KVERKGVNVYLTVRSIGVKLKWDNENSVFVTVDRSLHKNRGLKGLCGDYDGDATNDFGSAPNPAAFGNQWKSESCQDIANVPIHCESPEDQAAAEGDCRPINNVFFQCHSKISPTQVVKRCVQDMCILKKKGETSDS--AKSSVLCSHLSAYSYQCSLEGICIDWRGSTMCPQSCPALMTWSECASACPTTCANYDQLKSATCESSMVPRCKCGSGYVHYKSTCIRPNECPCTYNSVEYMPGSNLVVDCSTCNCANGRWQCTYNPNCPKMCSITGSHIVTFDGAKMDFNPMGCAYTLLEPVSGANDSRLQVQVTMEPSPEYLLAVTADSQFVNLPKMITVKYRGVTIQLKSVTLAAG-TRPSVIIDGVDFTNSLPYENVRSQILVRQLTSFYAMVKIGNHLSVYFDGYRTVELKGAKLLSQKIEGLCGNFDSKTENDLHTKGSDMIAPPVQVAQSYVSGSCSKTAAELPSPGSTSQSLSGVDDCTQVLLNSDSFKACRDSKKVDILGYYYRFCQKEKACGGIPNIGEL-YCTAAMSAARACKTAGFQIDFS-TDSRLSKCAPSCMSGGGSFTICARTCRSS--CSDLSSTSICELGCFPGCDCQYDNQYRDAYGTCVRQSECTCLDRYNRNGKIYRSGAVISRQCTNCTCTNGDFACGNSSCADKVVCPKDQVYLETMPACQKCINYDKCQSNQSESGRCGCPGDLVKKADGSCVAKPHCPCIYLGTEYLPGHILKIGCKTYKCVSRTWTKIAEDATKCEAVCVAYGDPHYSTFDRKAYSFQGSCQYILMKSDANAALGLPPIEVSAQNIPCGSQQVTCTKFVRVKVGSDTYVLVRGREPDQLPVAMNYGMRREKFTLFTQLVSDQLGLRILWDRSTRVYVFVKPHFNSKVSGLCGNFDGNADNDFTIKNLPINNPIEFASNFRTGGDSC-ASEESSASKSPQSWIEMCTANSRRRDYAESVCGAIKSKTGVFSACQQVLEQDVIENFYENCMYDACGCDTGGDCECVCTVLSAFATTCAESGVSVQWRFQDQCPIMCTGGRVYQPCMPPCAKTCHNVGLEPEPHCVNSQCIEGCACPNGYVEHDNECIPSDNCPCFYQGKEYPKGSVIHNTTSCSTCSCTKGGVMNCTSDSSVCRPTKPTCTENQYACNVTGMCISYSQFCDGTLDCLYGDDEKNCNTTCSPSYFRCITTQQCVAMSLKCDGIPQCTDGSDELNCGCNPTEIQCNKTGKCLPKQKRCDGVYDCGLPDTTDEDDCKKCDKVSEFKCGAADTTETKCIPRVNHCDGHDDCGDGSDEIGCKCLCMEKDTVIC----------DQCKCINVTQLCDGNRDCEDGTDEQSC 1688          
BLAST of SCO-spondin vs. TrEMBL
Match: A0A267FNX5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000138g1 PE=4 SV=1)

HSP 1 Score: 1130.55 bits (2923), Expect = 0.000e+0
Identity = 665/1654 (40.21%), Postives = 921/1654 (55.68%), Query Frame = 3
Query:  204 SCNKYIGLMMENYNLDEKSVPIAEQYQDPSIPVSKQQSLSMQLYV---SSGMPEPQCNFTLQNIVSEENCCVGYENFPYCNISVCYSDNGGCYNGGICMSPNQCKCQENYAGMQCDEDNPIIIQSQHPSQLYCYQSDQCFAFKKSDFLGKAVSYDECCADKTGSWGSQSGSCVSCKANFAGGNDVNNE--NFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDV-----------VVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGD-VTGLCGXXXXXXXXXXXXXXXVASFGNSFKGFGCPDIANTLSTCK-PDDQILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCT-EKICPSTCGIMGTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPA------GDNDICSTILNGPEFSGCMNSSKVD-KEFYATYCRREQS----SNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECP-PNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNN-DTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDV-NRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQ--AKFNCTEDYSDCI---TTCTPSQFRCD-DGKCIESSKICDKVTDCSNSEDEKNCN-VCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKC-QMTEYKCNNSQI----CILLNNKXXXXXXXXXXXXEHGCECICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNC 5030
            SC   + + ME   +DE SVPI       +  + +++ LS+Q Y+   +     P C F     + +  CCVGY+    C   VC+ D GGC NGG C+ PN C+C  NY G  CDED   I    +P++ YCY  D C   KK+ F    V++  CC+D TGS+G Q G C+SCK +    N+   E   F TC SYG + YRTFD   + YQGRC+Y+L A S    + W   I   NC     C K I +   D+           V K SG     T  +N  L   S  N  + +        V R+   + L++ +  +KLKWDN N++F+++  S++    + GLCG+ D + +NDF +  N A+FGN +K   C DIAN    C+ P+DQ  A   C  I   F  C   ++       CVQ++C   +   T+    + S VLC+HLSAYS  CS +G CI WR  T+C   CP    WS+CAS CP TC N  Q  SA C++S V RC CGSG V Y  TCI+P  CPC Y+  E+ PG+    DC+TC C +  W CT    CP  C I G+   TFDGAK  FN +GC Y  +EP     D R  V V ++ + E +L    +S ++N PK++TVK  G  I LK+ +   G ++ +V IDG D T  LP+      I VR+LT+ Y  VK+ +H  +YFDG +++ +K +  L   + GLCG FD  +END   K + +    V +A+SY++GSC  T   +  P +      G +D    +LN   F  C +S KVD   +Y  +C++E++     N  +L YC+A ++AA AC+  G Q +   T + L  C P C +GG  F IC+RTC+S+    + ++ S C+  CFPGC+C   N Y+   G CV +SECTC +          +G  I+  C  C C NG   C         VCPK+QVY++++  C  C NYD C    S +  CGCP D V K DG+CV    CPCIY+  EY P  ++ I C  Y C +R W  ++E+   CEAVC+AYGDPHY T D + +SFQGSC Y LM +  +++  +PPI +S  NI CG    TC KFV++ +G  TY+L RG   D +P+   Y +  E+ T FTQLVSD +GLR+LWDRSTRVY+F+KP F   V GLCGN+DG+  N++    +   + I+FA +F    D          + +P    +MC AN  R+ +AE +CG +K   GVF++C + + QDV   +Y NC+YDACGC+ GGDCEC+CT L+ FAT CA  G+ V+WR Q+ CPIMC GG+ Y  C  PC +TC  +G     HC  + C+EGC+CPNG ++ + EC+P   CPCFY G+ Y  G++I                 NCT D S C     TCT +Q+ C+  G CI  S+ CD   DC   +DEKNCN  C    F+CI+   C+ M+ KCDG   C D SDE++CGC P +I CN +  C+ ++K CDG YDCG+ D +DE +CKKC +++E+KC  +      CI   N CDG DDCGDGSDE GC+C+C E + ++C            C+CIN T+ CDG  DC +G DE++C
Sbjct:   66 SCGNMVEMTMEGLTIDESSVPILTDAALANRTMHEKRQLSLQTYIRDFAYSKATPNCTFYKLTNIEKTQCCVGYDG-SNCQTVVCFVDRGGCLNGGKCVKPNVCQCATNYLGTNCDEDLNAI--KNNPNEQYCYSDDACLT-KKTGFGSSRVAFGRCCSDGTGSFGYQKG-CMSCKTSTVARNNTGVEVVPFDTCVSYGPNSYRTFDGLTFEYQGRCTYLL-AGSTNPTMKWWCTITLLNCDKFETCRKQITMRFDDINQYVALGYNVQVFKLSGTTGATTLTANVTLEENSEPNEWNGV-------KVERKGVNVYLTVRSIGVKLKWDNENSVFVTVDRSLHKNRGLKGLCGDYDGDATNDFGSAPNPAAFGNQWKSESCQDIANVPIHCESPEDQAAAEGDCRPINNVFFQCHSKISPTQVVKRCVQDMCILKKKGETSDS--AKSSVLCSHLSAYSYQCSLEGICIDWRGSTMCPQSCPALMTWSECASACPTTCANYDQLKSATCESSMVPRCKCGSGYVHYKSTCIRPNECPCTYNSVEYMPGSNLVVDCSTCNCANGRWQCTYNPNCPKMCSITGSHIVTFDGAKMDFNPMGCAYTLLEPVSGANDSRLQVQVTMEPSPEYLLAVTADSQFVNLPKMITVKYRGVTIQLKSVTLAAG-TRPSVIIDGVDFTNSLPYENVRSQILVRQLTSFYAMVKIGNHLSVYFDGYRTVELKGAKLLSQKIEGLCGNFDSKTENDLHTKGSDMIAPPVQVAQSYVSGSCSKTAAELPSPGSTSQSLSGVDDCTQVLLNSDSFKACRDSKKVDILGYYYRFCQKEKACGGIPNIGEL-YCTAAMSAARACKTAGFQIDFS-TDSRLSKCAPSCMSGGGSFTICARTCRSS--CSDLSSTSICELGCFPGCDCQYDNQYRDAYGTCVRQSECTCLDRYNRNGKIYRSGAVISRQCTNCTCTNGDFACGNSSCADKVVCPKDQVYLETMPACQKCINYDKCQSNQSESGRCGCPGDLVKKADGSCVAKPHCPCIYLGTEYLPGHILKIGCKTYKCVSRTWTKIAEDATKCEAVCVAYGDPHYSTFDRKAYSFQGSCQYILMKSDANAALGLPPIEVSAQNIPCGSQQVTCTKFVRVKVGSDTYVLVRGREPDQLPVAMNYGMRREKFTLFTQLVSDQLGLRILWDRSTRVYVFVKPHFNSKVSGLCGNFDGNADNDFTIKNLPINNPIEFASNFRTGGDS-CASEESSASKSPQSWIEMCTANSRRRDYAESVCGAIKSKTGVFSACQQVLEQDVIENFYENCMYDACGCDTGGDCECVCTVLSAFATTCAESGVSVQWRFQDQCPIMCTGGRVYQPCMPPCAKTCHNVGLEPEPHCVNSQCIEGCACPNGYVEHDNECIPSDNCPCFYQGKEYPKGSVIHNTTSCSTCSCTKGGVMNCTSDSSVCRPTKPTCTENQYACNVTGMCISYSQFCDGTLDCLYGDDEKNCNTTCSPSYFRCITTQQCVAMSLKCDGIPQCTDGSDELNCGCNPTEIQCNKTGKCLPKQKRCDGVYDCGLPDTTDENDCKKCDEVSEFKCGAADTTETKCIPRVNHCDGHDDCGDGSDEIGCKCLCMEKDTVIC----------DQCKCINVTQLCDGNRDCEDGTDEQSC 1688          
BLAST of SCO-spondin vs. TrEMBL
Match: A0A1I8IM20 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 1046.19 bits (2704), Expect = 0.000e+0
Identity = 633/1678 (37.72%), Postives = 919/1678 (54.77%), Query Frame = 3
Query:  150 SPNNCIYDYNEDVDTVTESCNKYIGLMMENYNLDEKSVPIAEQYQDPSIPVSKQQSLSMQLYV---SSGMPEPQCNFTLQNIVSEENCCVGY--ENFPYCNISVCYSDNGGCYNGGICMSPNQCKCQENYAGMQCDEDNPIIIQSQHPSQL-YCYQSDQCFAFKKSDFLGKAVSYDECCADKTGSWGSQSGSCVSCKANFAGGNDVNNEN-------FTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDV--VVKSSGNGILYTTDSNNPLTPLSVTNT-----DSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXG-DVTGLCGXXXXXXXXXXXXXXXVASFGNSFKGFGCPDIANTLSTCKPDDQILAN--QQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPG-NKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKI-CPSTCGIMGTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTP-----QSIVDPPAGDNDICSTILNGPEFSGCMNSSKVD-KEFYATYCRREQSS---NKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECP-PNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGN-NDTIPL-FPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQD-VNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNG-AIIKMENCKKCQC-VQAKFNCTEDYSDCITTCT---PSQFRCDDGKCIESSKICDKVTDCSNSEDEKNC----NVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQI--VCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKC-QMTEYKCNNS----QICILLNNKXXXXXXXXXXXXEHGCECICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDE 5021
            S N C YDY E  +TV  SC   +   +  + +   SVP++    +P   +  Q+S  ++ Y+   ++G P PQC F+     +   CC GY  EN   C   VC+  +GGC NGG C+ P++C+CQ  + G  CDED   + + Q  ++L YC+    C   K + F  K   + +CC+    S+G  SG C +C ++  G   +           F TC S+G +   TFD   Y ++GRCSY+L    + S   W + +   NC +   C K +     D+   V    +  +Y     +    L V ++     D A    G   ++ R D+ I+ S   G ++L+WD+  ++ +++   +++  D+ GLCGN D +  N+F  F N ++FGN++K   CPD AN    C PD +  A+   +C +I   F  C D +    +F  CVQ+ C   +    T      S+V+C HLSAY+  CS  G CI WRS  LC T C   N  W +CASECP TC N  Q  S  CQ +   RC C    V +   C++   CPC Y+G+E P G      C +C C    W C ++  CP TC + G+ F TFDGA+  FN   C+YV +EP+ N TD R NV +  +  TE++L T+ N    N PK V +      I L ATS   G S+ +VFI+ ED T  LPF+  D ++ V+++T++ T VK+ SH  +YFDG ++I IK ++ +++N+ GLCG +DG++END   +++ +  S+  +A+SYITG C ++P      +  D  +G +     +L G  F  C  S+KVD    Y   CRRE +S      Q  +CS+++ AAI C+  G  Y+V F  +   + + LC   GT F +CSRTC+STC +L   +   C++ CFPGC+C   + Y+   G CV +SECTC +   P      AG  +  +C  C C NG   C+ +      VCPKNQV+MD V  C  C +Y+ C  ++ +   CGCP   V K DGTCV  + CPC  + +EY P   + + C +++C ++ W  + ++   CEAVC A GDPHY T D + F+FQG C YTL+   GD+S  +P   IS  N+ CG    TC KFV+IIIG + Y L RG   D  P  F  Y + +E LT +TQ+VSD +GLR+LWDR TRV ++L+  ++  V GLCGNYDG+  N++    +      ++AE +   A+ CP E    N+   +  +D+C  NP RK+W+E  CGV+K+ NG F  C+ A+  D V  +Y NC++DACGC+ GGDCEC+C+++A FA  C+ +G+ VKWR+ + CP+MC+GGK Y  C  PCPQTC  +G     HC    C EGC CP G +D NGECVP + CPC  NG  Y +G +      C++C C   AKF+C      C         + F+C +G CI   ++CD+  DC +  DEK+C      C +  FQC  +G CIP +K+CDG  +C D SDE  C      +  +C +S  CI  +++CDG  DCG NDKSDE +CK+C Q  E++C ++      C+ L  +CDG DDCGDGSDE+ C+CIC + +M LC            C+CI+  K CD V DC +G DE
Sbjct:  218 SENQCDYDYLEANETVA-SCGD-LSFTLAGFTISGDSVPVSPACANPRASIGDQRSACIRKYILDLATGKPTPQCKFSKPQKTTRRGCCPGYGGEN---CQQVVCFPKDGGCQNGGRCVKPDKCECQSGFQGAMCDED---LAELQKDTRLRYCFSDASC-KVKNTKFGRKTTPFSDCCSAGGNSFG-YSGVCTACTSS-TGTRSLGTPTGHSEIVPFDTCSSFGPNSISTFDGLTYEFEGRCSYLLAGSINPSR-RWFVKVAMVNCDTFKSCQKTLRFRLDDLHEFVAVGQSLQVYQISGLDGAQMLKVNDSFQGLFDDARDYSGV-RFIRRGDSIIMTSRSLG-LRLRWDSIGSVQLTLDRPVHSNQDLQGLCGNYDGDKKNEFGEFANPSAFGNAWKAQDCPDSANVPVHC-PDTKTTASAEMECRQIDSIFFPCHDRIPPQEFFQRCVQDACLAIRRGEPT------SEVVCRHLSAYAGLCSLGGICIDWRSSNLCPTNCSEPNMYWKECASECPTTCANYDQVKSELCQVTTSPRCECEPDYVHHKGKCVRKTDCPCRYNGKEFPAGGTFNTQCESCQCIQGRWSCYKRASCPKTCLVTGSSFRTFDGAQLDFNGRTCEYVLLEPAPNVTDSRLNVTITQRVRTENVLITDPNQ-LANLPKRVHISYAAYRIELVATSLNYG-SRASVFINDEDVTNSLPFSNQDDHLLVKQITSLTTMVKIGSHITVYFDGFRNIEIKANERVRSNVKGLCGNYDGDTENDLHPRNSDMFGSVTELAESYITGVCTDSPIPLRQAAFADQVSGSDHCQLALLTGDSFKACRESNKVDLNGHYLRSCRREVASGGVQGQQFLFCSSLVQAAIECKNQG--YDVDFYRD---SVLSLC---GT-FSLCSRTCRSTCSDLE--STEICEEGCFPGCDCQYDSQYRDHHGTCVRKSECTCRDRFNPDSAIYKAGDVLQRSCTNCTCSNGAFVCEDEACEDKVVCPKNQVFMDLVPSCQRCEDYNNCPRSAMLQKRCGCPGGQVKKSDGTCVPANQCPCKLLKKEYPPMHKLKMACKRFVCKDQTWKQIGKDR-KCEAVCKAQGDPHYFTFDKKKFNFQGKCQYTLVSFDGDASRGLPKFHISAQNVPCGSKQVTCTKFVRIIIGDERYTLVRGQEKDEFPAPFASYGVKLEHLTLYTQVVSDVLGLRILWDRKTRVLIYLRKDYRRQVSGLCGNYDGNAGNDFTFNNLPMASVDEWAEKYRTGAESCPAEDGSRNS---NGWRDICEQNPGRKTWSELTCGVIKNPNGPFKDCLLALDDDTVQTFYENCIFDACGCDSGGDCECVCSAMAGFADHCSDVGVHVKWRSMDNCPLMCDGGKRYMPCMEPCPQTCRNLGDEPAPHCQNAACTEGCGCPEGTVDQNGECVPISVCPCQRNGTEYQHGQSYFDEATCRECTCGANAKFSCQVKLDKCKVKPKCEDETNFQCTNGACIPREQVCDRKFDCLDRSDEKDCTPVNTTCSVAFFQCQRDGNCIPESKRCDGKAHCSDGSDEFDCQKCTDSLYYLCPVSGECIHRRQLCDGRIDCGFNDKSDESDCKECDQGAEFRCGSTIDKPGPCVPLRKRCDGHDDCGDGSDEYNCKCICTDDDMFLC----------DTCKCISSVKFCDKVRDCEDGTDE 1847          
BLAST of SCO-spondin vs. TrEMBL
Match: A0A267FR15 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011629g1 PE=4 SV=1)

HSP 1 Score: 989.949 bits (2558), Expect = 0.000e+0
Identity = 562/1410 (39.86%), Postives = 781/1410 (55.39%), Query Frame = 3
Query:  204 SCNKYIGLMMENYNLDEKSVPIAEQYQDPSIPVSKQQSLSMQLYV---SSGMPEPQCNFTLQNIVSEENCCVGYENFPYCNISVCYSDNGGCYNGGICMSPNQCKCQENYAGMQCDEDNPIIIQSQHPSQLYCYQSDQCFAFKKSDFLGKAVSYDECCADKTGSWGSQSGSCVSCKANFAGGNDVNNE--NFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDV-----------VVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGD-VTGLCGXXXXXXXXXXXXXXXVASFGNSFKGFGCPDIANTLSTCK-PDDQILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKI-CPSTCGIMGTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPA------GDNDICSTILNGPEFSGCMNSSKVD-KEFYATYCRREQS----SNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECP-PNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNN-DTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDV-NRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSY 4334
            SC   + + ME   +D+ SVPI       +    +++ LS+Q Y+   +     P C F     + +  CCVGY+    C   VC+ D GGC NGG C+ PN C+C  NY G  CDED   I    +P++ YCY  D C   KK+ F    V++  CC+D TGS+G Q G C+SCK +    N+   E   F TC SYG + YRTFD   + YQGRC+Y+L A S    + W   I   NC     C K I +   D+           V K SG     T  +N  L   S  N  + +        V R+   + L++ +  +KLKWDN N++F+++  S++    + GLCG+ D + +NDF +  N A+FGN +K   C DIAN    C+ P+DQ  A   C  I   F  C   ++       CVQ++C   +   T+    + S VLC+HLSAYS  CS +G CI WR  T+C   CP    WS+CAS CP TC N  Q  SA C++S V RC CGSG V Y  TCI+P  CPC Y+  E+ PG+    DC+TC C +  W CT    CP  C I G+   TFDGAK  FN +GC Y  +EP     D R  V V ++ + E +L    +S ++N PK++TVK  G  I LK+ +   G ++ +V IDG D T  LP+      I VR+LT+ Y  VK+ +H  +YFDG +++ +K +  L   + GLCG FD  +END   K + +    V +A+SY++GSC  T   +  P +      G +D    +LN   F  C +S KVD   +Y  +C++E++     N  +L YC+A ++AA AC+  G Q +   T + L  C P C +GG  F IC+RTC+S+    + ++ S C+  CFPGC+C   N Y+   G CV +SECTC +          +G  I+  C  C C NG   C         VCPK+QVY+D++  C  C NYD C    S +  CGCP D V K DG+CV    CPCIY+  EY P  ++ I C  Y C +R W  ++E+   CEAVC+AYGDPHY T D + +SFQGSC Y LM +  +++  +PPI +S  NI CG    TC KFV++ +G  TY+L RG   D +P+   Y +  E+ T FTQLVSD +GLR+LWDRSTRVY+F+KP F   V GLCGN+DG+  N++    +   + I+FA +F    D          + +P    +MC AN  R+ +AE +CG +K   GVF++C + + QDV   +Y NC+YDACGC+ GGDCEC+CT L+ FAT CA  G+ V+WR Q+ CPIMC GG+ Y  C  PC +TC  +G     HC  + C+EGC+CPNG ++ + EC+P   CPCFY G+ Y
Sbjct:   66 SCGNMVEMTMEGLTIDKSSVPILTDAALANRTTHEKRQLSLQTYIRDFAYSKATPNCTFYKLTNIEKTQCCVGYDG-SNCQTVVCFVDRGGCLNGGKCVKPNVCQCATNYLGTNCDEDLNAI--KNNPNEQYCYSDDACLT-KKTGFGSSRVAFGRCCSDGTGSFGYQKG-CMSCKTSTVAKNNTGVEVVPFDTCVSYGPNSYRTFDGLTFEYQGRCTYLL-AGSTNPTMKWWCTITLLNCDKFETCRKQITMRFDDINQYVALGYNVQVFKLSGTTGATTLTANVTLEENSEPNEWNGV-------KVERKGVNVYLTVRSIGVKLKWDNENSVFVTVDRSLHKNRGLKGLCGDYDGDATNDFGSAPNPAAFGNQWKSESCQDIANVPIHCESPEDQAAAEGDCRPINNVFFQCHSKISPTQVVKRCVQDMCILKKKGETSDS--AKSSVLCSHLSAYSYQCSLEGICIDWRGSTMCPQSCPALMTWSECASACPTTCANYDQLKSATCESSMVPRCKCGSGYVHYKSTCIRPNECPCTYNSVEYMPGSNLVVDCSTCNCANGRWQCTYNPNCPKMCSITGSHIVTFDGAKMDFNPMGCAYTLLEPVSGANDSRLQVQVTMEPSPEYLLAVTADSQFVNLPKMITVKYRGVTIQLKSVTLAAG-TRPSVIIDGVDFTNSLPYENVRSQILVRQLTSFYAMVKIGNHLSVYFDGYRTVELKGAKLLSQKIEGLCGNFDSKTENDLHTKGSDMIAPPVQVAQSYVSGSCSKTAAELPSPGSTSQSLSGVDDCTQVLLNSDSFKACRDSKKVDILGYYYRFCQKEKACGGIPNIGEL-YCTAAMSAARACKTAGFQIDFS-TDSRLSKCAPSCMSGGGSFTICARTCRSS--CSDLSSTSICELGCFPGCDCQYDNQYRDAYGTCVRQSECTCLDRYNRNGKIYRSGAVISRQCTNCTCANGDFACGNSSCADKVVCPKDQVYLDTMPACQKCINYDKCQSNQSESGRCGCPGDLVKKADGSCVAKPHCPCIYLGTEYLPGHILKIGCKTYKCVSRTWTKIAEDATKCEAVCVAYGDPHYSTFDRKAYSFQGSCQYILMKSDANAALGLPPIEVSAQNIPCGSQQVTCTKFVRVKVGSDTYVLVRGREPDQLPVAMNYGMRREKFTLFTQLVSDQLGLRILWDRSTRVYVFVKPHFNSKVSGLCGNFDGNADNDFTIKNLPINNPIEFASNFRTGGDS-CASEESSASKSPQSWIEMCTANSRRRDYAESVCGAIKSKTGVFSACQQVLEQDVIENFYENCMYDACGCDTGGDCECVCTVLSAFATTCAESGVSVQWRFQDQCPIMCTGGRVYQPCMPPCAKTCHNVGLEPEPHCVNSQCIEGCACPNGYVEHDNECIPSDNCPCFYQGKEY 1454          

HSP 2 Score: 114.775 bits (286), Expect = 1.656e-21
Identity = 98/400 (24.50%), Postives = 157/400 (39.25%), Query Frame = 3
Query: 3318 CIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKY----------------------DIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGN--VQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNA-----NPDRKSWAEQMCGVMKDTNGVFASCIEAMH--QDVNRYYSNCLYDACGCNRGGDCE------CLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCT 4406
            C++YG   Y+T DG  F +QG C Y L      S+N       ++  + C     TC K + +        ++ G N  +                             + +E+      L   SIG+++ WD    V++ +  S   N  ++GLCG+YDGD  N++                        P   +  N       QD+ N      +P+ ++ AE  C   +  N VF  C   +   Q V R    C+ D C   + G+         LC+ L+ ++ QC+  GI + WR   +CP  C     +  CAS CP TC        + C ++  V  C C +G +     C+ P  CPC YN   Y+ G+ + ++ C  C C   ++ CT
Sbjct:  255 CVSYGPNSYRTFDGLTFEYQGRCTYLL----AGSTNPTMKWWCTITLLNCD-KFETCRKQITMRFDDINQYVALGYNVQVFKLSGTTGATTLTANVTLEENSEPNEWNGVKVERKGVNVYLTVRSIGVKLKWDNENSVFVTVDRSLHKNRGLKGLCGDYDGDATNDFGSA---------------------PNPAAFGNQWKSESCQDIANVPIHCESPEDQAAAEGDC---RPINNVFFQCHSKISPTQVVKR----CVQDMCILKKKGETSDSAKSSVLCSHLSAYSYQCSLEGICIDWRGSTMCPQSCPALMTWSECASACPTTCANYDQLKSATCESSM-VPRCKCGSGYVHYKSTCIRPNECPCTYNSVEYMPGSNLVVD-CSTCNCANGRWQCT 619          

HSP 3 Score: 92.8189 bits (229), Expect = 6.769e-15
Identity = 90/372 (24.19%), Postives = 155/372 (41.67%), Query Frame = 3
Query:  765 TTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWS-INIVYENC---TSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGN---IKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXX----XXXXXXXXXVASFGNSFKGFG------------CPDIANTLSTCKPDDQILANQQCSKIRLK---FPGCADLVNSDT---YFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSK-VGRCICGSGEVEYGYTCIKPESCPCLYDGQEHP 1790
              C +YG  +Y TFD + Y++QG C YIL      +A+    I +  +N    +    C K + ++ G      S   +L      + L              P    Y +R++ F L +    +   +++ WD +  +++ +     +  V+GLCGN D N     +      +N   F ++F+  G             P     + T     +  A   C  I+ K   F  C  ++  D    ++  C+ + C          D     + +CT LSA++ +C++ G  +QWR    C   C G +++  C   C  TC N+   P  +C NS+ +  C C +G VE+   CI  ++CPC Y G+E+P
Sbjct: 1113 AVCVAYGDPHYSTFDRKAYSFQGSCQYILMKSDANAALGLPPIEVSAQNIPCGSQQVTCTKFVRVKVG------SDTYVLVRGREPDQL--------------PVAMNYGMRREKFTLFTQLVSDQLGLRILWDRSTRVYVFVKPHFNS-KVSGLCGNFDGNADNDFTIKNLPINNPIEFASNFRTGGDSCASEESSASKSPQSWIEMCTANSRRRDYAESVCGAIKSKTGVFSACQQVLEQDVIENFYENCMYDACG--------CDTGGDCECVCTVLSAFATTCAESGVSVQWRFQDQCPIMCTGGRVYQPCMPPCAKTCHNVGLEPEPHCVNSQCIEGCACPNGYVEHDNECIPSDNCPCFYQGKEYP 1455          

HSP 4 Score: 90.8929 bits (224), Expect = 2.868e-14
Identity = 145/604 (24.01%), Postives = 233/604 (38.58%), Query Frame = 3
Query: 3033 CPKNQVYMDSVSGC-NSCTNYD---TCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQG-SCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCA-------------KFVQIIIGGQTYLLSRGNNDTIPL--------FP----KYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNE-YMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDV-NRYYSNCLYD-ACGC--NRGGDCECLCTSLATFATQCAFLGIPVKW----RTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCP--NGMIDLNGECVPPTTCPCF----YNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEIS-CGCLPHQIVCNISRTCIEE 4706
            CP    + +  S C  +C NYD   + T  SS+   C C +  V     TC++P++CPC Y + EY P   + + C+   C+N  W        NC  +C   G  H  T DG    F    C YTL++    ++++   + +++   +  + LA  A             K+  + I  ++  L+ G   ++ +         P    +  I++ QLT F  +V     L V +D    V L         ++GLCGN+D   +N+ +  G+      +Q A+S+++ +  C  + + E     S  Q +        S  +    V+ +++  F +C ++   D+   YY  C  + ACG   N G   E  CT+  + A  C   G  + +    R     P    GG  +  CA  C  +C  + S +        C  GC C   N   D  G CV  + C C      NG+ Y +GA+I  + C  C C    F C                         +S   DKV             VC   Q    +  AC    +KC     C+ N  E   CGC P  +V     +C+ +
Sbjct:  532 CPALMTWSECASACPTTCANYDQLKSATCESSMVPRCKCGSGYV-HYKSTCIRPNECPCTYNSVEYMPGSNLVVDCSTCNCANGRWQCTYN--PNCPKMCSITGS-HIVTFDGAKMDFNPMGCAYTLLEPVSGANDSRLQVQVTM-EPSPEYLLAVTADSQFVNLPKMITVKYRGVTIQLKSVTLAAGTRPSVIIDGVDFTNSLPYENVRSQILVRQLTSFYAMVKIGNHLSVYFDGYRTVELKGAKLLSQKIEGLCGNFDSKTENDLHTKGSDMIAPPVQVAQSYVSGS--CS-KTAAELPSPGSTSQSL--------SGVDDCTQVLLNSDS-FKACRDSKKVDILGYYYRFCQKEKACGGIPNIG---ELYCTAAMSAARACKTAGFQIDFSTDSRLSKCAPSCMSGGGSFTICARTCRSSCSDLSSTSICELG---CFPGCDCQYDNQYRDAYGTCVRQSECTCLDRYNRNGKIYRSGAVISRQ-CTNCTCANGDFACG------------------------NSSCADKV-------------VCPKDQVYLDTMPAC----QKCINYDKCQSNQSESGRCGC-PGDLVKKADGSCVAK 1069          
BLAST of SCO-spondin vs. TrEMBL
Match: A0A267FD04 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009912g1 PE=4 SV=1)

HSP 1 Score: 903.279 bits (2333), Expect = 0.000e+0
Identity = 526/1417 (37.12%), Postives = 774/1417 (54.62%), Query Frame = 3
Query:  138 KSVTSPNNCIYDYNEDVDTVTESCNKYIGLMMENYNLDEKSVPIAEQYQDPSIPVSKQQSLSMQLYV---SSGMPEPQCNFTLQNIVSEENCCVGY--ENFPYCNISVCYSDNGGCYNGGICMSPNQCKCQENYAGMQCDEDNPIIIQSQHPSQL-YCYQSDQCFAFKKSDFLGKAVSYDECCADKTGSWGSQSGSCVSCKANFAGGNDVNNEN-------FTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDV--VVKSSGNGILYTTDSNNPLTPLSVTNT-----DSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXG-DVTGLCGXXXXXXXXXXXXXXXVASFGNSFKGFGCPDIANTLSTCKPDDQILAN--QQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPG-NKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKI-CPSTCGIMGTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTP-----QSIVDPPAGDNDICSTILNGPEFSGCMNSSKVD-KEFYATYCRREQSS---NKDQLSYCSAILNAAIACRRFGIQYEVPF-TSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECP-PNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGN-NDTIPL-FPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQD-VNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMI 4271
            ++  S N C YDY E  +TV  SC   +   +  + +   SVP++    +P   +  Q+S  ++ Y+   ++G P PQC F+     +   CC GY  EN   C   VC+  +GGC NGG C+ P++C+CQ  + G  CDED   + + Q  ++L YC+    C   K + F  K   + +CC+    S+G  SG C +C ++  G   +           F TC S+G +   TFD   Y ++GRCSY+L    + S   W + +   NC +   C K +     D+   V    +  +Y     +    L V ++     D A    G   ++ R D+ I+ S   G ++L+WD+  ++ +++   +++  D+ GLCGN D +  N+F  F N ++FGN++K   CPD AN    C PD +  A+   +C +I   F  C D +    +F  CVQ+ C   +    T      S+V+C HLSAY+  CS  G CI WRS  LC T C   N  W +CASECP TC N  Q  S  CQ +   RC C    V +   C++   CPC Y+G+E P G      C +C C    W C ++  CP TC + G+ F TFDGA+  FN   C+YV +EP+ N TD R NV +  +  TE++L T+ N    N PK V +      I L ATS   G S+ +VFI+ ED T  LPF+  D ++ V+++T++ T VK+ SH  +YFDG ++I IK ++ +++N+ GLCG +DG++END   +++ +  S+  +A+SYITG C ++P      +  D  +G +     +L G  F  C  S+KVD    Y   CRRE +S      Q  +CS+++ AAI C+  G  Y+V F   ++L  C P C+ GG  F +CSRTC+STC +L   +   C++ CFPGC+C   + Y+   G CV +SECTC +   P      AG  +  +C  C C NG   C+ +      VCPKNQV+MD V  C  C +Y+ C  ++ +   CGCP   V K DGTCV  + CPC  + +EY P   + + C +++C ++ W  + ++   CEAVC A GDPHY T D + F+FQG C YTL+   GD+S  +P   IS  N+ CG    TC KFV+IIIG + Y L RG   D  P  F  Y + +E LT +TQ+VSD +GLR+LWDR TRV ++L+  ++  V GLCGNYDG+  N++    +      ++AE +   A+ CP E    N+   +  +D+C  NP RK+W+E  CGV+K+ NG F  C+ A+  D V  +Y NC++DACGC+ GGDCEC+C+++A FA  C+ +G+ VKWR+ + CP+MC+GGK Y  C  PCPQTC  +G     HC    C EGC CP   +
Sbjct:   61 QASNSENQCDYDYLEANETVA-SCGD-LSFTLAGFTISGDSVPVSPACANPRASIGDQRSACIRKYILDLATGKPTPQCKFSKPQKTTRRGCCPGYGGEN---CQQVVCFPKDGGCQNGGRCVKPDKCECQSGFQGAMCDED---LAELQKDTRLRYCFSDASC-KVKNTKFGRKTTPFSDCCSAGGNSFG-YSGVCTACTSS-TGTRSLGTPTGHSEIVPFDTCSSFGPNSISTFDGLTYEFEGRCSYLLAGSINPSR-RWFVKVAMVNCDTFKSCQKTLRFRLDDLHEFVAVGQSLQVYQISGLDGAQMLKVNDSFQGLFDDARDYSGV-RFIRRGDSIIMTSRSLG-LRLRWDSIGSVQLTLDRPVHSNQDLQGLCGNYDGDKKNEFGEFANPSAFGNAWKAQDCPDSANVPVHC-PDTKTTASAEMECRQIDSIFFPCHDRIPPQEFFQRCVQDACLAIRRGEPT------SEVVCRHLSAYAGLCSLGGICIDWRSSNLCPTNCSEPNMYWKECASECPTTCANYDQVKSELCQVTTSPRCECEPDYVHHKGKCVRKTDCPCRYNGKEFPAGGTFNTQCESCQCIQGRWSCYKRASCPKTCLVTGSSFRTFDGAQLDFNGRTCEYVLLEPAPNVTDSRLNVTITQRVRTENVLITDPNQ-LANLPKRVHISYAAYRIELVATSLNYG-SRASVFINDEDVTNSLPFSNQDDHLLVKQITSLTTMVKIGSHITVYFDGFRNIEIKANERVRSNVKGLCGNYDGDTENDLHPRNSDMFGSVTELAESYITGVCTDSPIPLRQAAFADQVSGSDHCQLALLTGDSFKACRESNKVDLNGHYLRSCRREVASGGVQGQQFLFCSSLVQAAIECKNQG--YDVDFYRDSVLSLCAPPCRVGGGTFSLCSRTCRSTCSDLE--STEICEEGCFPGCDCQYDSQYRDHHGTCVRKSECTCRDRFNPDSAIYKAGDVLQRSCTNCTCSNGAFVCEDEACEDKVVCPKNQVFMDLVPSCQRCEDYNNCPRSAMLQKRCGCPGGQVKKSDGTCVPANQCPCKLLKKEYPPMHKLKMACKRFVCKDQTWKQIGKDR-KCEAVCKAQGDPHYFTFDKKKFNFQGKCQYTLVSFDGDASRGLPKFHISAQNVPCGSKQVTCTKFVRIIIGDERYTLVRGQEKDEFPAPFASYGVKLEHLTLYTQVVSDVLGLRILWDRKTRVLIYLRKDYRRQVSGLCGNYDGNAGNDFTFNNLPMASVDEWAEKYRTGAESCPAEDGSRNS---NGWRDICEQNPGRKTWSELTCGVIKNPNGPFKDCLLALDDDTVQTFYENCIFDACGCDSGGDCECVCSAMAGFADHCSDVGVHVKWRSMDNCPLMCDGGKRYMPCMEPCPQTCRNLGDEPAPHCQNAACTEGCGCPRERL 1446          

HSP 2 Score: 130.183 bits (326), Expect = 3.378e-26
Identity = 120/428 (28.04%), Postives = 182/428 (42.52%), Query Frame = 3
Query: 3315 VCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACG----------FSLATCAKFVQIIIGGQTYLLSRGN-------NDTIPLFPKYDIVIEQLTFFTQ-----LVSDSIGLRVLWDRSTRVYLFLKPSFQGN--VQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWA--EQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGD--CECLCTSLATFATQCAFLGIPVKWRTQNLCPIMC-EGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTC--TPSQFRCDDGKCIE-SSKICDKV 4502
             C ++G     T DG  + F+G C Y L  +   S        + VA + C           F L    +FV +    Q Y +S  +       ND+             + F  +     + S S+GLR+ WD    V L L      N  +QGLCGNYDGD +NE+     ++ +   F  ++ A       +  P++   P          PD K+ A  E  C   +  + +F  C + +      ++  C+ DAC   R G+   E +C  L+ +A  C+  GI + WR+ NLCP  C E   ++  CAS CP TC          C  T     C C    +   G+CV  T CPC YNG+ +  G     + C+ CQC+Q +++C +  S C  TC  T S FR  DG  ++ + + C+ V
Sbjct:  273 TCSSFGPNSISTFDGLTYEFEGRCSYLLAGSINPSRRWF----VKVAMVNCDTFKSCQKTLRFRLDDLHEFVAVGQSLQVYQISGLDGAQMLKVNDSFQGLFDDARDYSGVRFIRRGDSIIMTSRSLGLRLRWDSIGSVQLTLDRPVHSNQDLQGLCGNYDGDKKNEFG----EFANPSAFGNAWKA-------QDCPDSANVPVH-------CPDTKTTASAEMEC---RQIDSIFFPCHDRIPP--QEFFQRCVQDACLAIRRGEPTSEVVCRHLSAYAGLCSLGGICIDWRSSNLCPTNCSEPNMYWKECASECPTTCANYDQVKSELCQVTTSPR-CECEPDYVHHKGKCVRKTDCPCRYNGKEFPAGGTFNTQ-CESCQCIQGRWSCYKRAS-CPKTCLVTGSSFRTFDGAQLDFNGRTCEYV 670          

HSP 3 Score: 114.775 bits (286), Expect = 1.407e-21
Identity = 138/587 (23.51%), Postives = 231/587 (39.35%), Query Frame = 3
Query: 2976 VCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGC-NSCTNYDTCTD---TSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQG-SCMYTLMDTPGDSSNNIPPITIS---------------VANIACGFSLATCAKFVQIIIGGQTYLLSRGN--------NDTIPLFPKYD-IVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNE-YMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYY-SNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKW---RTQNLCPIMCE-GGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCP--NGMIDLNGECVPPTTCPC---FYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGT 4616
            +CI+ R +     NC+ P    N  + +  S C  +C NYD         + +  C C  D V    G CV+ +DCPC Y  +E+        +C    C    W+    + A+C   C+  G   ++T DG    F G +C Y L++   + +++   +TI+               +AN+     ++  A  ++++     Y  SR +         +++P   + D ++++Q+T  T +V     + V +D    + +      + NV+GLCGNYDGD +N+ +   +  +    + AES+I    +C     P    A +          D+ S ++  C +   T   F +C E+   D+N +Y  +C  +       G     C+SL   A +C   G  V +      +LC   C  GG  +  C+  C  TC  + S   +      C  GC C   +   D +G CV  + C C   F    +      +   +C  C C    F C ++  +    C  +Q               D V  C   ED  NC    + Q +C   G      KK DGT
Sbjct:  534 ICIDWRSSNLCPTNCSEP----NMYWKECASECPTTCANYDQVKSELCQVTTSPRCECEPDYVHH-KGKCVRKTDCPCRYNGKEFPAGGTFNTQCESCQCIQGRWSCY--KRASCPKTCLVTGS-SFRTFDGAQLDFNGRTCEYVLLEPAPNVTDSRLNVTITQRVRTENVLITDPNQLANLPKRVHISYAAYRIELVATSLNYG-SRASVFINDEDVTNSLPFSNQDDHLLVKQITSLTTMVKIGSHITVYFDGFRNIEIKANERVRSNVKGLCGNYDGDTENDLHPRNSDMFGSVTELAESYITG--VCTDSPIPLRQAAFA----------DQVSGSDH-CQLALLTGDSFKACRESNKVDLNGHYLRSCRREVASGGVQGQQFLFCSSLVQAAIECKNQGYDVDFYRDSVLSLCAPPCRVGGGTFSLCSRTCRSTCSDLES---TEICEEGCFPGCDCQYDSQYRDHHGTCVRKSECTCRDRFNPDSAIYKAGDVLQRSCTNCTCSNGAFVCEDEACEDKVVCPKNQV------------FMDLVPSCQRCEDYNNCPRSAMLQKRCGCPGG---QVKKSDGT 1080          
BLAST of SCO-spondin vs. Ensembl Cavefish
Match: scospondin (subcommissural organ spondin [Source:ZFIN;Acc:ZDB-GENE-051114-1])

HSP 1 Score: 526.168 bits (1354), Expect = 9.635e-154
Identity = 421/1479 (28.47%), Postives = 670/1479 (45.30%), Query Frame = 3
Query:  510 CQENYAGMQCDEDNPIIIQSQHPSQLYCYQSDQCFAFKKSDFLGKAVSYDECCADKTG-SWGSQSG-SCVSC----------------KANFAGGNDVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCG-----XXXXXXXXXXXXXXXVASFGNSFK-----GFGCPDIANTLSTCKPDDQIL----ANQQCSKIRLK-FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMGT-QFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKI-VTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPAG-------DNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSS-NKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDD-----CFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDT----CTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFP--------KYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPE-NNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDV--NRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCDDG--KCIESSKICDKVTDCSNSEDE----KNCN-VCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDC 4736
            C E +AG  C +   +        +  C+ +  C  F         +S ++CC    G SW + S  +C+SC                K +  G +  N +   TC S+G  +YR+FD + + +QG C+Y+L + +D    TW++ I    C     C K + +  G  +V            SN  L  L +   +  +   G  ++ L   +F+ +    G +++K+D +N ++++++   +     GLCG       D+      S     ASFGNS++       GC D A    +C     +     A   C +++   F  C   V+   Y   C+   C+  +              +C  L++Y+  C+ +   + WR   LCE  CPG +++SDC S CP +C +     S  C+   VG C C  G   +   C++ + CPC +    +  G   +  CNTC C    W C+ + C + C I+G     TFD   +     GCQ++ VE  V+       + V I++      G  G    ++   +  TV VN               S+ +V ++G+     LP    D  + VR+ T+ +  V+V     L+      + I +     + + GLCG    N  +DFT  +  +  S+ + A  +  GSC  +     DP +           +C+ +L+   F  C +   V++E Y   C+ E  S    +L +C+ +   A  C + G+       S       P+  +GG V+Q C R C  +C +L ++    C+++     C PGC+CP    +   GQCV    C C +      P    G+++ INC TCVC  G  NC          CP + ++    S   +C++ D+    CT+       C CP  TV   D  CV P +CPC +  R +  ND I+  C   +C  R W+   +    C   C+A GDPHY T DG+ +SF G C Y L              ++S  N+ CG +  TC K V + +G     L RG + T+   P           +V+E++  F  L S  +G+ +LWD   RVY+ L+P  QG V GLCGN+DGD +N++       +  ++       N+    +++SP   +VA    +D C  NP R +WA++ C V+  T  +F+ C    H +V   +YY  C++DACGC+ GGDCECLCT++A +A +C   G+ + WR+Q LCP+ CE G  Y+ C S C   C +   +  SHCS   CVEGC CP+G +     C+ P+ CPC + G  +  GA++  ++C+ C C    ++CT      +  C  S+F+C  G  +CI S  +CD   DC +  DE      C  VC  ++F+C S+  CI    +CDG  +C D SDE  C C   +  C   + CI  K++CDG+ DC
Sbjct:  104 CCEGWAGPHCSQGVSV--------RGLCFSTWNCEGFPGVQNF-SLMSIEQCCGSLWGLSWKNASDQTCLSCSYTLLPDPQTSPLLLRKGHLGGLH--NPKASATCMSWGGVHYRSFDRKHFHFQGGCTYVLASSTDG---TWAVYI-STVCDGGGHCSKALQMMLGRDLVS--------VNKSNMSLNGLIIAQGE-PVFQNGVSIHWL--GDFVFVESGLG-VRIKFDLSNTVYLTVNTEHFAA-TRGLCGVYNNNAEDDFTGRSGSISQYAASFGNSWRVPDQQTEGCSDAAELGHSCDVTGDVSLRRGAESACHQLKESPFSHCHHQVDPGPYVDTCLYVYCSLGEKERV--------GAVCDTLASYARECAQQHIILSWRRPDLCERVCPGGQLFSDCVSSCPPSCSSALPPASGQCREECVGGCECPPGLYLHRGQCLRKDDCPCFHRRHTYQEGDTIKQKCNTCVCQGGQWQCSSERCAAQCSIIGAMHISTFDKKSYNLQAGGCQFIVVEDFVDK-----KLAVTIRAGECVTGGRTGCPQEMSVTALHTTVTVN---------------SKGSVILNGQPEA--LPVLTAD--LAVRRATSSFLLVQVFGARLLWHTDGSLVVITLEPGFAHKVRGLCGTLTWNQHDDFTTPEGDVENSVPSFAAKFNIGSCPLSSAVTSDPCSTYTQRRQYAESVCA-VLHSAVFQACHDV--VEREPYVRMCQTEVCSCATHRLCHCTVVTAYAQHCAQEGV-----LVSWRNHTFCPVQCSGGQVYQECGRACGGSCADLQQSWV--CEENAGSRTCVPGCQCPEGLMQDDQGQCVPVDMCPCVHGGAVHQP----GSSVQINCNTCVCGKGVWNCSDDPCPEVRECPGSLIFSPG-SCLRTCSSLDSPQALCTEP---IYGCVCPEGTVLLGD-QCVTPDECPCHHNGRLFFTNDTISKDCNTCVCKQRRWHCTQQL---CAGTCVATGDPHYVTFDGRCYSFLGDCEYMLAQEMSGL------FSVSAENVPCGSTGVTCTKSVTLTVGNTAIHLLRGKSVTVNGMPVTLPKSYSGSGLVLEKVGMFVSL-SSRLGVTLLWDGGMRVYVRLEPHLQGRVGGLCGNFDGDTENDFT----TRQGIVESTPELFGNS----WKVSPSCPDVAEQDLRDPCVINPHRVTWAKKKCAVI--TQELFSLC----HAEVPYQQYYDWCVFDACGCDSGGDCECLCTAIAAYAEECNRRGVYIHWRSQELCPLQCEDGLVYEPCGSTCSAVCPSSTPSVHSHCSPLSCVEGCFCPHGTVRHGDGCITPSECPCEWEGSLFPAGAVL-TQHCQNCTCSNGTWDCTGPACPPLVPCLESEFQCTRGSQRCIPSIWLCDNEDDCGDGSDEICPSTYCGVVCAEEEFRC-SSSRCILYLHRCDGHDDCGDFSDERGCVCSLGEFQCPGDQ-CIPAKRVCDGHRDC 1476          

HSP 2 Score: 60.8474 bits (146), Expect = 1.516e-8
Identity = 70/257 (27.24%), Postives = 99/257 (38.52%), Query Frame = 3
Query: 2724 CQAGGTVFQI-CSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNC------------------------------------------KTKDN--CTNPVCPKNQVYMDSVSGCN-SCTNYDTCTD--TSSIANSCGCPNDTVSKIDGTCVQPSDCPC-----------IYMNR---EYAPNDVITIKCAKYICSNRMWNLLSEETANC 3308
            C+  G V++  C+  C  +C +L E         C PGC CP  +     G+CV  + C C  P+     E+  G N+T++C TCVCING L C                                          +T+ N  CT P CP  QV+      C  SC +    ++    + +  C CP  TV   +GTCV  S+CPC           I +N    E  P  V+   C   +C N ++N   E    C
Sbjct: 4496 CEDRGRVYEANCANQCPRSCADLWEHVQCL-QGTCHPGCRCPDGWLLQ-EGECVRVTACRCGLPTENGTLELSPGQNVTVDCNTCVCINGSLVCTNQPCPTYGSWGSWSECSVSCGTGQRIRRRSCTHKPGGPPCSETEQNQTCTQP-CPAGQVFSACAGSCPFSCQDLWPESECVPGACSPGCACPPATV-MFNGTCVPHSECPCSPVSLLLTSPNITLNALPDEVPPGTVVPHLCNFCVCDNGVFNCTEESCDAC 4748          

HSP 3 Score: 60.077 bits (144), Expect = 2.798e-8
Identity = 61/185 (32.97%), Postives = 79/185 (42.70%), Query Frame = 3
Query: 2706 QACIPLCQAGGTVFQICSRTCQSTCRELNEATASKC-DDDCFPGCECPPNYYKTGTGQCVSESECTCWNPS----------RPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSV--------SGCNSCTNYD--TCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPC 3197
            Q C   C AG  VF  C+ +C  +C++L     S+C    C PGC CPP       G CV  SEC C   S               E+P GT +   C  CVC NG  NC T+++C    CP+ + +  SV         GC      +   CT T  I+  C C +      DG CV P+ C C
Sbjct: 4635 QTCTQPCPAG-QVFSACAGSCPFSCQDL--WPESECVPGACSPGCACPPATVMF-NGTCVPHSECPCSPVSLLLTSPNITLNALPDEVPPGTVVPHLCNFCVCDNGVFNC-TEESCD--ACPEGERWRRSVLEMDRVCERGCVDMYRAEPLNCTSTHGISEGCVCEDGRYRSTDGRCVIPALCQC 4812          

HSP 4 Score: 51.9878 bits (123), Expect = 8.371e-6
Identity = 32/93 (34.41%), Postives = 45/93 (48.39%), Query Frame = 3
Query: 4173 PCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQF 4451
            PCP TC  + S    +CS  HC+ GC CP G+   +G CV  + C C + G     G  +  ++C  C C     +C  D S CI+ C  S +
Sbjct: 2506 PCPLTCSDLHSE--RNCSH-HCLTGCRCPAGLFLQDGHCVNASKCLCLWEGSELQPGEEVTPDSCTTCMCQDGHVSC--DNSSCISKCDWSAW 2593          
BLAST of SCO-spondin vs. Ensembl Cavefish
Match: vwf (von Willebrand factor [Source:NCBI gene;Acc:103041546])

HSP 1 Score: 328.176 bits (840), Expect = 3.594e-90
Identity = 330/1301 (25.37%), Postives = 539/1301 (41.43%), Query Frame = 3
Query:  756 ENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVV-VKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVAS-----FGNSFKGFG----CPDIANTLSTCKPDDQILAN--QQCSKIRLK--FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCI-QWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQ-----SNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVS--SHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY-ITGSCDNTPQSIVDPPAGD-------NDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKD-QLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNC---------------------KTKDNCTNPVCPKNQVYMDSVSG-----CNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIP-PITISVANIACGFSLATCAKFVQII-IGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYE-DAIQFAESFIANADICPYEISPE--NNV-APSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGK---------HYDACASPCPQTCDTIGSNAPSHCS-TTHCVEGC--SCPNGMI--DLNGECVPPTTCP-CFYNGQSYVNGAIIKMEN-----CKKCQCVQAKFNCT 4406
            E    C  +G  +  TFD  +Y + G CSY L    D    T+SI     +     G  K + +  G+   +  S  G+L       PL P + ++  +   +    ++   +  F +    A NI+L    ++                GLCGN ++ P+++++  +   +     F NS+   G    C  +     TC        +   +C  +R    F  CA LV++D + ++C  ++C                + +C  L  Y+ +C+  G  +  W + + C  +CP    +S+C+  C  +C++L       C+   V  C C  G+V  G  C++   C C + G+ +PPG+    DCNTC C    W CT + CP  C + G + + TFD   F F+   CQY+  +      D + N+F  I      ++ +  + T   +   +E    TV++    +               V +DG D        +P  N  +R  + + + V+++     +L +DG   + +++S      + GLCG ++GN  +DF      +   +     ++ +   CDN  +   DP + +        + C+ +L+ P+F  C +  +V+   Y   CR +  S  D Q   C+A+ N A AC   G+       +   Q    L   G  V+++C   C  TCR       S C   C  GC CP   Y T TG+CV   +C+C        P      + +I    C C NG + C                     + + + + P  P  Q+  +SV         +C N D    +    + C CP  TV +    CV P  CPC + N  Y+P   I I C   +C  R W         C+ VC   GD HY + DG  F+F G C Y L     D  N +     I V N ACG     C K + +  +GG   +         P+  + D+ I +  F+  +V     + + WD  TR+ L +   ++G V GLCGN+DG   N+ +    + E D + F  S         +++ P   N V  PS+    C+ +  ++   EQ C V+   + +F  C   +  D   Y+  C +D C C   GDC C C ++A +A +CA  G+ V WR+ +LCP+ CE             ++AC + CP+TC       P   S    C+EGC  SCP G I  ++   CV P+ C  C +NG+   +G  I + +     C+ C C +    C 
Sbjct:   23 EGGGRCSLFGRHHVHTFDGVIYEFPGDCSYKLAG--DCHHRTFSILGDLSH-----GRRKGVTVFLGETFELHLSVGGVLSQGAERLPL-PYASSSVFAGFELGSVRLWS-EEFGFSIRIDPAHNIQLTLSKHHA-----------NHTCGLCGNYNSVPTDEYTAQEGFLTEDPYDFANSWAMNGASEACKRVTPPAQTCNNTGASARDLMSRCETLRTSPVFLHCAHLVDTDAFAAVCESDVCHCVDGQ----------ECVCQALLEYARTCASHGLVLPNWHTQSQCTPKCPIGMQYSECSQACSTSCQSL--NIHEVCREECVDGCSCAVGKVLDGDRCVEVSQCSCQHTGKRYPPGSTISQDCNTCVCRHGSWECTNEECPGQCVVSGQSHYKTFDDKFFTFSGF-CQYLLAK------DCQTNLFSAIIDTVQCADDQDAVCTRSVTLKFHELANQTVRLKHGGV---------------VSVDGLD------VQMPLINGLLRVQSTVLSSVRLNYGDDLQLDWDGRGRVVLRLSPVYAGKMCGLCGNYNGNQGDDFLTAGGLVETRVEGFGNAWKMNAECDNIQKQPSDPCSLNPKRVRFAEEACALLLS-PKFEPCHH--EVNPYPYLKNCRYDVCSCADGQECLCAAVSNYAAACSARGV-----LINWRGQGYCELTCPGNQVYEVCGSVCNQTCRS-RSLPDSACRSMCEEGCFCPRGLYLTDTGECVPPDQCSCHYDGEIYQPNDMFADHHSI----CYCENGSMRCSSSELPASVLSDLFFDEPPLSRERRSVSCPA-PLQQLRCESVRDVGIECARTCQNLDLECVSQGCISGCVCPPGTV-RHRRECVPPDQCPCFHNNHAYSPGQSIKIDCNTCVCGGRQWKCTQRV---CDGVCHTVGDSHYISFDGLKFTFPGPCQYILAQ---DYCNGLDGTFRILVENSACGTIGHRCRKSISVFYMGGLIVMEQEEVKMKKPVMKETDVEIVRSGFY-YIVLLGKNISITWDTGTRIILQISGQYRGKVCGLCGNFDGSQNNDLLSSNNQIEVDPLDFGNS---------WKVQPSCANAVQVPSQ----CSTDMSKQVTVEQSCRVLN--SDLFRECNSVV--DPEPYWEICTHDTCSCASVGDCACFCDAIAAYAHECAQKGVVVDWRSNDLCPLSCEELNKDAGVECMWRFNACDTACPKTC-----QHPEQLSCPIACLEGCHASCPQGQILDEVLRRCVEPSECQVCMHNGERISHGKQIILNHGDPHLCQICHCEENTLTCA 1219          

HSP 2 Score: 101.293 bits (251), Expect = 7.626e-21
Identity = 101/375 (26.93%), Postives = 154/375 (41.07%), Query Frame = 3
Query: 3318 CIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVAN-IACGFSLATCAKF-VQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFT-QLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEY-MHGTMKYEDAIQFAESFIAN--ADICPYEISPE---NNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPV-KWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTED 4412
            C  +G  H  T DG ++ F G C Y L    GD  +    I   +++    G ++     F + + +GG   +LS+G  + +PL      V       + +L S+  G  +  D +  + L L      +  GLCGNY+    +EY        ED   FA S+  N  ++ C     P    NN   S    M      R             T+ VF  C   +  D + + + C  D C C  G   EC+C +L  +A  CA  G+ +  W TQ+ C   C  G  Y  C+  C  +C ++  N    C    CV+GCSC  G +     CV  + C C + G+ Y  G+ I  ++C  C C    + CT +
Sbjct:   28 CSLFGRHHVHTFDGVIYEFPGDCSYKLA---GDCHHRTFSILGDLSHGRRKGVTVFLGETFELHLSVGG---VLSQGA-ERLPLPYASSSVFAGFELGSVRLWSEEFGFSIRIDPAHNIQLTLSKHHANHTCGLCGNYNSVPTDEYTAQEGFLTEDPYDFANSWAMNGASEACKRVTPPAQTCNNTGASARDLMSRCETLR-------------TSPVFLHCAHLV--DTDAFAAVCESDVCHCVDGQ--ECVCQALLEYARTCASHGLVLPNWHTQSQCTPKCPIGMQYSECSQACSTSCQSL--NIHEVCR-EECVDGCSCAVGKVLDGDRCVEVSQCSCQHTGKRYPPGSTIS-QDCNTCVCRHGSWECTNE 374          

HSP 3 Score: 92.4337 bits (228), Expect = 4.643e-18
Identity = 100/410 (24.39%), Postives = 167/410 (40.73%), Query Frame = 3
Query:  699 SGSCVSCKANFAGGNDVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVI---EAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLE---AGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCG-----XXXXXXXXXXXXXXXVASFGNSFK-GFGCPDIANTLS---TCKPDDQILANQQCS-KIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSG-EVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPST 1877
            S  C +C          N E    C   G  +Y+TFD++ +T+ G C Y+L      +  +  I+ V      D  C + + +   E  +  V+    G++ + D  +   PL          I G    +LR  + +L S+      +++L WD      +   + +Y G + GLCG       D+  +        V  FGN++K    C +I    S   +  P     A + C+  +  KF  C   VN   Y   C  ++C+ +             + LC  +S Y+ +CS +G  I WR    CE  CPGN+++  C S C  TCR+    P + C++     C C  G  +     C+ P+ C C YDG+ + P  +     + C C +    C+    P++
Sbjct:  356 SQDCNTCVCRHGSWECTNEECPGQCVVSGQSHYKTFDDKFFTFSGFCQYLLAKDCQTNLFSAIIDTVQCADDQDAVCTRSVTLKFHELANQTVRLKHGGVV-SVDGLDVQMPL----------ING----LLRVQSTVLSSVRLNYGDDLQLDWD-GRGRVVLRLSPVYAGKMCGLCGNYNGNQGDDFLTAGGLVETRVEGFGNAWKMNAECDNIQKQPSDPCSLNPKRVRFAEEACALLLSPKFEPCHHEVNPYPYLKNCRYDVCSCADG----------QECLCAAVSNYAAACSARGVLINWRGQGYCELTCPGNQVYEVCGSVCNQTCRSR-SLPDSACRSMCEEGCFCPRGLYLTDTGECVPPDQCSCHYDGEIYQPNDMFADHHSICYCENGSMRCSSSELPAS 738          
BLAST of SCO-spondin vs. Ensembl Cavefish
Match: otog (otogelin [Source:ZFIN;Acc:ZDB-GENE-120228-1])

HSP 1 Score: 325.479 bits (833), Expect = 2.235e-89
Identity = 312/1192 (26.17%), Postives = 517/1192 (43.37%), Query Frame = 3
Query:  756 ENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYEN---CTSD----TGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGT--PMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXV-----ASFGNSF-----KGFGCPDIANTL-STCKPDDQ--ILANQQCSKIRLK--FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCI-QWRSDT-LCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKV---GRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMGTQ-FDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSK-SIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY-ITGSCDNTPQSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLS------------YCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPP-NYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMD--------SVS---GCN-SCTNYD---TCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIP--LFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHG-TMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCE 4142
            E   TC S+G   Y TFD   Y + G+CSY L    +   +  S+ I   N   CTS     T  V + +   G++ ++                  L+VT    ++ +P     + + +  +++L+S +     L W   N       +  + G   GLCGN + + ++D      V     A FGNS+     +   C  I     S C   D   +L  ++     LK  F  C + V+  +Y + C  ++C    N           DV+C   + Y+ +C+     + +WR+   +C  +CP    + +C   CPV CR         C +SK+     C C    +     C+K   CPC + G  +P G   Q +CN CTC+   W+CTE+ CP  C + G   F +FDG  + F    CQYV     +  + +     V IQ+   +  G   + A I    +V  +   +++ L  +      SQ  +          LP++  D    +++L++++ +VK S    L ++  +  +Y+++ +  +++ +GLCG F+GN ++DF      I  +      ++ ++ +C      +  P     D C T      ++  +   +V  +     C    S    QL              CSA+ + A  CR+  +  E  F S++ + C   C A    + +C  +CQ  C  L+ +    C D+C  GC CP   YY T T  CV  +EC C        P    G  I  +    +C +G++  ++    T+ +CP  Q+Y D        SVS    C+ +C +Y    TC+        C CP   +   D  C +P  CPC++  +EY P D ++  C   +C    +     E   C ++C AYGD HY+T DG +F + G+C   L+ +  D       ++++  NI C  S   C K + I +G    +         P  +  + +++I    +FT +      L VLWDR T +++   P +QG + GLCGN+D    NE      M      +F  S+ A   +   +I           +  C+ NP R+++A++ CG++   + VF  C   +  DV  +Y NCL D CGC+RGGDCEC C+S+A +A +C   G+ V WR+ +LCP  CE
Sbjct:  127 EREMTCRSWGQYNYETFDGLYYYFPGKCSYTLLKDCE-ENIQPSLLIQVHNDPECTSFPYSCTRSVSLFLPWEGEIRLQD-----------------LNVTFKGQSVKLPHNIHDLELEQIADYVLVS-QPQVFTLAWHGLNGSIYIKMSPEFVGRTCGLCGNFNADVNDDLKTSYGVFTEDLAMFGNSWVEEEPQKATCSMIPYLYPSPCSGQDSHVLLKVEEVCATLLKEPFKSCHEFVSPYSYMASCSNDLCLSGPNG----------DVVCQVFTEYARACAHADHPLNKWRTHVPVCGVECPAELQYRECIPCCPVHCRT-----EQMCIDSKLQCLDGCYCQDDLIYEDGLCVKASDCPCEHRGMLYPSGHTIQEECNNCTCSGGAWNCTEQKCPGECSVTGDMYFQSFDGRVYTFL-ATCQYV-----LAKSRNSGGFTVTIQN---APCGPNLDGACIQSVNVVLNEDPRTEVTLSHSGEVFMASQFRI---------SLPYS--DDVFQIQELSSLFVQVKTSQGLLLQYNWREFRLYLQLGELWRDDTVGLCGTFNGNIQDDFLAPSGMIESTPQLFGNAWRVSSAC------VPRPSLPQLDPCDTHQQAASYA--VEKCEVLMQEVFAVCHEHVSPVGFQLQCRADVCKCGTPCLCSALAHYARTCRKHNVIIE--FRSHVPE-CSVACPATME-YGLCVSSCQRRC--LSFSMPQSCGDECEEGCVCPQGTYYSTHTHSCVKRNECPCSFLGTDYSP----GDVIMTSSGVQICRDGQIVLQS--TITDKLCPPGQIYEDCGNMVDGPSVSKGLACDRTCESYLLNLTCSTHEPCVPGCVCPTGLLKHGD-ECFEPVACPCLWKGKEYYPGDKVSSTCHLCVCQQGTFQC---EFRPCPSMCTAYGDRHYRTFDGLLFDYVGACKVYLLKSSADVM-----VSVTTENIDCFESGVICRKALLISVGRSFIVFDDETGKPSPSSVIDRQNVLIWSAGYFTIVHLSQYELSVLWDRKTTIHIQAGPRWQGKLSGLCGNFDLKTVNEMRTPDNMDSATPQEFGNSWTAAECVNSPDI-----------RHPCSLNPLREAFAKKQCGIL--LSEVFQVCHPVV--DVTWFYMNCLADTCGCSRGGDCECFCSSVAAYAHRCCHQGVTVDWRSPSLCPYDCE 1220          

HSP 2 Score: 130.568 bits (327), Expect = 9.936e-30
Identity = 135/516 (26.16%), Postives = 215/516 (41.67%), Query Frame = 3
Query: 3033 CPKNQVYMDSVSGCN-SCTNYDTCTDTS-SIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSL-ATCAKFVQIII------------GGQTYLLSRGNNDTIPLFPKYDIV--IEQLTFFTQLVSDSIGLRVLWD-RSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQ-DMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQ-NLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMI--DLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCD-----DGKCIESSKICDK 4499
            CP    Y + +  C   C     C D+     + C C +D + + DG CV+ SDCPC +    Y     I  +C    CS   WN   ++   C   C   GD ++++ DG++++F  +C Y L       S N    T+++ N  CG +L   C + V +++             G+ ++ S+         P  D V  I++L+     V  S GL + ++ R  R+YL L   ++ +  GLCG ++G++Q++++  +   E   Q       NA    + +S      PS  Q D C+ +    S+A + C V+     VFA C E  H     +   C  D C C       CLC++LA +A  C    + +++R+    C + C     Y  C S C + C  +  + P  C    C EGC CP G         CV    CPC + G  Y  G +I M +     C   +       +D +  C P Q   D     DG  +     CD+
Sbjct:  403 CPAELQYRECIPCCPVHCRTEQMCIDSKLQCLDGCYCQDDLIYE-DGLCVKASDCPCEHRGMLYPSGHTIQEECNNCTCSGGAWNCTEQK---CPGECSVTGDMYFQSFDGRVYTFLATCQYVLAK-----SRNSGGFTVTIQNAPCGPNLDGACIQSVNVVLNEDPRTEVTLSHSGEVFMASQFRIS----LPYSDDVFQIQELSSLFVQVKTSQGLLLQYNWREFRLYLQLGELWRDDTVGLCGTFNGNIQDDFLAPSGMIESTPQL----FGNA----WRVSSACVPRPSLPQLDPCDTHQQAASYAVEKCEVLM--QEVFAVCHE--HVSPVGFQLQCRADVCKCGT----PCLCSALAHYARTCRKHNVIIEFRSHVPECSVACPATMEYGLCVSSCQRRC--LSFSMPQSCGD-ECEEGCVCPQGTYYSTHTHSCVKRNECPCSFLGTDYSPGDVI-MTSSGVQICRDGQIVLQSTITDKL--CPPGQIYEDCGNMVDGPSVSKGLACDR 883          

HSP 3 Score: 103.219 bits (256), Expect = 2.004e-21
Identity = 109/387 (28.17%), Postives = 167/387 (43.15%), Query Frame = 3
Query: 3309 EAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNI-PPITISVAN-IACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIP----LFPK--YDIVIEQLTFFTQLVSDSIGLRVLWD-RSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKY-EDAIQFAESFI------ANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPV-KWRTQ-NLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHC--STTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTE 4409
            E  C ++G  +Y+T DG  + F G C YTL+    D   NI P + I V N   C     +C + V + +  +  +  +  N T        P   +D+ +EQ+  +  LVS      + W   +  +Y+ + P F G   GLCGN++ D+ ++       + ED   F  S++      A   + PY + P    +P   QD   ++   K   E++C  +      F SC E +      Y ++C  D C     GD   +C     +A  CA    P+ KWRT   +C + C     Y  C   CP  C T        C  S   C++GC C + +I  +G CV  + CPC + G  Y +G  I+ E C  C C    +NCTE
Sbjct:  129 EMTCRSWGQYNYETFDGLYYYFPGKCSYTLLK---DCEENIQPSLLIQVHNDPECTSFPYSCTRSVSLFLPWEGEIRLQDLNVTFKGQSVKLPHNIHDLELEQIADYV-LVSQPQVFTLAWHGLNGSIYIKMSPEFVGRTCGLCGNFNADVNDDLKTSYGVFTEDLAMFGNSWVEEEPQKATCSMIPY-LYP----SPCSGQD---SHVLLK--VEEVCATL--LKEPFKSCHEFV--SPYSYMASCSNDLCLSGPNGDV--VCQVFTEYARACAHADHPLNKWRTHVPVCGVECPAELQYRECIPCCPVHCRT-----EQMCIDSKLQCLDGCYCQDDLIYEDGLCVKASDCPCEHRGMLYPSGHTIQ-EECNNCTCSGGAWNCTE 489          

HSP 4 Score: 55.4546 bits (132), Expect = 7.736e-7
Identity = 44/146 (30.14%), Postives = 62/146 (42.47%), Query Frame = 3
Query: 4134 MCEGGKHYDACAS-----------PCPQTCDTIGSNAPSHCSTTH-CVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTP---SQFRCDDGKCIESSKICDKVTDCSNSED 4526
            +C  G+ Y+ C +            C +TC++   N    CST   CV GC CP G++    EC  P  CPC + G+ Y  G  +    C  C C Q  F C  ++  C + CT      +R  DG   +    C KV    +S D
Sbjct:  856 LCPPGQIYEDCGNMVDGPSVSKGLACDRTCESYLLNL--TCSTHEPCVPGCVCPTGLLKHGDECFEPVACPCLWKGKEYYPGDKVS-STCHLCVCQQGTFQC--EFRPCPSMCTAYGDRHYRTFDGLLFDYVGAC-KVYLLKSSAD 995          
BLAST of SCO-spondin vs. Ensembl Cavefish
Match: ENSAMXT00000041370.1 (pep primary_assembly:Astyanax_mexicanus-2.0:5:1809499:1822580:1 gene:ENSAMXG00000037407.1 transcript:ENSAMXT00000041370.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 318.546 bits (815), Expect = 1.785e-87
Identity = 328/1262 (25.99%), Postives = 532/1262 (42.16%), Query Frame = 3
Query:  750 NNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVV-VKSS--GNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCG----XXXXXXXXXXXXXXXVASFGNSFKGFG----CPDIANTLSTCKPDDQILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGS-CIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYT---CIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKL-----PFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSK--SIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYIT-GSCDNTPQSIVDP--PAGDND-----ICSTILNGPE-FSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDD--CFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNC---KTKDNCTNPVCPKN---QVYMDSVSGC-NSCTNYD-TCTD-----TSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSI-GLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMC-------EGGKHYDACASPCPQTCDTIGSNAPSHCST-THCVEGC--SCPNGMIDLNGE---CVPPTTCPCFYNGQSYVNGAII 4352
            +  N   C ++G  +++T+D  ++     C++ILT+    S   ++I +  +    +    K+ +   G VV VK+   G+G+   T S+  +   +V  T            +  +D+ +++ L A  I                        GLCG        N         +   +GN +K  G    C +    ++    D+    N   SK    F  C DLV+ + +  +C++++C  + ++         S  LC  L+ YS  C   G     WR++  C  +CP +K++ +C S C  TC N  +     C    +  C C S  V    T   CI   +C C++ G+ +  G      C  CTC+   W+C +K CP TC + G     TFDG  + F+   C YV +      TD     F I+                     +V   +  S+  LKA +  L +  TNV +  E +   L       T  + +I + K ++ Y  ++ +   +L    +    +YI      +  + GLCG F+    +DFT        + V+ A ++ T  SC +  ++  +P   + +N+      CS + +    FS C   S+++   Y        +  K +   C+A+ +   AC   GI   +    ++      L      V+     +C  +CR L++   S C        GC C    Y     +CV  S C C++ +    P    G  ++    TC C  G+LNC        CT+P+   N    V   + S C  SC   D  C       T    + C CP+  VS  +G C+    CPC++    Y P + +   C    C +R W   + +   C A C  YGD HY T D + + F G+C YTL      SSN      +   NI CG +  TC+K +++ IG    +LS G+   +      +I  +  T    LV ++  G+ ++WDR T +Y+ L P F G V GLCGN+DG+  N++   T + ++ +  A  F  +    P    PE  V     Q+ C  NP R++WA++ C ++   + VF++C   +  D   +YS C+ DAC C+ GGDCEC CT++A +A  C  +G+ V WRT  +CP+ C       E   HY  C +PC +TC     N    CS     +EGC   CP G+   + +   CV    C C+   + Y NG  +
Sbjct:   22 SEHNGQVCSTWGNYHFKTYDGDVFQLPSTCNHILTSQCRGSYEAFNIQLRRQVENGEPTISKITMKLDGTVVDVKAPHLGSGVFIETISSYIMVKATVGLTA-----------MWNEDDALMIELNAKFIN--------------------QTCGLCGDFNGVPTYNEFIKDGAQLSATDYGNLWKMDGPTETCEEQPERVNENCGDENFCQNLFLSK---AFSSCTDLVSVEPFTKVCIEDLCQCNSSAG--------SSCLCDTLAEYSRQCVHAGGQPANWRTEHFCPMKCPESKVYMECGSPCMDTCSNPER--GQVCGEHCIDGCFCPSDTVFDDVTNTGCIPLSNCSCIHGGKAYASGEGYSSSCRECTCSGGQWNCVDKQCPGTCSVEGGAHIITFDGKPYTFHG-DCSYV-LSKECTGTD-----FTILG-------------------DLVKCGITDSETCLKAVTLALSNG-TNVSLSCELNINLLFKKIFRLTQTESDISIFKPSSFYIVIQTTIGLRLEIQLTPIMQVYITADPKFQGQMCGLCGNFNNIQADDFTTMGGLTEGTAVDFANTWKTRASCLDVQRTFENPCSLSTENEKYAQYWCSLLSDASGVFSSCH--SEINPATYKNCIYDTCNCEKTEDCMCAALSSYVHACAAKGIY--IKGWRDVACKSYTLSCPNTMVYSYNMTSCGRSCRSLSQTDFS-CSSQFVAVDGCGCAEGTYLNEKEECVDPSGCPCYDSNTVIQP----GETVSREGTTCTCKQGQLNCIGSGKVQECTSPMTYLNCSAAVPGSTGSECAKSCKTLDMACVSYHIKYTRGCVSGCVCPSGLVSDDNGGCITEDLCPCVHNGASYKPGETVKEDCNTCTCKDRRWQCTTNQ---CSATCSIYGDGHYITFDDKRYVFNGNCEYTLAQDFCSSSNTNGTFRVITENIPCGTTGTTCSKAIKLFIGSNELVLSDGSYQVVQRDAGQEIPYQIRTMGNYLVIETNNGVVLIWDRKTSMYIKLTPDFNGRVCGLCGNFDGNANNDF---TTRSQELVVNALDFGNSWKFSP--TCPEAMVV----QEPCAHNPYREAWAQRQCSIIN--SDVFSACHSKV--DPASFYSACVRDACACDTGGDCECFCTAVAAYAEACNAVGVCVAWRTPKVCPLFCDYYNPPGECEWHYKPCGAPCMKTC----RNPAGTCSLQLPAMEGCYPECPAGLPFFDEDTMKCVALEECGCYVGMEHYANGQTV 1183          

HSP 2 Score: 150.984 bits (380), Expect = 6.429e-36
Identity = 138/492 (28.05%), Postives = 220/492 (44.72%), Query Frame = 3
Query: 3033 CPKNQVYMDSVSGCNSCTNYDTCTDTSS-------IANSCGCPNDTV--SKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMD--TPGDSSNNIPPITISVANIACGFSLA-TCAKFVQIIIGGQTYLLSRGNNDTIP-------LFPKY--------DIVIEQLTFFTQLVSDSIGLRVLWDRS--TRVYLFLKPSFQGNVQGLCGNYDGDLQNEYM-HGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVN-RYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVK-WRTQ--NLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGM-IDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNC 4403
            CP+++VYM+  S C      DTC++            + C CP+DTV     +  C+  S+C CI+  + YA  +  +  C +  CS   WN + ++   C   C   G  H  T DG+ ++F G C Y L    T  D        TI    + CG + + TC K V       T  LS G N ++        LF K         DI I + + F  ++  +IGLR+    +   +VY+   P FQG + GLCGN++    +++   G +    A+ FA ++   A     + + EN          C+ + + + +A+  C ++ D +GVF+SC    H ++N   Y NC+YD C C +  DC  +C +L+++   CA  GI +K WR        + C     Y    + C ++C ++     S  S    V+GC C  G  ++   ECV P+ CPC+ +      G  +  E    C C Q + NC
Sbjct:  273 CPESKVYMECGSPC-----MDTCSNPERGQVCGEHCIDGCFCPSDTVFDDVTNTGCIPLSNCSCIHGGKAYASGEGYSSSCRECTCSGGQWNCVDKQ---CPGTCSVEGGAHIITFDGKPYTFHGDCSYVLSKECTGTD-------FTILGDLVKCGITDSETCLKAV-------TLALSNGTNVSLSCELNINLLFKKIFRLTQTESDISIFKPSSFYIVIQTTIGLRLEIQLTPIMQVYITADPKFQGQMCGLCGNFNNIQADDFTTMGGLTEGTAVDFANTWKTRASCLDVQRTFENP---------CSLSTENEKYAQYWCSLLSDASGVFSSC----HSEINPATYKNCIYDTCNCEKTEDC--MCAALSSYVHACAAKGIYIKGWRDVACKSYTLSCPNTMVYSYNMTSCGRSCRSLSQTDFSCSSQFVAVDGCGCAEGTYLNEKEECVDPSGCPCYDSNTVIQPGETVSREG-TTCTCKQGQLNC 726          

HSP 3 Score: 109.383 bits (272), Expect = 2.831e-23
Identity = 95/378 (25.13%), Postives = 157/378 (41.53%), Query Frame = 3
Query: 3315 VCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDG-DLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTN--------GVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFL-GIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMI---DLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTE 4409
            VC  +G+ H+KT DG +F    +C + L      S              A    L    +  +  I   T  L     D         + IE ++ +  +V  ++GL  +W+    + + L   F     GLCG+++G    NE++      +D  Q + +   N     +++       P+   + C   P+R     + CG   D N          F+SC + +   V  +   C+ D C CN      CLC +LA ++ QC    G P  WRT++ CP+ C   K Y  C SPC  TC    +         HC++GC CP+  +     N  C+P + C C + G++Y +G      +C++C C   ++NC +
Sbjct:   28 VCSTWGNYHFKTYDGDVFQLPSTCNHILTSQCRGSYE------------AFNIQLRRQVENGEPTISKITMKLDGTVVDVKAPHLGSGVFIETISSYI-MVKATVGLTAMWNEDDALMIELNAKFINQTCGLCGDFNGVPTYNEFI------KDGAQLSATDYGNL----WKMD-----GPT---ETCEEQPER---VNENCG---DENFCQNLFLSKAFSSCTDLV--SVEPFTKVCIEDLCQCNSSAGSSCLCDTLAEYSRQCVHAGGQPANWRTEHFCPMKCPESKVYMECGSPCMDTCS---NPERGQVCGEHCIDGCFCPSDTVFDDVTNTGCIPLSNCSCIHGGKAYASGEGYS-SSCRECTCSGGQWNCVD 362          

HSP 4 Score: 65.4698 bits (158), Expect = 6.144e-10
Identity = 95/408 (23.28%), Postives = 159/408 (38.97%), Query Frame = 3
Query:  699 SGSCVSCKANFAGGNDVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSN-----NPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCG-----XXXXXXXXXXXXXXXVASFGNSFKGFG-CPDIANTLS---TCKPDDQILANQQCSKIRLK---FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCET---QCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEY---GYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHC 1853
            S SC  C  +    N V+ +   TC   G  +  TFD + YT+ G CSY+L+     +  T   ++V    T    C+K + +        S+G  +  + + N       +  L+ T +D ++  P +   V++    + L ++   I   +           +  + G + GLCG      AD+  +           F N++K    C D+  T     +   +++  A   CS +      F  C   +N  TY   C+ + C          +     D +C  LS+Y  +C+ KG  I+   D  C++    CP   ++S   + C  +CR+L QT  + C +  V    CG  E  Y      C+ P  CPC        PG     +  TCTC     +C
Sbjct:  345 SSSCRECTCSGGQWNCVDKQCPGTCSVEGGAHIITFDGKPYTFHGDCSYVLSKECTGTDFTILGDLVKCGITDSETCLKAVTL------ALSNGTNVSLSCELNINLLFKKIFRLTQTESDISIFKPSSFYIVIQTTIGLRLEIQLTPIMQVY--------ITADPKFQGQMCGLCGNFNNIQADDFTTMGGLTEGTAVDFANTWKTRASCLDVQRTFENPCSLSTENEKYAQYWCSLLSDASGVFSSCHSEINPATY-KNCIYDTC----------NCEKTEDCMCAALSSYVHACAAKGIYIKGWRDVACKSYTLSCPNTMVYSYNMTSCGRSCRSLSQTDFS-CSSQFVAVDGCGCAEGTYLNEKEECVDPSGCPCYDSNTVIQPGETVSREGTTCTCKQGQLNC 726          

HSP 5 Score: 53.9138 bits (128), Expect = 2.128e-6
Identity = 30/72 (41.67%), Postives = 41/72 (56.94%), Query Frame = 3
Query: 4227 TTHCVEGCSCPNGMI-DLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCT 4439
            T  CV GC CP+G++ D NG C+    CPC +NG SY  G  +K E+C  C C   ++ CT +   C  TC+
Sbjct:  775 TRGCVSGCVCPSGLVSDDNGGCITEDLCPCVHNGASYKPGETVK-EDCNTCTCKDRRWQCTTN--QCSATCS 843          
BLAST of SCO-spondin vs. Ensembl Cavefish
Match: ENSAMXT00000019204.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001825.1:10421:34530:-1 gene:ENSAMXG00000018303.2 transcript:ENSAMXT00000019204.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 311.612 bits (797), Expect = 7.618e-86
Identity = 304/1192 (25.50%), Postives = 485/1192 (40.69%), Query Frame = 3
Query:  768 TCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAG-NIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVASFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIR--LKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCI-QWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYT---CIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIM-GTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTK----LPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFD--GSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGS-CDNTPQSIVDPPAGDND-------ICSTILN--GPEFSGCMNSSKVDKEFYATYCRREQSS-NKDQLSYCSAILNAAIACRRFGI---QYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFP--GCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMD-SVSG--------CNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPL----FPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYM-HGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGK-------HYDACASPCPQTC 4190
             C  +G  +++TFD  +Y +QG C Y L +    S   +S+++     T D+   +V+V   GD+ +K + N ++                 D  + +P     VL +     + L A   + + W+ ++ + + +          GLCG                      F G     +   +S  +  D       CS++     +  C  +V+ + Y   CV + C  S+  +    +P     LCT LS YS  CS  G     WR    C  +CP N  +S+  S C  TC +     S  C+  K+  C C  G V    +   CI  E C C ++ + +  G V   +   C C+   W C     P  C +  G+ F TFDG +F F+   C Y+                 + Q   ES     G        +++    + +D  LK+      + + N  +  +D T K    L       NI V + ++ +  V+ S   ++         +YI +  + +    GLCG F+    ++       +  +  + A S+   S C +  +S+ DP + + D        CS +L   GP F+ C +S  V+ E Y   C+    +  K +   C    +   AC   GI    +         + C P  Q      Q C RTC S   E        C +   P  GC CP   Y+   G CV+  +C+C++        I  G +ITI  + CVC NG+L+C +        CP  +V+ + S +G          +C         +   + C CP+  +    G CV   +CPC +    Y P   IT +C    C    W    E+   C   C  YG  HY T D + F F G C Y  +       N      +   N+ CG +  TC+K V+I++G     L  G      L      KY +    +  +  + +D IGL VLWDR T V + L+P   G V GLCGN++G+ ++++   G ++  D ++FA S+  N+  CP  +          + D C+   +R +WA+  C ++  T   F  C   +  D   Y+ NC+ D+C C+ GGDCEC CT++A +A  C   G+ V WRT  +CP+ CE          HY  C +PC +TC
Sbjct:    3 VCSMWGNFHFKTFDGDVYQFQGICEYNLVSHCHGSVQDFSVHVKRSEFTGDSKINRVLVT-IGDMAIKLTKNLVMVN---------------DDVVKLPHYVAGVLLEQYATYIKLYAKLGLSVMWNKDDAVMVELEAKYT-NQTCGLCG---------------------DFNGMAI--LNEFISEAQACDYSSQRPGCSELLEDKAWKSCTSIVSPEPYIQACVVDRCW-SRPGDIEDSLP-----LCTTLSEYSRQCSHAGGTPPNWRKPDFCAVKCPYNMEYSESGSPCVDTCSH--TDTSLLCEEHKMDGCYCPPGTVFDDISDRGCIPQEQCQCKHN-KVYNSGDVLHMEDKECVCHHGSWTCESLPTPGLCAVEEGSHFTTFDGKEFTFHG-ECYYI-----------------LSQDCEESKFTVLG--------QLIPCVDHETDTCLKSVVLLPNNDKNNALVIKDDGTVKQNGDLTLPYASANIIVFRPSSFHIIVQTSFGLRMQVQLVPVMQLYITLDRSYQTKTCGLCGNFNMVLSDELKTPQGLVEGTASSFANSWKAQSNCRDRSESLDDPCSYNIDSESYAEHWCSKLLEKEGP-FAKCHSS--VNPESYYKRCKYSTCTCEKTENCLCGVFSSYVRACTAKGIFLQGWRDTVCKKYTEHC-PATQTFSYKLQGCQRTCDSLSLE-----RPACINTYLPVDGCACPDGLYENENGVCVALDKCSCYHNGE----RIKPGKSITIKNEHCVCTNGKLHCHSWKPSVMD-CPAPKVFFNCSEAGPEEHGLECAKTCAQKTVDCFLTGCTSGCQCPSGLLDDGRGHCVPQHNCPCKHNGHYYPPGSQITDQCNTCTCKQGKWKCTEEK---CPGTCTIYGSGHYNTFDNRRFGFSGDCGY--IAAQNKCGNKTGTFHVITENVPCGTTGTTCSKSVRIVLGKTQLDLIDGKVTNTDLESGTLIKYRV--RNVGLYLAIEAD-IGLTVLWDRKTTVRIILQPQHMGEVCGLCGNFNGNGKDDFTTQGQLQVSDVLEFANSWKVNSH-CPDAVP---------DFDPCSKAHNRHTWAKMQCSII--TGKTFKECHSMV--DPAPYFDNCVRDSCACDTGGDCECFCTAVAAYAQACNEAGVCVAWRTPEICPVFCEFYNDPLECLWHYSPCHTPCYKTC 1083          

HSP 2 Score: 137.502 bits (345), Expect = 7.164e-32
Identity = 148/532 (27.82%), Postives = 228/532 (42.86%), Query Frame = 3
Query: 2901 CWNPSRPKDPE--IPAGTNITINCQTCVCINGRL-NCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTC--TDTSSI-----ANSCGCPNDTVSK--IDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIAC-GFSLATCAKFVQII---------IGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLR--VLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYED-AIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVN--RYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIM---CEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMID-LNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNC 4403
            CW  SRP D E  +P  T ++   + C    G   N +  D C    CP N  Y +S S C      DTC  TDTS +      + C CP  TV     D  C+    C C + N+ Y   DV+ ++  + +C +  W   S  T     +C      H+ T DG+ F+F G C Y L     +S       T+    I C      TC K V ++         +      + +  + T+P +   +I++ + + F  +V  S GLR  V      ++Y+ L  S+Q    GLCGN++  L +E        E  A  FA S+ A ++      S +         D C+ N D +S+AE  C  + +  G FA C    H  VN   YY  C Y  C C +  +C  LC   +++   C   GI ++     +C      C   + +      C +TCD++    P+  +T   V+GC+CP+G+ +  NG CV    C C++NG+    G  I ++N + C C   K +C
Sbjct:  192 CW--SRPGDIEDSLPLCTTLSEYSRQCSHAGGTPPNWRKPDFCAVK-CPYNMEYSESGSPC-----VDTCSHTDTSLLCEEHKMDGCYCPPGTVFDDISDRGCIPQEQCQCKH-NKVYNSGDVLHMEDKECVCHHGSWTCESLPTP---GLCAVEEGSHFTTFDGKEFTFHGECYYILSQDCEESK-----FTVLGQLIPCVDHETDTCLKSVVLLPNNDKNNALVIKDDGTVKQNGDLTLP-YASANIIVFRPSSFHIIVQTSFGLRMQVQLVPVMQLYITLDRSYQTKTCGLCGNFNMVLSDELKTPQGLVEGTASSFANSWKAQSNCRDRSESLD---------DPCSYNIDSESYAEHWCSKLLEKEGPFAKC----HSSVNPESYYKRCKYSTCTCEKTENC--LCGVFSSYVRACTAKGIFLQGWRDTVCKKYTEHCPATQTFSYKLQGCQRTCDSLSLERPACINTYLPVDGCACPDGLYENENGVCVALDKCSCYHNGERIKPGKSITIKN-EHCVCTNGKLHC 689          

HSP 3 Score: 109.768 bits (273), Expect = 1.711e-23
Identity = 100/380 (26.32%), Postives = 162/380 (42.63%), Query Frame = 3
Query: 3315 VCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRG---NNDTIPLFPKY--DIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCE---CLCTSLATFATQCAFL-GIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTT-----HCVEGCSCPNGMI--DLNGE-CVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNC 4403
            VC  +G+ H+KT DG ++ FQG C Y L+     S  +      SV      F+  +    V + IG     L++     ND +   P Y   +++EQ   + +L +  +GL V+W++   V + L+  +     GLCG+++G                +     FI+ A  C Y          S ++  C+   + K+W                SC   +  +   Y   C+ D C  +R GD E    LCT+L+ ++ QC+   G P  WR  + C + C     Y    SPC  TC        SH  T+     H ++GC CP G +  D++   C+P   C C +N + Y +G ++ ME+ K+C C    + C
Sbjct:    3 VCSMWGNFHFKTFDGDVYQFQGICEYNLVSHCHGSVQD-----FSVHVKRSEFTGDSKINRVLVTIGDMAIKLTKNLVMVNDDVVKLPHYVAGVLLEQYATYIKLYA-KLGLSVMWNKDDAVMVELEAKYTNQTCGLCGDFNG----------------MAILNEFISEAQACDY----------SSQRPGCSELLEDKAW---------------KSCTSIVSPE--PYIQACVVDRCW-SRPGDIEDSLPLCTTLSEYSRQCSHAGGTPPNWRKPDFCAVKCPYNMEYSESGSPCVDTC--------SHTDTSLLCEEHKMDGCYCPPGTVFDDISDRGCIPQEQCQCKHN-KVYNSGDVLHMED-KECVCHHGSWTC 322          

HSP 4 Score: 80.8777 bits (198), Expect = 1.074e-14
Identity = 91/326 (27.91%), Postives = 136/326 (41.72%), Query Frame = 3
Query:  768 TCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENC---TSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAG-NIKLKWDXXXXXXXXXXXXXXXGDVTGLCGX-----XXXXXXXXXXXXXXVASFGNSFK-GFGCPDIANTLSTCKP--DDQILANQQCSKIRLK-FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQC-----PGNKIW--SDCASECPVTCRNLFQTPSAYCQN 1685
            TC  YG  +Y TFDN+ + + G C YI  A +     T + +++ EN    T+ T C K + I  G   +                L    VTNTD   +  GT +    ++  + L++EA   + + WD        I    + G+V GLCGN      D+  +       +V  F NS+K    CPD       C    +    A  QCS I  K F  C  +V+   YF  CV++ C          D     +  CT ++AY+ +C++ G C+ WR+  +C   C     P   +W  S C + C  TC N    P   C+N
Sbjct:  799 TCTIYGSGHYNTFDNRRFGFSGDCGYI-AAQNKCGNKTGTFHVITENVPCGTTGTTCSKSVRIVLGKTQLD---------------LIDGKVTNTD---LESGTLIKYRVRNVGLYLAIEADIGLTVLWD-RKTTVRIILQPQHMGEVCGLCGNFNGNGKDDFTTQGQLQVSDVLEFANSWKVNSHCPDAVPDFDPCSKAHNRHTWAKMQCSIITGKTFKECHSMVDPAPYFDNCVRDSC--------ACDTGGDCECFCTAVAAYAQACNEAGVCVAWRTPEICPVFCEFYNDPLECLWHYSPCHTPCYKTCLN----PDGICRN 1092          

HSP 5 Score: 57.7658 bits (138), Expect = 1.140e-7
Identity = 33/74 (44.59%), Postives = 41/74 (55.41%), Query Frame = 3
Query: 4221 CSTTHCVEGCSCPNGMID-LNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCT 4439
            C  T C  GC CP+G++D   G CVP   CPC +NG  Y  G+ I  + C  C C Q K+ CTE+   C  TCT
Sbjct:  731 CFLTGCTSGCQCPSGLLDDGRGHCVPQHNCPCKHNGHYYPPGSQI-TDQCNTCTCKQGKWKCTEE--KCPGTCT 801          
BLAST of SCO-spondin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010519.1 (pep scaffold:Pmarinus_7.0:GL477612:23664:47127:1 gene:ENSPMAG00000009527.1 transcript:ENSPMAT00000010519.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 305.064 bits (780), Expect = 1.908e-85
Identity = 285/1020 (27.94%), Postives = 436/1020 (42.75%), Query Frame = 3
Query: 1506 CTHLSAYSDSCSDKG-SCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEY------GYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSA---------YINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIY--TEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKD--NSIRESIVNIAKSYITGSCDNTPQSIVDPPA---GDNDI----CSTILN--GPEFSGCMNSSKVDKEFYATYCRREQSS-NKDQLSYCSAILNAAIACRRFGIQYEVPFTSNI----LQACIPLCQAGGTVFQICS----RTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMD----SVSGCNSCTNYDTCTDTSSI------ANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTL-MDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPL-FPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYE-DAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMC------EGG--KHYDACASPCPQTCDTIGSNAPSHCST-THCVEGC--SCPNGMIDLNGECVP-PTTCPCFYNGQSY-VNGAIIKMENCK 4370
            C  ++ +S  C+    S   WRS   C   CP  ++  +C S C  TC N   + S  C ++ V  C C  G          G  CI   +C C   GQ +  G      C  CTC    W+C  + C  TC I+G + F TFD   + F+   C Y         TD   N F ++   T+     EG  +         YI+  + V  K +G  ++                     H  K+P      ++ + + ++ Y   E       ++       +YI  + A  N   GLCG F+  + +DFT     ++   +  N+ K+  T  C +  +  +DP +    +N+     C  +++  GP FS C +    D+  Y T C+ +  S +  +   C+A+   A AC   G+   V + S+I     + C P+          C     RT +  CR +              GC C    Y    G CV +S+C C+  S      I AG  + ++   C+C  G L+C      +   C     Y +    S  G  +C    TC +  SI       + C CP   +   +G CV    C C +  R Y P D IT  C K  C N  W+  SE    C+ +C  YG+ H+ T DG+ + F GSC Y L  D+ G+SS +     I+  N  CG +  TC+K V    G    +L+ G      L FP     + ++  +T +V  S+G+ ++WD  T V + + P  +G V GLCG+YDG + N+++  T      A +FA  +  +   CP           S+  D C  N  R+SWA + C V+KD  GVF  C   +  +   YY+ C+ D+CGC+ GGDC CLCT+LA++A  C   G+ ++WRT +LCP+ C      EG    HY  C   C ++C    +N  + C+     +EGC  +CP+    LN   +     C C  NG +Y VN  I   + C+
Sbjct:  213 CATIAEFSRRCTQANESPGTWRSPEFCGVTCPRGQVHRECGSVCKDTCSN--PSASVNCPSTCVDGCFCPEGTAGTVWDDVSGSGCIPQSNCGCNQLGQSYASGESLITGCKNCTCEQGQWNCDSRPCYGTCKILGGSYFSTFDSKTYRFHG-DCFYTLT------TDCAGNKFSVLGELTK----CEGRDSKTCLNSVIFYIDGIRTVVFKASGDVLV---------------------HENKVPLPFVSASVTIVQESSFYLRAETNFGLRLRVQLKPLMQLYITAATAYHNKTCGLCGNFNEVTGDDFTHSGIVDATAATFCNVWKAQAT--CPDREEVTMDPCSVYITNNEYAKAHCGLLMDNDGP-FSTCHSVVSADE--YYTRCKYDTCSCSYPEPCLCAALSAYAYACSAHGVVL-VGWRSDICSLDAENC-PVSHEFSYAAPECGSASCRTSREVCRGVRPPPFELPSPSPVEGCVCGAGLYDDEHGVCVLKSDCPCY--SEMSGDLIRAGVTVDLHDTQCLCTGGELHCFGLSPISGNTCEGLMTYHNCSDGSSEGSAACQR--TCANPHSICYSPGCVSGCVCPGGLIVDHNGNCVSEEQCTCEHNGRHYDPGDTITQLCNKCTCMNARWSCTSEV---CQGLCFVYGEGHHTTFDGKQYVFDGSCQYILSQDSCGNSSGSF---RITTENEPCGTTGTTCSKKVHFYAGADELVLTDGTVKGSSLDFPGSPFHVRRMGIYT-VVETSLGVTIIWDGHTAVSVHVNPQLKGRVCGLCGDYDGKVANDFVTRTGSVAASAPEFAAGWKESGSGCP---------DLSRVSDPCTINHHRESWAHKQCSVLKD--GVFKQCHNMV--EYLPYYAACVRDSCGCDTGGDCHCLCTALASYAQACGSAGVCLRWRTPDLCPLGCDLYNKDEGQCEWHYRECGRGCQRSC----TNRNAICTANLPPLEGCYPTCPSDRPFLNESSMTCVERCDCVSNGTTYKVNDRIPSNDPCE 1163          

HSP 2 Score: 86.2705 bits (212), Expect = 5.535e-17
Identity = 98/397 (24.69%), Postives = 163/397 (41.06%), Query Frame = 3
Query: 3315 VCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDS-SNNIPPITISVANIACGFSLATCAKF----VQIIIGGQTYLLSR------GNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLY-DACGCNRGGDCECL----CTSLATFATQCAFLG-IPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMI-----DLNGE-CVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTC 4436
            +C  +G  H  T D           +  MD P  S + N+  IT S  +++  F  +   +     V + + G +  L+R      G    +P +  + I IE +  + +  S  +G  +LWD++  + + L P F     GLCG+++G   + Y++  +    ++ F  SF+   D       P  ++    E ++                          SC+  M   +     N L+ D C  +  G         C ++A F+ +C      P  WR+   C + C  G+ +  C S C  TC     +A  +C +T CV+GC CP G       D++G  C+P + C C   GQSY +G  + +  CK C C Q ++NC  D   C  TC
Sbjct:    1 ICSVWGTSHLLTFD-----------HASMDLPLSSCALNLVSITDS-PSLSLSFQRSALDRMSVENVVVTMEGISLSLTREGQSISGQRVQLP-YKDHSIQIEMVGSYIK-CSSIMGFSLLWDQNNAITVKLDPKFNTKTTGLCGDFNGIADDFYLN--VMSTTSVLF--SFLLTCD------EPTQHIEHLFEDEL-------------------------LSCVSVMDHQLKSLLVNILWSDICRLDCNGTAGLYPCDGCATIAEFSRRCTQANESPGTWRSPEFCGVTCPRGQVHRECGSVCKDTCSN--PSASVNCPST-CVDGCFCPEGTAGTVWDDVSGSGCIPQSNCGCNQLGQSYASGESL-ITGCKNCTCEQGQWNC--DSRPCYGTC 342          

HSP 3 Score: 81.6481 bits (200), Expect = 1.183e-15
Identity = 78/288 (27.08%), Postives = 130/288 (45.14%), Query Frame = 3
Query:  771 CHSYGLDYYRTFDNQLYTYQGRCSYILTAPS-DVSAVTWSINIVYENC-TSDTGCVKVIVIEAG-DVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCG-----XXXXXXXXXXXXXXXVASFGNSFK--GFGCPDIANTLSTCKPDD--QILANQQCSKIRLK-FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQC 1595
            C  YG  ++ TFD + Y + G C YIL+  S   S+ ++ I    E C T+ T C K +   AG D +V + G                  T   S+L  PG+P +V R   + ++    G + + WD +  + + ++  +  G V GLCG      A++  +   S   +   F   +K  G GCPD++     C  +   +  A++QCS ++   F  C ++V    Y++ CV++ C          D       LCT L++Y+ +C   G C++WR+  LC   C
Sbjct:  818 CFVYGEGHHTTFDGKQYVFDGSCQYILSQDSCGNSSGSFRITTENEPCGTTGTTCSKKVHFYAGADELVLTDG------------------TVKGSSLDFPGSPFHVRRMGIYTVVETSLG-VTIIWDGHTAVSVHVNPQLK-GRVCGLCGDYDGKVANDFVTRTGSVAASAPEFAAGWKESGSGCPDLSRVSDPCTINHHRESWAHKQCSVLKDGVFKQCHNMVEYLPYYAACVRDSCG--------CDTGGDCHCLCTALASYAQACGSAGVCLRWRTPDLCPLGC 1077          

HSP 4 Score: 68.5514 bits (166), Expect = 1.284e-11
Identity = 115/437 (26.32%), Postives = 171/437 (39.13%), Query Frame = 3
Query:  762 FTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCT---SDTGCVKVIVIEAG--DVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXV----ASFGNSFKGFG-CPDIANTLSTCKPDDQILANQQCSKIRL--------KFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSC-IQWRSD--TLCETQCPGNKIWSDCASECPV--------TCRNLFQTPSAYCQNSKVGRCICGSG--EVEYGYTCIKPESCPCLYD--GQEHPPGTVRQFDCNTCTCNSSLWHC--TEKICPSTCGIMGTQFDTFDGAKFAFNDVGCQYVAVEP 1967
            + TC   G  Y+ TFD++ Y + G C Y LT  +D +   +S+      C    S T    VI    G   VV K+SG+ +++      P    SVT      I+  +  Y+  + NF L       ++LK             + Y+    GLCGN +    +DF++   V    A+F N +K    CPD      T  P    + N + +K            F  C  +V++D Y++ C  + C+ S               LC  LSAY+ +CS  G   + WRSD  +L    CP +  +S  A EC           CR +   P      S V  C+CG+G  + E+G  C+    CPC  +  G     G         C C     HC     I  +TC  + T  +  DG+  +     CQ     P
Sbjct:  339 YGTCKILGGSYFSTFDSKTYRFHGDCFYTLT--TDCAGNKFSVLGELTKCEGRDSKTCLNSVIFYIDGIRTVVFKASGDVLVHENKVPLPFVSASVT------IVQESSFYLRAETNFGLRL----RVQLK---PLMQLYITAATAYHNKTCGLCGNFNEVTGDDFTHSGIVDATAATFCNVWKAQATCPDREEV--TMDPCSVYITNNEYAKAHCGLLMDNDGPFSTCHSVVSADEYYTRCKYDTCSCSYP----------EPCLCAALSAYAYACSAHGVVLVGWRSDICSLDAENCPVSHEFSYAAPECGSASCRTSREVCRGVRPPPFELPSPSPVEGCVCGAGLYDDEHG-VCVLKSDCPCYSEMSGDLIRAGVTVDLHDTQCLCTGGELHCFGLSPISGNTCEGLMTYHNCSDGS--SEGSAACQRTCANP 745          

HSP 5 Score: 55.8398 bits (133), Expect = 9.789e-8
Identity = 41/109 (37.61%), Postives = 55/109 (50.46%), Query Frame = 3
Query: 4119 NLCPI---MCEGGKHYDACA-------SPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMI-DLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTED 4412
             L PI    CEG   Y  C+       + C +TC    +N  S C +  CV GC CP G+I D NG CV    C C +NG+ Y  G  I  + C KC C+ A+++CT +
Sbjct:  709 GLSPISGNTCEGLMTYHNCSDGSSEGSAACQRTC----ANPHSICYSPGCVSGCVCPGGLIVDHNGNCVSEEQCTCEHNGRHYDPGDTIT-QLCNKCTCMNARWSCTSE 812          

HSP 6 Score: 50.8322 bits (120), Expect = 3.095e-6
Identity = 73/351 (20.80%), Postives = 142/351 (40.46%), Query Frame = 3
Query: 1980 TDDRANVFVIIQSNTESMLG-TEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKT------GTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTK 3011
            T D A++ + + S   +++  T+  S  ++  +    +++  ++++      L  ++    I G+    +LP+   D +I + ++   Y +      F L +D + +I +K+         GLCG F+G +++ +         S  ++  S++  +CD   Q I      +   C ++++    S  +N        ++  CR + +     L  C      A   RR     E P T    + C   C   G V + C   C+ TC   N + +  C   C  GC CP     T      G+G C+ +S C C    +       +G ++   C+ C C  G+ NC ++
Sbjct:   12 TFDHASMDLPLSSCALNLVSITDSPSLSLSFQRSALDRMSVENVVVTMEGISLSLTREGQSISGQ--RVQLPYK--DHSIQI-EMVGSYIKCSSIMGFSLLWDQNNAITVKLDPKFNTKTTGLCGDFNGIADDFYLNV-----MSTTSVLFSFLL-TCDEPTQHIEHLFEDELLSCVSVMDHQLKSLLVNI------LWSDICRLDCNGTAG-LYPCDGCATIAEFSRRCTQANESPGTWRSPEFCGVTCPR-GQVHRECGSVCKDTCS--NPSASVNCPSTCVDGCFCPEGTAGTVWDDVSGSG-CIPQSNCGCNQLGQ----SYASGESLITGCKNCTCEQGQWNCDSR 336          
BLAST of SCO-spondin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008773.1 (pep scaffold:Pmarinus_7.0:GL476328:703641:749596:1 gene:ENSPMAG00000007891.1 transcript:ENSPMAT00000008773.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 298.901 bits (764), Expect = 6.082e-82
Identity = 268/1002 (26.75%), Postives = 425/1002 (42.42%), Query Frame = 3
Query: 1332 PDDQILANQQCSKI--RLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSC-SDKGSCIQWRSDTL---CETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYT---CIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFID--GE----DHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY-ITGSCDNTPQSIVDP-------PAGDNDICSTIL--NGPEFSGCMNSSKVDKEFYATYCRREQSSNKD-QLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDD--CFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMD---SVSGCNSCTNYDTCTDTS----SIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIV----IEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGT-MKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDM-CNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEG-------GKHYDACASPCPQTC 4190
            PDD  +    C  +    +F  C   ++   Y   C+ + C+       T D P    V       YS  C S  G+   WR+ +       +C    I+ +C   CP +C     + S  C    V  C C  G +    T   CI  E C C+++   +  G +   DC  C C+  +W+C E+ C  TC + G +   TFD  +F F+     ++A+       D R ++F ++                     +        +  LK+ +  LG +   + I   GE    D    LP+      I  +    I+    +  +  +       +Y+ +  +      GLCG ++G   +DF   +  I  + +  A S+    +C    +S  +P            D+CS +   +GP FS C  +  V  E +   C  +  S +D +   C+A+ + A+AC    +  E  +  ++       C  G  V+   +  C +TCR L E T S+C        GC CP   Y +G G C++  EC C+     +   +P G ++      C C  G + C      T   CP   VY +   S +  NS   + TC+          + C CP   V   DGTC+QP  CPC +  ++ AP + I + C    C NR W   +     C + C  YG  HY+T DGQ F F+GSC Y +      + NN     I+  N+ CG +  TC++ + + +G     L + +     L    + +    I+    +  +V  S  + + WD++T V++ L P ++G V GLCGN+DG   N+    T M  ED ++F  S+  +  +C          A +KE    C     R  WA+Q CG++K  +  FASC   +  DV  ++  C++DACGC+ GGDCECLC ++A +A  C   G  +KWRT +LCP+ CE          HY  C   CP+TC
Sbjct:  175 PDDCSMHESLCELVLNTPEFADCKARLDVRPYIGACIVDQCS------CTSDCPDFGTV-----EEYSRECRSIGGTPGNWRNTSETCGAAPECLPGTIYQECGIPCPNSCSQ--PSLSNMCIEECVPGCFCPRGTIWDDLTDKGCIPLEECSCVFNKHTYNAGDILHQDCQDCVCHGGVWNCEEQPCTRTCALEGGSHIKTFDQNQFTFHGDCYYFMAM-------DCRTHLFNLM---------------------VKLKPCETKNTCLKSLALILGRNVLKIMISDSGEVSVNDVEVNLPYDSNAITIFYQSSFYIHLHTSIGVNLLVQLSPVMQLYLTLDPSFHTATCGLCGDYNGIQSDDFKTSNGLIEGTAIYFANSWKAQNTCPPPTESTEEPCMLSLNHKQYAEDMCSNMKTPDGP-FSACHGT--VSPEAFYKRCLYDTCSCQDSEACLCAALSSYALACASKHVVLE-GWREHLCAKYTENC-PGSQVYSYNALPCVNTCRVLQE-TGSQCFSSGVAVDGCTCPKGTYDSGGGFCMAPEECPCYY----RGNVLPLGNSVQQGKYICECRAGTMLCMNPQGPTPQPCPHPMVYFNCNQSTANGNSFPCHQTCSLQECYNPECNSGCVCPKGLVYSDDGTCIQPEACPCEHNGQKTAPGESIEVDCNTCTCVNRKWECTNN---TCLSTCSLYGQGHYRTFDGQRFLFEGSCTYVIAQDNCQNPNNEGTFNITTENVPCGTTGTTCSRSINVQVGNWVIKLFQKSYSIDFLGSGPETINPFQIKHRGLYL-VVETSNRITLTWDKNTGVFISLGPEYKGTVCGLCGNHDGRAANDLTTRTHMVVEDPLEFGNSWKLSG-LC----------ADAKETSSPCALMSHRLPWAQQRCGILK--SDTFASCHALV--DVLPFHEACVHDACGCDTGGDCECLCNAVAVYAKACNEAGQCIKWRTPDLCPLFCEYYDAPDDCTWHYRPCGQSCPKTC 1106          

HSP 2 Score: 146.362 bits (368), Expect = 3.429e-35
Identity = 118/413 (28.57%), Postives = 178/413 (43.10%), Query Frame = 3
Query: 3129 CGCPNDTV--SKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTL-MDTPGDSSNNIPPITISVANIACGFSLATC--AKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRS--TRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYED-AIQFAESFIANADICPYEISPENNVAPSKE--QDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIM---CEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGE-CVPPTTCPCFYNG 4325
            C CP  T+     D  C+   +C C++    Y   D++   C   +C   +WN    E   C   C   G  H KT D   F+F G C Y + MD      N +  +        C  SLA       ++I+I     +        +P       +  Q +F+  L + SIG+ +L   S   ++YL L PSF     GLCG+Y+G   +++       E  AI FA S+ A           +N   P  E  ++ C  + + K +AE MC  MK  +G F++C   +  +   +Y  CLYD C C       CLC +L+++A  CA   + ++   ++LC      C G + Y   A PC  TC  +        S+   V+GC+CP G  D  G  C+ P  CPC+Y G
Sbjct:  291 CFCPRGTIWDDLTDKGCIPLEECSCVFNKHTYNAGDILHQDCQDCVCHGGVWNC---EEQPCTRTCALEGGSHIKTFDQNQFTFHGDCYYFMAMDCRTHLFNLMVKLKPCETKNTCLKSLALILGRNVLKIMISDSGEVSVNDVEVNLPYDSNAITIFYQSSFYIHLHT-SIGVNLLVQLSPVMQLYLTLDPSFHTATCGLCGDYNGIQSDDFKTSNGLIEGTAIYFANSWKA-----------QNTCPPPTESTEEPCMLSLNHKQYAEDMCSNMKTPDGPFSACHGTVSPEA--FYKRCLYDTCSCQDSE--ACLCAALSSYALACASKHVVLEGWREHLCAKYTENCPGSQVYSYNALPCVNTCRVLQETGSQCFSSGVAVDGCTCPKGTYDSGGGFCMAPEECPCYYRG 684          

HSP 3 Score: 109.768 bits (273), Expect = 4.714e-24
Identity = 108/414 (26.09%), Postives = 174/414 (42.03%), Query Frame = 3
Query: 1701 CICGSGEV-EYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMGT-QFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY-ITGSCDN-----TPQSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQ---SSNKDQLSYCSAILNAAIACRRFG--IQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCD--DDCFPGCECPPNYYKTGTGQCVSESEC 2897
            C+C  G V     TCI+PE+CPC ++GQ+  PG   + DCNTCTC +  W CT   C STC + G   + TFDG +F F +  C YV  + +  N ++    F I   N     GT G +      + + V+V G+ +I      +L     ++   G    T  PF I        K   +Y  V+ S+   L +D +  ++I +    K  + GLCG  DG + ND T + + + E  +    S+ ++G C +     +P +++            IL    F+ C   + VD   +   C  +     +  D    C+A+   A AC   G  I++  P    +              ++ C ++C  TCR+ +          + C+P C     Y+      CVS   C
Sbjct:  759 CVCPKGLVYSDDGTCIQPEACPCEHNGQKTAPGESIEVDCNTCTCVNRKWECTNNTCLSTCSLYGQGHYRTFDGQRFLF-EGSCTYVIAQDNCQNPNNEG-TFNITTENVP--CGTTGTTC----SRSINVQV-GNWVI------KLFQKSYSIDFLGSGPETINPFQI--------KHRGLYLVVETSNRITLTWDKNTGVFISLGPEYKGTVCGLCGNHDGRAANDLTTRTHMVVEDPLEFGNSWKLSGLCADAKETSSPCALMSHRLPWAQQRCGILKSDTFASC--HALVDVLPFHEACVHDACGCDTGGDCECLCNAVAVYAKACNEAGQCIKWRTPDLCPLFCEYYDAPDDCTWHYRPCGQSCPKTCRDPHAECREGVQRFEGCYPKCTESKPYFDEDNMLCVSWDSC 1147          

HSP 4 Score: 104.76 bits (260), Expect = 1.612e-22
Identity = 106/381 (27.82%), Postives = 164/381 (43.04%), Query Frame = 3
Query: 3318 CIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITI-SVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFL-GIPVKWR-TQNLCPIM--CEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMI--DLNGE-CVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTC 4436
            C  +G  H+KT DG+ F    SC Y       D++ N   I   SV N     S+      + I +  +   +++ + D +P F +Y I I  L    ++ + +IG ++ W++   + L +  S++    GLCG+Y+GD +     G +     +  AE  + N    P     +    P+         PD  S  E +C ++ +T   FA C   +  DV  Y   C+ D C C    DC    T +  ++ +C  + G P  WR T   C     C  G  Y  C  PCP +C      + S+     CV GC CP G I  DL  + C+P   C C +N  +Y  G I+  ++C+ C C    +NC E    C  TC
Sbjct:    1 CSTWGQNHFKTFDGKFFDLGISCNYLFASNCKDATPNFNVIIRRSVNNPQIISSINISIIDINIDLSAEGAAVNKESQD-LP-FNQYGIQIIALGDDVKITATNIGFKLFWNKKDSLLLQVTESYRNKTCGLCGDYNGDAEYPEFKGGI-----LSVAEYALNNKYYDPMVQCDQIEQPPT---------PDDCSMHESLCELVLNTPE-FADCKARL--DVRPYIGACIVDQCSCT--SDCPDFGT-VEEYSRECRSIGGTPGNWRNTSETCGAAPECLPGTIYQECGIPCPNSC---SQPSLSNMCIEECVPGCFCPRGTIWDDLTDKGCIPLEECSCVFNKHTYNAGDILH-QDCQDCVCHGGVWNCEE--QPCTRTC 353          

HSP 5 Score: 83.9593 bits (206), Expect = 3.171e-16
Identity = 120/478 (25.10%), Postives = 180/478 (37.66%), Query Frame = 3
Query:  477 GGICMSPNQCKC-------------QENYAGMQCDEDNPIIIQSQHPSQLYC------YQSDQCFAFKKSDFLGKAVSYDEC--------CADKTGSWGSQSGSCVSCKA--------NFAGGNDV-----------------NNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTA-----PSDVSAVTWSINIVYENC---TSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVA-----SFGNSFKGFG-CPDIANTLSTCKPDDQIL--ANQQCSKIRL-KFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQC-----PGNKIW--SDCASECPVTCRNLFQTPSAYCQ 1682
            GG CM+P +C C             Q+     +C     + +  Q P+   C      +  +Q  A   S    +  S  EC        C    G   S  G+C+  +A          A G  +                 NN   +TC  YG  +YRTFD Q + ++G C+Y++       P++      + NI  EN    T+ T C + I ++ G+ V+K            + P T           I P    + ++     L+   +  I L WD  N          Y G V GLCGN D   +ND +   ++       FGNS+K  G C D   T S C      L  A Q+C  ++   F  C  LV+   +   CV + C          D     + LC  ++ Y+ +C++ G CI+WR+  LC   C     P +  W    C   CP TCR+    P A C+
Sbjct:  669 GGFCMAPEECPCYYRGNVLPLGNSVQQGKYICECRAGTMLCMNPQGPTPQPCPHPMVYFNCNQSTANGNSFPCHQTCSLQECYNPECNSGCVCPKGLVYSDDGTCIQPEACPCEHNGQKTAPGESIEVDCNTCTCVNRKWECTNNTCLSTCSLYGQGHYRTFDGQRFLFEGSCTYVIAQDNCQNPNNEG----TFNITTENVPCGTTGTTCSRSINVQVGNWVIKLFQKSYSIDFLGSGPET-----------INP----FQIKHRGLYLVVETSNRITLTWD-KNTGVFISLGPEYKGTVCGLCGNHDGRAANDLTTRTHMVVEDPLEFGNSWKLSGLCADAKETSSPCALMSHRLPWAQQRCGILKSDTFASCHALVDVLPFHEACVHDAC--------GCDTGGDCECLCNAVAVYAKACNEAGQCIKWRTPDLCPLFCEYYDAPDDCTWHYRPCGQSCPKTCRD----PHAECR 1114          

HSP 6 Score: 75.8702 bits (185), Expect = 8.950e-14
Identity = 93/387 (24.03%), Postives = 158/387 (40.83%), Query Frame = 3
Query: 1896 QFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSS---HFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSE-NDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPAGDN-----DICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQ----YEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPN--YYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTK 3011
             F TFDG  F    + C Y+      N  D   N  VII+ +             +N P+I++        I    S +         ++ E     LPF     N +  ++  +  +VK+++    FKL+++   S+ ++V+++ +N   GLCG ++G++E  +F     S+ E  +N         CD   Q    PP  D+      +C  +LN PEF+ C   +++D   Y   C  +Q S          +   +  CR  G           T      C+P     GT++Q C   C ++C +   + ++ C ++C PGC CP    +       C+   EC+C       +    AG  +  +CQ CVC  G  NC+ +
Sbjct:    8 HFKTFDGKFFDLG-ISCNYLFAS---NCKDATPNFNVIIRRS-------------VNNPQIISSINISIIDINIDLSAE------GAAVNKESQ--DLPF-----NQYGIQIIALGDDVKITATNIGFKLFWNKKDSLLLQVTESYRNKTCGLCGDYNGDAEYPEFKGGILSVAEYALNNKYYDPMVQCDQIEQ----PPTPDDCSMHESLCELVLNTPEFADC--KARLDVRPYIGACIVDQCSCTSDCPDFGTVEEYSRECRSIGGTPGNWRNTSETCGAAPECLP-----GTIYQECGIPCPNSCSQ--PSLSNMCIEECVPGCFCPRGTIWDDLTDKGCIPLEECSCVFNKHTYN----AGDILHQDCQDCVCHGGVWNCEEQ 347          

HSP 7 Score: 72.4034 bits (176), Expect = 9.619e-13
Identity = 94/389 (24.16%), Postives = 160/389 (41.13%), Query Frame = 3
Query:  768 TCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVT-GLCGXXXXXXXXXXXXXXXVAS-----FGNSFKGFG-CPDIANTLSTCKP-----DDQILANQQCSKIRLK---FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCET---QCPGNKIWSDCASECPVTCRNLFQTPSA-YCQNSKVGRCICGSGEVEYGYT-CIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPS 1874
            TC   G  + +TFD   +T+ G C Y +    D     +++ +  + C +   C+K + +  G  V+K      +  +DS      +SV + +  L      + +  Q +F +    +  + L    +  + + +         T GLCG+ +   S+DF   + +       F NS+K    CP    T ST +P     + +  A   CS ++     F  C   V+ + ++  C+ + C+  Q+S            LC  LS+Y+ +C+ K   ++   + LC      CPG++++S  A  C  TCR L +T S  +     V  C C  G  + G   C+ PE CPC Y G   P G   Q     C C +    C     P+
Sbjct:  352 TCALEGGSHIKTFDQNQFTFHGDCYYFMAM--DCRTHLFNLMVKLKPCETKNTCLKSLALILGRNVLK------IMISDSGE----VSVNDVEVNLPYDSNAITIFYQSSFYIHLHTSIGVNLLVQLSPVMQLYLTLDPSFHTATCGLCGDYNGIQSDDFKTSNGLIEGTAIYFANSWKAQNTCP--PPTESTEEPCMLSLNHKQYAEDMCSNMKTPDGPFSACHGTVSPEAFYKRCLYDTCS-CQDSEA---------CLCAALSSYALACASKHVVLEGWREHLCAKYTENCPGSQVYSYNALPCVNTCRVLQETGSQCFSSGVAVDGCTCPKGTYDSGGGFCMAPEECPCYYRGNVLPLGNSVQQGKYICECRAGTMLCMNPQGPT 716          
BLAST of SCO-spondin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008716.1 (pep scaffold:Pmarinus_7.0:GL476328:595486:663084:-1 gene:ENSPMAG00000007851.1 transcript:ENSPMAT00000008716.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 286.189 bits (731), Expect = 6.043e-78
Identity = 273/1016 (26.87%), Postives = 427/1016 (42.03%), Query Frame = 3
Query: 1506 CTHLSAYSDSCSDKGSCI-QWRSDTLCETQ-CPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGY---TCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGI-MGTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKS--IYIKVSDALKNN-----LIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY-ITGSCDNTPQSIVDPPAGDNDI-------CSTILNGPE-FSGCMNSSKVDKEFYATYCRREQ-SSNKDQLSYCSAILNAAIACRRFGIQYE--VPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCF--PGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNC--KTKDNCTNPVCPKNQVYMDSVSGC---NSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKY-----DIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEY-MHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNR--YYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACA---SPCPQT-CDTIGSNAPSHCSTTHCVEGC--SCPNGMIDLNGE---CVPPTTCPCFYNGQSY-VNGAIIKMENCKKCQCVQAKFNC 4403
            C  LSAYS  CS +   +  WRS  +C  Q CPGN  + +C S CP TC N+   PS  CQ   V  C+C SG V       TCI PE C C Y+G  +        DCN+CTC +  W CT ++CP  C +  G  F+TFD   + F+ V   Y+AV+             V +++  + +  +  N + +     +T K     +  K+          N  I     +  LP+     ++ + + ++++ +V  S    +    S +  +YI + D++          GLCG F+G + +DF      +  +    A S+ +   C++    I DP   +  +       C+ + N    F  C     VD   Y + C+++  S    Q       L+ A+AC   G+ +E     T + L  C         V+   +  C  TCR L+    + C +      GC+C    +    G CV    C C+       P    G  +TI    C C  G+L C    K++  +P  P   V + ++S     N C               C CP   ++  +G CV  S C   ++       +      + Y C +  WN    +   C++ C  YGD HY T DGQ F F G+C Y +      S   +    I   NI CG S++TC+K ++  +  +   L+ G  +   +         ++          +V  S G++++WDR T +++   P  Q  + GLCG Y+ D+ +++ M         + F  S+ A +D C       ++V  + E   C  NP RK+W+E+ C ++K    VF +C    H  V+   +Y  C+ D+C CN GGDCEC CTS+A +A  C   G  V WRT +LCP+ C+     D+C     PC      T G+ A         +EGC   CP     L+     CV    C C    Q    NG ++  + C+ C CV     C
Sbjct:  230 CAALSAYSRECSLQYKPLPNWRSSQMCPPQDCPGNLEYQECGSTCPPTCANM--DPSK-CQEPCVAGCVCPSGTVLSAINEETCIAPEECRCNYNGITYDASDKITIDCNSCTCEAGSWTCTTRLCPKACSLESGAHFNTFDSRSYTFHGVCSYYLAVK----------QAHVALRALGQKLECSAKNPSDLGSISSLTDKKRIRSLEFKS----------NGKIISSQMSVSLPYI--SDSVKIFRKSSMFIQVDTSYGMMMLVQNSPTMQVYIGLIDSVMFRETVCTPTGLCGNFNGIASDDFMSSQGLVEGTAAAFANSWKVNPDCEDVGTVIRDPCQLNTAVAKQAELRCAILRNSTAFFKDCHY--LVDPYSYYSRCKQDACSCPSGQDCITETFLSYALACASKGLIFENWRKATDSQLVEC-----PNAEVYSYNANACNQTCRSLSSVDLA-CQESGLVAEGCQCAEGLFANDEGMCVPAVSCPCYVNGDILKP----GEKVTIADIPCYCREGQLLCSESKKEDHVDPY-PPPPVAIQNISTLVRINECVVLYFLQLGRQCQPGCICPEGLINNGNGDCVNNSPCSVCHLVMS-GRKEQCHCGASVYKCYSGSWNCTELQ---CDSTCKMYGDGHYTTFDGQRFQFDGNCEYVVAQDFCVSDPKVGTFQIITENIPCG-SMSTCSKSIRFFLQNKEIKLADGKYEIHDVSGSASKGSEEVFTVHTVGLYLIVKASNGIKLIWDRRTSLFIIAPPDKQNQLCGLCGKYNFDMSDDFTMRDHSLSASPLHFGNSWKA-SDAC-------SDV--TDEASPCEMNPYRKAWSERKCSILK--TDVFDAC----HSQVDHIPFYEACVRDSCACNIGGDCECFCTSVAAYAEACTSAGQCVAWRTPDLCPVFCDYYNSPDSCTWHYRPCGIVNTKTCGNPAGIDLGNFPQLEGCYPKCPAKTPYLDEHMMTCVSMDKCSCEMGSQIVPANGTVVNRDTCETCTCVMGNMEC 1186          

HSP 2 Score: 90.1225 bits (222), Expect = 4.639e-18
Identity = 109/405 (26.91%), Postives = 163/405 (40.25%), Query Frame = 3
Query: 3297 TANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGN--NDTIPLFPKYDIVIEQLTFFTQLVSDSIGLR--VLWDRSTRVYLFLKP-----SFQG--------------NVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANAD-ICPYEISPE-NNVAPSKEQDMCNANPDRKSW----AEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWR--TQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGE---------CVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQA 4391
            T  C   C  +GDPHY+T DGQ ++F   C YTL++        I     SV      F   T A FV+ I      +   GN  N ++P       VI ++ F  Q V+     +  V+ +  T++ + +       SF G              N QG CG  +    ++ M  +   EDA   A   +  AD + P    P     AP+ ++   +  P  + +       +C ++  +N  FA C EA   D++ ++ +C+YD C        E  C SL   A QCA LG  V WR  T+ +C   C  G  Y         +CD  G+       T+   EGC CP GM   N +         C+ P   P  + G S+         +CK+C C +A
Sbjct: 1952 TWKCNCQCQGWGDPHYRTFDGQKYTFLEDCTYTLVE------EKINKYAFSVLVDNYYFYKQTPASFVRGIT-----VNYNGNSANISLPAAKGRQTVINKVIFNGQAVAFPFVGKGFVITNHETQILVEIPAIGASVSFTGMMFTVDLPYSLFGNNTQGQCGTCNNARGDDCMRQSGVVEDASCCA---VTAADWMVPDASKPHCRAKAPTGQKPCPSTTPTTRPYCTADTATICDIIT-SNRAFAGCAEAT--DLSEFFDSCVYDTCAVPTA--LEVGCASLQVAAEQCAALGFYVDWRSLTRGMCQYNCSSGFEYQPIGPKEQLSCDYSGATI----QTSILEEGCFCPKGMKMFNSQAQTCVVECGCMGPQGKPVMF-GNSW-------QSDCKECVCDKA 2325          

HSP 3 Score: 81.6481 bits (200), Expect = 1.719e-15
Identity = 96/379 (25.33%), Postives = 149/379 (39.31%), Query Frame = 3
Query: 3309 EAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNND--------TIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVK-WRTQNLCPIM-CEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMI--DLNGE-CVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCT 4406
            +AVC  +G   +KT D   F F  +C Y       D  ++     I +++ A         +F +I+    T +    N          T+P F    I+I+      +L    + +    +      +     F+  + GLCGN+DG       +  +K         SF A      YE+     V  S+        P  + +  Q     K T  V +SC  +   +   Y + C  + C C  G    C C +L+ ++ +C+    P+  WR+  +CP   C G   Y  C S CP TC  +    PS C    CV GC CP+G +   +N E C+ P  C C YNG +Y     I ++ C  C C    + CT
Sbjct:    3 QAVCTTWGGGFFKTFDEAFFKFSSNCSYMFFQ---DCRSSYEEFNIKISHGAN-------EQFSEILFKIDTDVAQFANGKVSFNNRILTLP-FSNNKILIQTHGSGVKLAFRQLEISAYLNDDA-FTVVAGDEFRQQLCGLCGNFDGSSTVTTSYSRLK------MLLSFSA------YEV--LFFVKCSQLHLNLKTLPAIQQYLIQPKSSGKCTAVVTSSCKGSCGLNQEGYAAMCAIEKCQC--GSATTCGCAALSAYSRECSLQYKPLPNWRSSQMCPPQDCPGNLEYQECGSTCPPTCANMD---PSKCQEP-CVAGCVCPSGTVLSAINEETCIAPEECRCNYNGITYDASDKITID-CNSCTCEAGSWTCT 348          

HSP 4 Score: 60.8474 bits (146), Expect = 3.740e-9
Identity = 91/376 (24.20%), Postives = 157/376 (41.76%), Query Frame = 3
Query:  792 YYRTFDNQLYTYQGRCSYILT---APSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCG-----XXXXXXXXXXXXXXXVASFGNSFK-GFGCPDIANTLS-TCKPDDQIL--ANQQCSKIR---LKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQ-WRSDTLCE-TQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGR--CICGSGEVEYGY-TCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTE 1859
            ++ TFD++ YT+ G CSY L    A   + A+   +    +N  SD G +  +  +     ++   NG + ++  +  L  +S    DS  I   + M++    ++ ++ L   +  ++      +  S+         TGLCG      +D+  S+        A+F NS+K    C D+   +   C+ +  +   A  +C+ +R     F  C  LV+  +Y+S C Q+ C+           PS  D +     +Y+ +C+ KG   + WR  T  +  +CP  +++S  A+ C  TCR+L     A CQ S +    C C  G        C+   SCPC  +G    PG         C C      C+E
Sbjct:  363 HFNTFDSRSYTFHGVCSYYLAVKQAHVALRALGQKLECSAKN-PSDLGSISSLTDKKRIRSLEFKSNGKIISSQMSVSLPYIS----DSVKIFRKSSMFIQVDTSYGMMMLVQNSPTMQ--VYIGLIDSVMFRETVCTPTGLCGNFNGIASDDFMSSQGLVEGTAAAFANSWKVNPDCEDVGTVIRDPCQLNTAVAKQAELRCAILRNSTAFFKDCHYLVDPYSYYSRCKQDACS----------CPSGQDCITETFLSYALACASKGLIFENWRKATDSQLVECPNAEVYSYNANACNQTCRSLSSVDLA-CQESGLVAEGCQCAEGLFANDEGMCVPAVSCPCYVNGDILKPGEKVTIADIPCYCREGQLLCSE 720          

HSP 5 Score: 60.077 bits (144), Expect = 5.989e-9
Identity = 78/331 (23.56%), Postives = 127/331 (38.37%), Query Frame = 3
Query: 2100 SDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKN------IHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEK------DNSIRESIVNIAKSYITGSCDNTP---QSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQ--CVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPK 3041
            S+I+ K       D+    F +G+        T+P  N       H   +   + ++++S++         +  +   D  +  L GLCG FDG+S    +          S  E +  +  S +  +    P   Q ++ P +     C+ ++     S C  S  +++E YA  C  E+       +   A L+A    R   +QY+        Q C P    G   +Q C  TC  TC  ++    SKC + C  GC CP     +   +  C++  EC C       D    A   ITI+C +C C  G   C T+      +CPK
Sbjct:   56 SEILFKI------DTDVAQFANGKVSFNNRILTLPFSNNKILIQTHGSGVKLAFRQLEISAYLN-----DDAFTVVAGDEFRQQLCGLCGNFDGSSTVTTSYSRLKMLLSFSAYEVLFFVKCSQLHLNLKTLPAIQQYLIQPKSSGK--CTAVVT----SSCKGSCGLNQEGYAAMCAIEKCQCGSATTCGCAALSA--YSRECSLQYKPLPNWRSSQMCPPQDCPGNLEYQECGSTCPPTCANMD---PSKCQEPCVAGCVCPSGTVLSAINEETCIAPEECRCNYNGITYD----ASDKITIDCNSCTCEAGSWTCTTR------LCPK 354          
BLAST of SCO-spondin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008652.1 (pep scaffold:Pmarinus_7.0:GL477625:577100:586386:1 gene:ENSPMAG00000007836.1 transcript:ENSPMAT00000008652.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 264.233 bits (674), Expect = 1.359e-75
Identity = 191/671 (28.46%), Postives = 314/671 (46.80%), Query Frame = 3
Query: 2247 EVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY-----ITGSCDNTPQSIVDPP--------AGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQ-SSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTG-QCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNP--VCPKNQVYMDSVSGCN-SCTNYDTCTDTSSIANSC--GCPNDTVSKIDGT-CVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDT--------------PGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLF-------PKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQ--FAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLC 4127
            +V + +  ++ +DG + +Y+     L+  + GLCG F  +  +DF  +   +   +      +      T SC       +  P        +   + C+ ++N P F+ C   ++V+ + +   C  E  ++     + C    + A  C   G+   V     +L  C   C  G  V+Q C+ +C+STC  L  +    C ++C  GC CP        G  CV +S+C C   S    P    G+ + + C+ C C  G  +C + + C +   +CP+N  +    S C  +C N +  + +S I  +C  GC   T    DG+ CVQP++CPC +  + +     IT+ C   +C+ ++W     E   C  VC  YGDPHYKT DG+ + FQG+C Y L  T               GD  N+     ++V N+ CG S  TC K     IG + +    G+   I L        P  + +I +   +   V   IG+ + WD STR+Y+ L P + G V+GLCGN++GD  ++++       + +   F +S+  +A   P  +            D C  +P R +W+++ CGV++ +  +FA C   +   V  Y   CLYDACGC+ GGDCECLCT++A +A +C+  G+P++WR+  LC
Sbjct:    1 QVTLDNGMRIVWDGVRRLYVTAPPELEGTVAGLCGTFTRDQRDDFMTRAGDVEIEVWAFTARWKVAQGATNSCPEANSLALASPCNTYAQLNSAAQETCNKLMNDP-FNLC--HTRVNPDAFKKDCTYEVCTAGALTGAECKTFADYAYICASRGV---VLANWRLLLDCTVTC-PGDMVYQQCASSCRSTCASL--SNIEDCHEECAEGCNCPDGLLLDFDGLSCVDQSQCKCSYSSTNYAP----GSILQMGCKNCTCEYGGWSCWSSEGCVDDSGLCPENMQWSPCKSSCPVTCGNMNNPSLSSCITETCDAGCECSTGLVWDGSKCVQPANCPCYHGGQSFQTGQSITLDCNNCVCNGQVWEC---EHKRCPGVCSVYGDPHYKTFDGRAYDFQGNCQYVLARTIYSLIDYSSLNLTDMGDVDND--GFVLTVENVPCGSSGVTCTKN----IGLKYWRAHNGDIFKIDLVRGKNVVDPTGNFIIRRAGLYL-FVDTPIGVSIQWDYSTRLYIRLHPKYMGLVEGLCGNFNGDQNDDFVTPAAGPPEEMPNIFGDSWKVHAYCAPAVVI----------NDTCLTHPHRAAWSQRKCGVLRSS--LFADCQGVVA--VAPYVDRCLYDACGCDSGGDCECLCTAIAAYAYECSANGVPIEWRSDELC 634          

HSP 2 Score: 114.39 bits (285), Expect = 5.263e-26
Identity = 106/405 (26.17%), Postives = 156/405 (38.52%), Query Frame = 3
Query: 1593 CPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKV-GRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESM--LGTEGNSAYINEPKIVTVKVNG----SDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPAGDNDICST-------------ILNGPEFSGCMNSSKVDKEFYATYCRREQ---SSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAG 2735
            CP N  WS C S CPVTC N+     + C        C C +G V  G  C++P +CPC + GQ    G     DCN C CN  +W C  K CP  C + G   + TFDG  + F    CQYV              ++ +I  ++ ++  +G   N  ++   + V    +G     +I LK      GD      + G++         P  N  +R+   +Y  V       + +D S  +YI++       + GLCG F+G+  +DF        E + NI            P  ++      ND C T             +L    F+ C     V    Y   C  +     S  D    C+AI   A  C   G+  E  + S+ L    PLC+ G
Sbjct:  267 CPENMQWSPCKSSCPVTCGNMNNPSLSSCITETCDAGCECSTGLVWDGSKCVQPANCPCYHGGQSFQTGQSITLDCNNCVCNGQVWECEHKRCPGVCSVYGDPHYKTFDGRAYDFQG-NCQYVLAR----------TIYSLIDYSSLNLTDMGDVDNDGFVLTVENVPCGSSGVTCTKNIGLKYWRAHNGDIFKIDLVRGKN------VVDPTGNFIIRR-AGLYLFVDTPIGVSIQWDYSTRLYIRLHPKYMGLVEGLCGNFNGDQNDDFVTPAAGPPEEMPNIFGDSWKVHAYCAPAVVI------NDTCLTHPHRAAWSQRKCGVLRSSLFADCQGVVAVAP--YVDRCLYDACGCDSGGDCECLCTAIAAYAYECSANGVPIE--WRSDELCRKSPLCKKG 643          

HSP 3 Score: 100.908 bits (250), Expect = 8.025e-22
Identity = 76/263 (28.90%), Postives = 122/263 (46.39%), Query Frame = 3
Query: 3630 GLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDAC--GCNRGGDCECLCTSLATFATQCAFLGIPVK-WRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNG-MIDLNG-ECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNC 4403
            G+R++WD   R+Y+   P  +G V GLCG +  D ++++M      E  +    +    A          N++A +     CN      S A++ C   K  N  F  C   ++ D   +  +C Y+ C  G   G +C+    + A +A  CA  G+ +  WR    C + C G   Y  CAS C  TC ++ +    H     C EGC+CP+G ++D +G  CV  + C C Y+  +Y  G+I++M  CK C C    ++C
Sbjct:    7 GMRIVWDGVRRLYVTAPPELEGTVAGLCGTFTRDQRDDFMTRAGDVEIEVWAFTARWKVAQGATNSCPEANSLALASP---CNTYAQLNSAAQETCN--KLMNDPFNLCHTRVNPDA--FKKDCTYEVCTAGALTGAECK----TFADYAYICASRGVVLANWRLLLDCTVTCPGDMVYQQCASSCRSTCASLSNIEDCH---EECAEGCNCPDGLLLDFDGLSCVDQSQCKCSYSSTNYAPGSILQM-GCKNCTCEYGGWSC 254          

HSP 4 Score: 62.7734 bits (151), Expect = 4.991e-10
Identity = 52/195 (26.67%), Postives = 79/195 (40.51%), Query Frame = 3
Query: 1296 CPDIANTLSTCKPDDQIL-----ANQQCSKIRLK-FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQ-WRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVE--YGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHC 1853
            CP+ AN+L+   P +        A + C+K+    F  C   VN D +   C   +CT            +++   C   + Y+  C+ +G  +  WR    C   CPG+ ++  CAS C  TC +L       C       C C  G +    G +C+    C C Y    + PG++ Q  C  CTC    W C
Sbjct:   73 CPE-ANSLALASPCNTYAQLNSAAQETCNKLMNDPFNLCHTRVNPDAFKKDCTYEVCTAG----------ALTGAECKTFADYAYICASRGVVLANWRLLLDCTVTCPGDMVYQQCASSCRSTCASLSNIED--CHEECAEGCNCPDGLLLDFDGLSCVDQSQCKCSYSSTNYAPGSILQMGCKNCTCEYGGWSC 254          

HSP 5 Score: 62.003 bits (149), Expect = 1.104e-9
Identity = 71/286 (24.83%), Postives = 121/286 (42.31%), Query Frame = 3
Query:  768 TCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTW-SINIVYENCTSDTGCVKVIV-IEAGDVVVKSSGN-GILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVAS------FGNSFK--GFGCPDIA-NTLSTCKPDDQILANQQCSKIRLK-FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCE 1586
             C  YG  +Y+TFD + Y +QG C Y+L A +  S + + S+N+       + G V  +  +  G   V  + N G+ Y    N  +  + +    +  ++  T  +++R+    L       + ++WD  +       +  Y G V GLCGN + + ++DF              FG+S+K   +  P +  N      P     + ++C  +R   F  C  +V    Y   C+ + C          D     + LCT ++AY+  CS  G  I+WRSD LC 
Sbjct:  362 VCSVYGDPHYKTFDGRAYDFQGNCQYVL-ARTIYSLIDYSSLNLTDMGDVDNDGFVLTVENVPCGSSGVTCTKNIGLKYWRAHNGDIFKIDLVRGKN--VVDPTGNFIIRRAGLYLFVDTPIGVSIQWD-YSTRLYIRLHPKYMGLVEGLCGNFNGDQNDDFVTPAAGPPEEMPNIFGDSWKVHAYCAPAVVINDTCLTHPHRAAWSQRKCGVLRSSLFADCQGVVAVAPYVDRCLYDAC--------GCDSGGDCECLCTAIAAYAYECSANGVPIEWRSDELCR 635          

HSP 6 Score: 57.7658 bits (138), Expect = 1.939e-8
Identity = 30/90 (33.33%), Postives = 44/90 (48.89%), Query Frame = 3
Query: 4134 MCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNC 4403
            +C     +  C S CP TC  + + + S C T  C  GC C  G++    +CV P  CPC++ GQS+  G  I ++ C  C C    + C
Sbjct:  266 LCPENMQWSPCKSSCPVTCGNMNNPSLSSCITETCDAGCECSTGLVWDGSKCVQPANCPCYHGGQSFQTGQSITLD-CNNCVCNGQVWEC 354          
BLAST of SCO-spondin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009153.1 (pep scaffold:Pmarinus_7.0:GL479660:8329:29413:-1 gene:ENSPMAG00000008271.1 transcript:ENSPMAT00000009153.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 152.91 bits (385), Expect = 8.296e-39
Identity = 145/491 (29.53%), Postives = 206/491 (41.96%), Query Frame = 3
Query: 3033 CPKNQVYMDSVSGC-NSCTNY---DTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPC-----IY--MNREYAPNDVIT---------IKCAKYICSNRMWNLLSEETANCEAV----CIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANI-ACGFSLATCAKFVQI-IIGGQTYLLSR-------GNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQ-FAESFIANA---DICPYEISPENNVAPSKEQD-MCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGI-PVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENC-KKCQCV 4385
            C  N  Y D  S C N+C +    D C  T +    C C +  V   D  CV   DC C     IY  +   +  ++  T         + C  + C       L      C+ V    C   GDPHY+T DG  ++F G+  Y L+ T GD+ N I PI +   N    G S  +    V + + G +    SR       G     P+FP+  + I+Q +    L +D  GL V++DR     + +  S+   V GLCGNY+GD  +EY     +   +I+ F ES+  N    ++ P     + +++     D  C+     +      CG++KD  G F  C E +  D   YY NCLYD C     GD E LC S+A +   C   GI P  WR  + C   C     Y    + CP +C  +   AP  C     +EGC C  G +     CVP   C CF++   Y  G       C  +CQCV
Sbjct:   71 CLANSHYTDCASLCPNTCLHASTEDDCRSTETCTEGCVCDSGFVLS-DRLCVPQQDCGCWDNGKIYHTLGESWLTDNCSTQCRCMGPEEMNCTLHSCMAEESCALQNGQYKCQPVGFSTCTISGDPHYQTFDGLPYNFMGNNTYVLVQTSGDNPNLI-PINVRGKNANRHGLSDVSYLDEVHVNVFGHEIRFTSRCQLPYFDGVRMRPPMFPREGLSIQQSSHRIILQTD-FGLTVIYDRREHADVIISSSYMNEVSGLCGNYNGDPNDEYFGRNGQQIPSIKVFGESWAMNGASENLAPAVSQYKFSISEDSLNDPTCSGTQLIELQGISSCGMIKDMAGPFQPCQETVSPD--SYYENCLYDMCA--NFGDKETLCNSVAVYTAACQRKGITPSNWRNFSGCDAACPPNSIYTESMTACPASCGNLA--APEECGLPR-MEGCQCELGFVWSGFHCVPFRDCGCFHDDTYYEVGKEFYSPQCSSRCQCV 551          

HSP 2 Score: 88.1965 bits (217), Expect = 5.676e-18
Identity = 131/559 (23.43%), Postives = 224/559 (40.07%), Query Frame = 3
Query: 1383 FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQ-EHPPGTVRQFD-CNT-CTC------NSSLWHC-TEKICP-------------STCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKL--YFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY-ITGSCDN------------TPQSIVDPPAGDNDI--------CSTI--LNGPEFSGCMNSSKVDKEFYATYCRREQSSN-KDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWN 2909
            F  C  ++N   Y + C  ++   S           ++ +LC  L AY+++C  +G  IQWR++T C   C  N  ++DCAS CP TC +           +    C+C SG V     C+  + C C  +G+  H  G     D C+T C C      N +L  C  E+ C              STC I G   + TFDG  + F      YV V+ S     D  N+  I      +      + +Y++E   V V V G +I   +   QL       + DG       P   P + + +++ ++    + + + F L   +D  +   + +S +  N + GLCG ++G+  +++  ++     SI    +S+ + G+ +N            +  S+ DP      +        C  I  + GP F  C  +  V  + Y   C  +  +N  D+ + C+++     AC+R GI    P        C   C    +++      C ++C  L  A   +C      GC+C   +  +G   CV   +C C++
Sbjct:   11 FASCHHVINPQDYVTTCTFDMGQYS----------GMASILCDSLQAYAEACRVEGVNIQWRNETFCPLSCLANSHYTDCASLCPNTCLHASTEDDCRSTETCTEGCVCDSGFVLSDRLCVPQQDCGCWDNGKIYHTLGESWLTDNCSTQCRCMGPEEMNCTLHSCMAEESCALQNGQYKCQPVGFSTCTISGDPHYQTFDGLPYNFMGNN-TYVLVQTS----GDNPNLIPINVRGKNANRHGLSDVSYLDE---VHVNVFGHEIRFTSRC-QL------PYFDG---VRMRPPMFPREGLSIQQSSH---RIILQTDFGLTVIYDRREHADVIISSSYMNEVSGLCGNYNGDPNDEYFGRNGQQIPSIKVFGESWAMNGASENLAPAVSQYKFSISEDSLNDPTCSGTQLIELQGISSCGMIKDMAGP-FQPCQET--VSPDSYYENCLYDMCANFGDKETLCNSVAVYTAACQRKGI---TPSNWRNFSGCDAACPP-NSIYTESMTACPASCGNL--AAPEECGLPRMEGCQCELGFVWSGF-HCVPFRDCGCFH 528          

HSP 3 Score: 81.6481 bits (200), Expect = 7.730e-16
Identity = 59/169 (34.91%), Postives = 83/169 (49.11%), Query Frame = 3
Query: 3915 CGVMKDTNGVFASCIEAMH-QDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHC-STTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVN-GAIIKMENCK-KCQCV-QAKFNCT 4406
            C V+    G FASC   ++ QD   Y + C +D       G    LC SL  +A  C   G+ ++WR +  CP+ C    HY  CAS CP TC  + ++    C ST  C EGC C +G +  +  CVP   C C+ NG+ Y   G     +NC  +C+C+   + NCT
Sbjct:    1 CQVLTSPTGPFASCHHVINPQD---YVTTCTFDMG--QYSGMASILCDSLQAYAEACRVEGVNIQWRNETFCPLSCLANSHYTDCASLCPNTC--LHASTEDDCRSTETCTEGCVCDSGFVLSDRLCVPQQDCGCWDNGKIYHTLGESWLTDNCSTQCRCMGPEEMNCT 162          

HSP 4 Score: 63.5438 bits (153), Expect = 3.153e-10
Identity = 81/357 (22.69%), Postives = 148/357 (41.46%), Query Frame = 3
Query:  783 GLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXX-----XXXXXXXXXXXXVASFGNSFKGFGCPD-IANTLSTCK--PDDQILANQQCSKIRL-----------------KFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKG-SCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYD 1775
            G  +Y+TFD   Y + G  +Y+L   S  +     IN+  +N  +  G   V  ++  +V V   G+ I +T+    P             + P   + + +  + I+L  + G + + +D   +  + I +S    +V+GLCGN +          +     ++  FG S+   G  + +A  +S  K    +  L +  CS  +L                  F  C + V+ D+Y+  C+ ++C    +  T          LC  ++ Y+ +C  KG +   WR+ + C+  CP N I+++  + CP +C NL       C   ++  C C  G V  G+ C+    C C +D
Sbjct:  193 GDPHYQTFDGLPYNFMGNNTYVLVQTSGDNPNLIPINVRGKN-ANRHGLSDVSYLD--EVHVNVFGHEIRFTSRCQLPYFDGVRMRPP---MFPREGLSIQQSSHRIILQTDFG-LTVIYDRREHADVIISSSYM-NEVSGLCGNYNGDPNDEYFGRNGQQIPSIKVFGESWAMNGASENLAPAVSQYKFSISEDSLNDPTCSGTQLIELQGISSCGMIKDMAGPFQPCQETVSPDSYYENCLYDMCANFGDKET----------LCNSVAVYTAACQRKGITPSNWRNFSGCDAACPPNSIYTESMTACPASCGNL--AAPEECGLPRMEGCQCELGFVWSGFHCVPFRDCGCFHD 529          
BLAST of SCO-spondin vs. Ensembl Nematostella
Match: EDO44199 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWN6])

HSP 1 Score: 255.758 bits (652), Expect = 1.304e-68
Identity = 307/1209 (25.39%), Postives = 483/1209 (39.95%), Query Frame = 3
Query:  771 CHSYGLDYYRTFDNQLYTYQGRCSY-ILTAPSDVSAVTWSINIVYENCTSDTGCVKVI-------VIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVASFGNSFKGFGCPDIANTLSTCKPD-----------DQILANQQCSKI-----RLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCS-DKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEP--SVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIIL----KATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY------ITGSCDNTPQSIVDPPAGD--------NDICSTI--LNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIP--LCQAGGTVFQICSR-------TCQSTCRELNEATASKCDDDCFPGCECPPN-YYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGS-CMYTLMDTPGDSSNNIPPITISVANIAC--GFSLATCAKF--------VQIIIGGQTYLLSRGNNDTI-----------PLFPKYDIVIE--QLTFFT------QLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAI-QFAESF-IANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLC 4127
            C+  G  ++ TFD+Q Y++ G CSY  L   S+V  +   +    +NC  +  C K +        +  G  V    G   +     N P T  S  N   A    G  + V   D  ++    +  + +K  ++     S         + GLCGN D N +NDF   D      ++   FG   + + L T  P            D   A Q   K+        F  C   V+   + + C+ ++C      N+T    S SD +C  LS YS +C+ +    + WRS +LC   CP     S+C+S CP  C N+   P+A C +  V  C C  G+++    C+ P  C C + G  +  G +R+ +C++C CN  +W+CT+  C  TC ++G + F TFD   ++ +   C YV  E     N+T  +  + + I S+    L      A      +    V GS  +L    KATS  L      V                 +N+ V     +           + + G  + YI V    K+   GLCG F+ N  +DF  +D          A+ +         +C  +  + +D P              C+ I  LNGP F  C     V  +     C ++    KD L  CS     A AC   GI   +    + +  C P  +C AG TV + C+R        C STC +L   T +     C  GC C           +CV +++C C+      D     G      C  C C  G  +C   D C      +  VY D    C +   +          + C CP+  +   +GTCVQ   C C + N+ Y    +    C++    +R W  L+   A  E  C A+G  HY+T DG +++F+   C YT M+           + + V N+ C   F L  C +         V++++  +++ L R   DT            P    Y   +E  Q+  F       ++  + I   + +D+ TRVY+     ++G VQGLCGN+DG   N+    T     +I +FA+S+ + +A +    +SP            C   PDRK WA++ C  ++  N  F  C +A++     Y   C Y+ C  + GGDC   C+++A +   C   GI + WR +  C
Sbjct:  478 CYISGRGHFTTFDHQEYSFYGTCSYKALIDNSNVKQIFQVVLNNDKNCDINAPCTKSVDVNVDGKKVHLGQEVASRHGFVKVDGVTENLPYTK-SWPNIRQA----GKYVIVRTSDEVLIYFDGSEELMIKVPDSYKTVNSSDTR-----LKGLCGNYDGNNTNDFIGLDGTTYTKDNINDFGVSMLDDPLCTNPPKPPSGCYSEVAGDVFSAMQNAEKMCSVIQSDAFSACRSKVDFRDFKAQCIADVCA----CNST----SRSDCMCNVLSTYSKACAWNHNITLSWRSPSLCPVTCPSGMEHSECSSACPRDCSNMNSDPNA-CNSKCVDGCFCPEGKIQDRGKCVDPGQCSCYHSGIPYAHGAIRKSECSSCLCNGGMWNCTDTPCSGTCTMVGNSHFTTFDSRSYSMHG-QCDYVLSEHCHFSNDTTKQFTIHIKISSDGSRQLIVSLAGA----TPVTLGGVEGSPTVLNSNGKATSHILSVEHIGV-----------------QNVLVHAYAGL----------TILWTGYNA-YITVGPDFKSQTCGLCGTFNQNDADDFHTRDGDNEADAYAFAQEWQVVSSVAASNCHRSNWNQLDQPCSTYSSNEGYAKSGCNAIIDLNGP-FKACHR--YVPPQDMYQKCVKDGCMCKDCL--CSVAAAYAKACADKGIV--IDGWRDTISVCKPKFVCPAG-TVLKQCNRDPLTRKLRCPSTCDDLANVTDTCPSRRCVEGCYCEKEGELMNNEHKCVDKTQCPCYY----GDTMYKYGEIRKDRCNNCTCKGGVFDCTNVD-CEAMCLTRGLVYSDCGITCENL--HPINGGERPCVSGCYCPDGLIMHDNGTCVQSMQCQCKHNNKYYDAGAISPTDCSRKCRGDRYWEQLAGIQAQPEYECSAFGKGHYRTFDGMLYNFESEGCGYTFMEHED--------VKVVVKNMKCVNSFELQMCKEVTITLVKENVEVVMMQKSFTLKRNGIDTAYNPGSYPPPCKPFLNTYMNTLEIFQVGLFMIVRIVDRVNPNHIKFEIRFDQGTRVYVMANTDYKGTVQGLCGNFDGKDSNDKRTSTGSIATSIPEFADSWRVGSACLDTKTVSP------------CVLYPDRKPWADKGCEEIR-ANPNFTICHDAVNP--APYIEACKYETCMSHMGGDCGAFCSAIAAYVRACNRYGISILWRREGFC 1596          

HSP 2 Score: 148.673 bits (374), Expect = 1.127e-35
Identity = 121/420 (28.81%), Postives = 196/420 (46.67%), Query Frame = 3
Query: 3312 AVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQ-----------LVSDSIGLRVLWDRSTRVYLFLKPSFQG------NVQGLCGNYDGDLQNEY--MHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAF-LGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTP---SQFRCDDGKCIESSKICDKV 4502
             +C   G  H+ T D Q +SF G+C Y  +    D+SN      + + N       A C K V + + G+   L +    +   F K D V E L +              +V  S  + + +D S  + + +  S++        ++GLCGNYDG+  N++  + GT   +D I      + +  +C     P +        D+ +A  +    AE+MC V++  +  F++C   +  D   + + C+ D C CN     +C+C  L+T++  CA+   I + WR+ +LCP+ C  G  +  C+S CP+ C  + S+ P+ C++  CV+GC CP G I   G+CV P  C C+++G  Y +GAI K E C  C C    +NCT+  + C  TCT    S F   D +       CD V
Sbjct:  476 GLCYISGRGHFTTFDHQEYSFYGTCSYKALI---DNSNVKQIFQVVLNNDKNCDINAPCTKSVDVNVDGKKVHLGQ-EVASRHGFVKVDGVTENLPYTKSWPNIRQAGKYVIVRTSDEVLIYFDGSEELMIKVPDSYKTVNSSDTRLKGLCGNYDGNNTNDFIGLDGTTYTKDNINDFGVSMLDDPLCTNPPKPPSGCYSEVAGDVFSAMQN----AEKMCSVIQ--SDAFSACRSKV--DFRDFKAQCIADVCACNSTSRSDCMCNVLSTYSKACAWNHNITLSWRSPSLCPVTCPSGMEHSECSSACPRDCSNMNSD-PNACNS-KCVDGCFCPEGKIQDRGKCVDPGQCSCYHSGIPYAHGAIRKSE-CSSCLCNGGMWNCTD--TPCSGTCTMVGNSHFTTFDSRSYSMHGQCDYV 878          

HSP 3 Score: 123.635 bits (309), Expect = 4.267e-28
Identity = 134/505 (26.53%), Postives = 205/505 (40.59%), Query Frame = 3
Query: 3030 VCPKNQVYMDSVSGC-NSCTNYDTCTDT--SSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFS--LATCAKFVQIIIGG----QTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYE-DAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMH-QDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVK-WR-TQNLCP--IMCEGGKHYDACAS-------PCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGE--CVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTE------------DYSDCITTC 4436
             CP    + +  S C   C+N ++  +   S   + C CP   +    G CV P  C C +    YA   +   +C+  +C+  MWN        C   C   G+ H+ T D + +S  G C Y L +    S++     TI +   + G    + + A    + +GG     T L S G   +      + + +E +     LV    GL +LW      Y+ + P F+    GLCG ++ +  +++       E DA  FA+ +   + +        N    ++    C+     + +A+  C  + D NG F +C   +  QD+   Y  C+ D C C      +CLC+  A +A  CA  GI +  WR T ++C    +C  G     C          CP TCD + +N    C +  CVEGC C      +N E  CV  T CPC+Y    Y  G I K + C  C C    F+CT              YSDC  TC
Sbjct:  758 TCPSGMEHSECSSACPRDCSNMNSDPNACNSKCVDGCFCPEGKIQD-RGKCVDPGQCSCYHSGIPYAHGAIRKSECSSCLCNGGMWNCTDTP---CSGTCTMVGNSHFTTFDSRSYSMHGQCDYVLSEHCHFSNDTTKQFTIHIKISSDGSRQLIVSLAGATPVTLGGVEGSPTVLNSNGKATS------HILSVEHIGVQNVLVHAYAGLTILW-TGYNAYITVGPDFKSQTCGLCGTFNQNDADDFHTRDGDNEADAYAFAQEWQVVSSVAASNCHRSN---WNQLDQPCSTYSSNEGYAKSGCNAIIDLNGPFKACHRYVPPQDM---YQKCVKDGCMCK-----DCLCSVAAAYAKACADKGIVIDGWRDTISVCKPKFVCPAGTVLKQCNRDPLTRKLRCPSTCDDL-ANVTDTCPSRRCVEGCYCEKEGELMNNEHKCVDKTQCPCYYGDTMYKYGEIRK-DRCNNCTCKGGVFDCTNVDCEAMCLTRGLVYSDCGITC 1238          

HSP 4 Score: 87.0409 bits (214), Expect = 5.378e-17
Identity = 111/409 (27.14%), Postives = 174/409 (42.54%), Query Frame = 3
Query: 1869 PSTCGIMGT-QFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEP--KIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKN------NLIGLCGKFDGNSENDFTEKDNS--IRESIVNIAKSYITGS-CDNTPQSIVDPPAG-----DNDICSTILNGPE---------FSGCMNSSKVD-KEFYAT----YCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNC 3002
            P  C I G   F TFD  +++F    C Y A+   ++N++ +  +F ++ +N ++          IN P  K V V V+G  + L     ++      V +DG   T  LP+T    NI   +    Y  V+ S    +YFDGS+ + IKV D+ K        L GLCG +DGN+ NDF   D +   +++I +   S +    C N P+    PP+G       D+ S + N  +         FS C   SKVD ++F A      C    +S  D +  C+ +   + AC      + +  +      C P+    G     CS  C   C  +N +  + C+  C  GC CP    +   G+CV   +C+C++   P       G      C +C+C  G  NC
Sbjct:  475 PGLCYISGRGHFTTFDHQEYSFYGT-CSYKAL---IDNSNVK-QIFQVVLNNDKN--------CDINAPCTKSVDVNVDGKKVHL---GQEVASRHGFVKVDGV--TENLPYTKSWPNI---RQAGKYVIVRTSDEVLIYFDGSEELMIKVPDSYKTVNSSDTRLKGLCGNYDGNNTNDFIGLDGTTYTKDNINDFGVSMLDDPLCTNPPK----PPSGCYSEVAGDVFSAMQNAEKMCSVIQSDAFSAC--RSKVDFRDFKAQCIADVCACNSTSRSDCM--CNVLSTYSKAC---AWNHNITLSWRSPSLC-PVTCPSGMEHSECSSACPRDCSNMN-SDPNACNSKCVDGCFCPEGKIQD-RGKCVDPGQCSCYHSGIP----YAHGAIRKSECSSCLCNGGMWNC 844          
BLAST of SCO-spondin vs. Ensembl Nematostella
Match: EDO41877 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S313])

HSP 1 Score: 183.726 bits (465), Expect = 5.978e-51
Identity = 113/342 (33.04%), Postives = 165/342 (48.25%), Query Frame = 3
Query: 3123 NSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTL-MDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGN--------NDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQ--GNVQGLCGNYDGDLQNEYMHGTMKYEDA-IQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWR 4112
            + C CP  +V    G C+  ++CPC +  + Y  +DVI   C    C    W    +    C A C A+GDPHYKT DG+++SFQG C Y +  D    S   +    I   NI CG +  TC K V + +      + RG         +   P+  +Y++V   L     ++    GL V+WDR TR+Y+ L P  Q    V GLCGN+DGD+ N+YM      E +   F +++ A  D C   + P   + P      C  N  R+S +   C ++K  +G F  C  ++  D       C+YD CGC+  GDCEC C ++A +A +C   G+ VKWR
Sbjct:   12 SGCVCPVGSVLDDFGRCILETECPCHHNGKSYKTDDVIRRDCNTCTCVRNTWECTKKR---CRATCTAFGDPHYKTFDGRLYSFQGGCNYVMSTDKCPGSKLTLQSFRIDAENIPCGSAGVTCTKSVTVTLHDTIIHMVRGKAVPSVTKVSSLSPVHARYELVYAGLYV---IIKAPFGLNVIWDRGTRLYIELSPDSQHWSKVCGLCGNFDGDMTNDYMAKNGITETSPYPFGDTWRARGD-CTKTMEP---IHP------CKQNKHRESKSHAACAIIK--SGTFKPCHISVDPDPYYERCRCVYDTCGCDSVGDCECTCEAIAAYAYECLAAGVVVKWR 335          

HSP 2 Score: 83.1889 bits (204), Expect = 9.031e-17
Identity = 73/263 (27.76%), Postives = 113/263 (42.97%), Query Frame = 3
Query: 1701 CICGSGEV--EYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKN--NLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY-ITGSCDNTPQSI 2471
            C+C  G V  ++G  CI    CPC ++G+ +    V + DCNTCTC  + W CT+K C +TC   G   + TFDG  ++F   GC YV       +TD      + +QS           SA +   K VTV ++  D I+     +   S            TK+    P    +      +Y  +K      + +D    +YI++S   ++   + GLCG FDG+  ND+  K+     S      ++   G C  T + I
Sbjct:   14 CVCPVGSVLDDFG-RCILETECPCHHNGKSYKTDDVIRRDCNTCTCVRNTWECTKKRCRATCTAFGDPHYKTFDGRLYSFQG-GCNYVM------STDKCPGSKLTLQSFRIDAENIPCGSAGVTCTKSVTVTLH--DTIIHMVRGKAVPS-----------VTKVSSLSPVHARYELVYAGLYVIIKAPFGLNVIWDRGTRLYIELSPDSQHWSKVCGLCGNFDGDMTNDYMAKNGITETSPYPFGDTWRARGDCTKTMEPI 255          

HSP 3 Score: 50.8322 bits (120), Expect = 2.712e-6
Identity = 31/87 (35.63%), Postives = 45/87 (51.72%), Query Frame = 3
Query: 4221 CSTTHCVEGCSCPNG-MIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTP---SQFRCDDGK 4469
            C    C  GC CP G ++D  G C+  T CPC +NG+SY    +I+  +C  C CV+  + CT+    C  TCT      ++  DG+
Sbjct:    5 CGQVFCKSGCVCPVGSVLDDFGRCILETECPCHHNGKSYKTDDVIR-RDCNTCTCVRNTWECTK--KRCRATCTAFGDPHYKTFDGR 88          

HSP 4 Score: 50.447 bits (119), Expect = 3.854e-6
Identity = 64/286 (22.38%), Postives = 126/286 (44.06%), Query Frame = 3
Query:  768 TCHSYGLDYYRTFDNQLYTYQGRCSYILTAP----SDVSAVTWSINIVYENC-TSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXX-XXXXXGDVTGLCGXXXXXXXXXXXXXXXVAS-----FGNSFKGFG-CPDIANTLSTCKPDDQILANQQCSKIRLK---FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCT--HLSAYSDSCSDKGSCIQWRSD 1574
            TC ++G  +Y+TFD +LY++QG C+Y+++      S ++  ++ I+     C ++   C K + +   D ++       + +    + L+P+   +    L+  G  +YV+ +  F         + + WD    ++I +  +S +   V GLCGN D + +ND+   + +       FG++++  G C      +  CK +    +    +   +K   F  C   V+ D Y+  C        +    T    S+ D  CT   ++AY+  C   G  ++WR D
Sbjct:   73 TCTAFGDPHYKTFDGRLYSFQGGCNYVMSTDKCPGSKLTLQSFRIDAENIPCGSAGVTCTKSVTVTLHDTIIHMVRGKAVPSVTKVSSLSPV---HARYELVYAG--LYVIIKAPF--------GLNVIWDRGTRLYIELSPDSQHWSKVCGLCGNFDGDMTNDYMAKNGITETSPYPFGDTWRARGDCTKTMEPIHPCKQNKHRESKSHAACAIIKSGTFKPCHISVDPDPYYERC--------RCVYDTCGCDSVGDCECTCEAIAAYAYECLAAGVVVKWRQD 337          
BLAST of SCO-spondin vs. Ensembl Nematostella
Match: EDO41876 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S312])

HSP 1 Score: 137.117 bits (344), Expect = 1.473e-34
Identity = 105/389 (26.99%), Postives = 175/389 (44.99%), Query Frame = 3
Query: 3312 AVCIAYGDPHYKTLDGQMFSFQGSCMYTLMD--TPGDSSNNIPPITISVAN-IACGFSLATCAKFVQIIIGGQTY-------LLS-----RGNNDTIPL-FPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMK--YEDAIQFAESFIANA--DIC--PYEISPENNVAPSKEQDMC-NANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTE 4409
              C  +G  HY+T DG+   F G C YTL     PG         ++ V N   CG +   C + + + IG +TY       L+S     R N   +   +   ++ + ++  +T + S    L + +D ++ + + +   ++ N  GLCGN +G   ++ +            +FAES+      + C  P E++          +D+C NA+   +  A+++C V+   N  F++C   +  D   +   C  D C C  G    C C +L  ++  CA   I + WR+Q+LCP  C   K Y  C   C +TCD  G     H     C++GC CP G +  +  C+P   CPC +NG +YV G  I++  C  C+C    + C++
Sbjct:    2 GACSTWGQRHYRTFDGRHIDFIGKCSYTLAQDCIPGSDQ-----FSLHVQNDKTCGSAGMDCERALLLYIGEKTYKVRWLVHLISSHGAIRVNGAKVSAPYKDTNVEVSKVHSYTIIRSQGDELGIKFDGASSIQVAVSHKYRNNTCGLCGNNNGIPDDDLLMAVTNKPATSVAEFAESWAMPEPNEKCESPLEVT----------RDVCSNASSVIRDAAKRICMVLLSEN--FSACHTKV--DPVPFVKRCEEDVCSCKFGEHSGCQCQALTEYSRACASREIMLDWRSQHLCPKQCIQPKVYSECGPACVKTCDADGLQPTCH---ETCIDGCHCPEGTVQTDNRCLPVNQCPCQHNGITYVTGTTIRV-GCNTCKCRGGSWTCSK 367          

HSP 2 Score: 82.8037 bits (203), Expect = 1.996e-16
Identity = 83/383 (21.67%), Postives = 157/383 (40.99%), Query Frame = 3
Query:  783 GLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTG--CVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXX------XXXXXXXXXXXXVASFGNSFKGFGCPD--------IANTLSTCKPDDQIL--ANQQCSKIRLK--FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICP 1871
            G  +YRTFD +   + G+CSY L       +  +S+++  +      G  C + +++  G+   K     +++   S+  +    V     +     T + V +  ++ ++  +   + +K+D  ++I +++ +     +  GLCGN +         +       +VA F  S+     P+        +  T   C     ++  A ++   + L   F  C   V+   +   C +++C+              S   C  L+ YS +C+ +   + WRS  LC  QC   K++S+C   C  TC      P+  C  + +  C C  G V+    C+    CPC ++G  +  GT  +  CNTC C    W C++  CP
Sbjct:    8 GQRHYRTFDGRHIDFIGKCSYTLAQDCIPGSDQFSLHVQNDKTCGSAGMDCERALLLYIGEKTYKV--RWLVHLISSHGAI---RVNGAKVSAPYKDTNVEVSKVHSYTIIRSQGDELGIKFDGASSIQVAVSHKYR-NNTCGLCGNNNGIPDDDLLMAVTNKPATSVAEFAESW---AMPEPNEKCESPLEVTRDVCSNASSVIRDAAKRICMVLLSENFSACHTKVDPVPFVKRCEEDVCS--------CKFGEHSGCQCQALTEYSRACASREIMLDWRSQHLCPKQCIQPKVYSECGPACVKTCDADGLQPT--CHETCIDGCHCPEGTVQTDNRCLPVNQCPCQHNGITYVTGTTIRVGCNTCKCRGGSWTCSKHRCP 371          

HSP 3 Score: 58.151 bits (139), Expect = 1.869e-8
Identity = 74/315 (23.49%), Postives = 114/315 (36.19%), Query Frame = 3
Query: 2130 QLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEK-DNSIRESIVNIAKSYITGSCDNTPQSIVDPPAGDNDICS--------------TILNGPEFSGCMNSSKVDKEFYATYCRREQSS---NKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNC 3020
             L  S   + ++G     K+     D N+ V K+ +            + FDG+ SI + VS   +NN  GLCG  +G  ++D      N    S+   A+S+     +   +S   P     D+CS               +L    FS C   +KVD   +   C  +  S    +     C A+   + AC    I  +        + CI        V+  C   C  TC    +     C + C  GC CP    +T   +C+  ++C C +           GT I + C TC C  G   C +K  C
Sbjct:   78 HLISSHGAIRVNG----AKVSAPYKDTNVEVSKVHSYTIIRSQGDELGIKFDGASSIQVAVSHKYRNNTCGLCGNNNGIPDDDLLMAVTNKPATSVAEFAESWAMPEPNEKCES---PLEVTRDVCSNASSVIRDAAKRICMVLLSENFSAC--HTKVDPVPFVKRCEEDVCSCKFGEHSGCQCQALTEYSRACASREIMLDWRSQHLCPKQCIQ-----PKVYSECGPACVKTCDA--DGLQPTCHETCIDGCHCPEGTVQTDN-RCLPVNQCPCQH----NGITYVTGTTIRVGCNTCKCRGGSWTC-SKHRC 370          
BLAST of SCO-spondin vs. Ensembl Nematostella
Match: EDO33061 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST99])

HSP 1 Score: 100.908 bits (250), Expect = 8.492e-23
Identity = 70/281 (24.91%), Postives = 131/281 (46.62%), Query Frame = 3
Query: 3312 AVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPL----FPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDA-IQFAESFIANADICPYEISPENNVAPS----KEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLC 4127
             +C +YGDPHY+T DG+MF+F G+C Y L+      + ++   +    N A G + +        +I  Q  L+ + +   + L     P   + I++  F   L+S++ G++++WD  + + + +   ++GN  GLCGN++G   +++M    +Y  +  +F +S+     +  +   P    APS    +    C  +      A + C  +K     F++C   +    ++YY  C+ + C C       C C SL T+A  C  +G+ V W  +  C
Sbjct:   55 GICTSYGDPHYQTFDGRMFNFHGNCRYRLVADCRQGNFSVRLRSERHHNQAVGEAKSLVVHIGSTVIHLQRGLVVKVDRKEVQLPYQRLP--SLQIDRKNFMITLLSET-GVKIIWDGESYIEVHVSHRYRGNTCGLCGNFNGVPSDDFMMKNGRYARSDREFGKSW----SLGGHRRRPCLQRAPSPPIAEPISKCRRSALHHWRARKRCWPIKSQ---FSNCHPVV--KPHKYYKACISEVCKCLVK---RCECESLVTYARACRRMGVNVNWGRKKAC 320          

HSP 2 Score: 66.6254 bits (161), Expect = 2.316e-11
Identity = 65/297 (21.89%), Postives = 108/297 (36.36%), Query Frame = 3
Query:  756 ENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSD-TGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXX-----XXXXXXXXXXVASFGNSFKGFG-----------CPDIANTLSTCKPD--DQILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCET 1589
            E+   C SYG  +Y+TFD +++ + G C Y L A  D     +S+ +  E   +   G  K +V+  G  V+     G++   D      P               P   + + NF++  L    +K+ WD   +      +  Y G+  GLCGN +          +     +   FG S+   G            P IA  +S C+        A ++C  I+ +F  C  +V    Y+  C+  +C              +    C  L  Y+ +C   G  + W     C T
Sbjct:   52 EDMGICTSYGDPHYQTFDGRMFNFHGNCRYRLVA--DCRQGNFSVRLRSERHHNQAVGEAKSLVVHIGSTVIHLQ-RGLVVKVDRKEVQLPYQR-----------LPSLQIDRKNFMITLLSETGVKIIWD-GESYIEVHVSHRYRGNTCGLCGNFNGVPSDDFMMKNGRYARSDREFGKSWSLGGHRRRPCLQRAPSPPIAEPISKCRRSALHHWRARKRCWPIKSQFSNCHPVVKPHKYYKACISEVCK-----------CLVKRCECESLVTYARACRRMGVNVNWGRKKACGT 322          

HSP 3 Score: 57.7658 bits (138), Expect = 1.759e-8
Identity = 64/277 (23.10%), Postives = 101/277 (36.46%), Query Frame = 3
Query: 1896 QFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPF-TIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTP--QSIVDPPAGD---------------NDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGI 2672
             + TFDG  F F+   C+Y  V       D R   F +       +     ++  + E K + V +  + I L          Q  + +  +    +LP+  +P   I  +   N    +   +  K+ +DG   I + VS   + N  GLCG F+G   +DF  K+     S     KS+  G     P  Q    PP  +                  C  I +  +FS C    K  K + A  C  E      +   C +++  A ACRR G+
Sbjct:   64 HYQTFDGRMFNFHG-NCRYRLV------ADCRQGNFSV------RLRSERHHNQAVGEAKSLVVHIGSTVIHL----------QRGLVVKVDRKEVQLPYQRLPSLQIDRK---NFMITLLSETGVKIIWDGESYIEVHVSHRYRGNTCGLCGNFNGVPSDDFMMKNGRYARSDREFGKSWSLGGHRRRPCLQRAPSPPIAEPISKCRRSALHHWRARKRCWPIKS--QFSNCHPVVKPHKYYKA--CISEVCKCLVKRCECESLVTYARACRRMGV 310          
BLAST of SCO-spondin vs. Ensembl Nematostella
Match: EDO49498 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGB0])

HSP 1 Score: 95.1301 bits (235), Expect = 9.552e-20
Identity = 59/137 (43.07%), Postives = 77/137 (56.20%), Query Frame = 3
Query: 4431 TCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNC--NVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCG---CLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENC--KKCQMTEYKCNNSQICI 4820
            +CTP+QF C  G+CI     CD   DCS+  DE+ C    C   QF C SNG CI +  +CDG  +C D SDE +C    C P +  C   R CI+ K ICDG  DCG  D+SDE +C  + C    ++C+N+  CI
Sbjct:  124 SCTPAQFSCPSGRCIPLRWRCDGDGDCSDGADERGCPPKNCTDSQFSC-SNGQCISLAWRCDGDHDCADKSDERNCTGKTCKPFEFACANGRHCIQRKWICDGENDCG--DRSDEVDCGLESCGNDRWRCSNTSRCI 257          

HSP 2 Score: 86.6557 bits (213), Expect = 4.422e-17
Identity = 63/168 (37.50%), Postives = 84/168 (50.00%), Query Frame = 3
Query: 4377 QCVQAKFNCTEDYSDCI-------------TTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNC--NVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISC---GCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENC--KKCQMTEYKCNNSQICI 4820
            +C+   + C  DY DC+             T C+ S FRC +G+C     +CD   DC +  DEK C  + C   QF C S G CIP+  +CDG  +C D +DE  C    C   Q  C+  + CI     CDG++DC   DKSDE NC  K C+  E+ C N + CI
Sbjct:   55 KCIPLSWRCDGDY-DCLAPDLSDEANCSVATNCSASMFRCANGQCKPRDWVCDGFDDCGDGSDEKGCANHSCTPAQFSCPS-GRCIPLRWRCDGDGDCSDGADERGCPPKNCTDSQFSCSNGQ-CISLAWRCDGDHDCA--DKSDERNCTGKTCKPFEFACANGRHCI 217          

HSP 3 Score: 65.855 bits (159), Expect = 1.199e-10
Identity = 72/245 (29.39%), Postives = 98/245 (40.00%), Query Frame = 3
Query: 4365 CKKCQCVQAKFNC-----------TEDYSDCI-TTCTPSQFRCDDG-KCIESSKICDKVTDC--SNSEDEKNCNV---CDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCG---CLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENC--KKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNC 5030
            CK   C+  ++ C            ++Y+ C   +C  S+FRC    KCI  S  CD   DC   +  DE NC+V   C    F+C +NG C P    CDG  +C D SDE  C    C P Q  C   R CI  +  CDG+ DC  +D +DE  C  K C  +++ C+N                                                   QCI+   +CDG +DC +  DE+NC
Sbjct:    8 CKNGHCISLRWKCDGENDCVDNSDEDEYAGCAEWSCRASEFRCQASRKCIPLSWRCDGDYDCLAPDLSDEANCSVATNCSASMFRC-ANGQCKPRDWVCDGFDDCGDGSDEKGCANHSCTPAQFSCPSGR-CIPLRWRCDGDGDC--SDGADERGCPPKNCTDSQFSCSNG--------------------------------------------------QCISLAWRCDGDHDCADKSDERNC 198          
BLAST of SCO-spondin vs. Ensembl Medaka
Match: scospondin (SCO-spondin [Source:NCBI gene;Acc:101172449])

HSP 1 Score: 380.563 bits (976), Expect = 1.469e-106
Identity = 280/937 (29.88%), Postives = 428/937 (45.68%), Query Frame = 3
Query: 2151 NVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPAGDNDICST-------------ILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLS-YCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCREL------NEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTN-PVCPKNQVY--MDSVSGCNSCTNYDTCTDTSSIA--------NSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFP--------KYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPE-NNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDV--NRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNC-------------TEDYSDCITTCTPSQFRCD--------------------DGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDC 4736
             V ++G   T  LP    D  +H  + ++ +  V+      L+        I +   L + + GLCG    +  +DFT  +  +  S+   A+ +I+       Q    P A  +D CST             +++ P F  C +   V+KE Y   C  E  +   Q S +C+ +   A  C + G+Q          Q   P+  +GG VF+ C RTC  +C +       N+++       C PGC+CP    +   GQCV  S C C    +   P    GT +  NC TCVC +G  NC T+++C +   CP + VY     +  C+S  ++     +SS+         + C CP  T    D  CV P +CPC +  + Y  N+ IT  C   +C  R W+        C+ VC+A GDPHY T DG+ +SF G C Y L      ++      +I+  N+ CG +  TC K V   +G     L RG   T+   P           + +E++  F  L S  +G+ ++WD   RVY+ L    +G V GLCGN+D D +N++      ++ +++       N+    +++SP   +V     QD C  NP R +WA++ C V+  T  +F+ C    H +V    YY  C++D CGC+ GGDCECLCT++A++A +C   G+ V+WR+Q LCP+ CE G  Y+ C   C Q+C ++  ++ S C    CVEGC CP G I     C+ P  CPC + G  +  G  I  + C+ C CV+  + C               +++     C PSQ+ CD                    +GKC+ SS +CD   DC  ++      VC    F C     CI    +CDG  +C D SDE  C C P +  C +   C+   ++CDG+ DC
Sbjct:  464 TVTVNGVRQT--LPVVSSDLAVH--RASSSFILVQTFGALVLWHLDGPFALIHLQPGLAHKVHGLCGTLTWSQHDDFTTPEGDVEMSVSAFAEKFIS-------QPCTLPKAAPSDPCSTYTQRISYAERVCSVIHNPVFQKCHDV--VEKEPYFRLCLSEVCACALQRSCHCTVLTAYAQHCAQEGVQVHW-----RNQTFCPVQCSGGQVFRECGRTCGFSCFDWQHGWLCNDSSGEIGQRVCVPGCQCPTGLVQDHLGQCVPVSLCPCVQDDKIYSP----GTILQNNCNTCVCKHGAFNC-TQEHCKSVQQCPGSLVYSPRSCMLTCSS-LDHQGQQQSSSVTKPSCREPLSGCVCPQGTFFHGD-RCVLPDECPCHHNGQVYYTNETITKDCNTCVCQKRRWHCTR---LVCDGVCVATGDPHYVTFDGRRYSFLGDCQYVL------ATETSGLFSITAENVPCGSTGVTCTKSVTFSLGSTIIHLLRGKAVTVNGMPVTLPKSYSGSGLTLEKVGLFVSL-SSRLGVTLMWDGGMRVYVHLAAHLRGQVGGLCGNFDEDTENDFT----THQGSVESTAEVFGNS----WKVSPSCPDVENQDLQDPC-LNPHRVTWAKKRCAVL--TQDLFSVC----HTEVPFQHYYDWCVFDTCGCDSGGDCECLCTAIASYAEECNRRGVYVRWRSQELCPLQCEKGMIYEPCGPACSQSCPSVQQHSYSRCEVLSCVEGCFCPAGTIHHGDGCILPLDCPCEWEGSMFPPGTSI-TQRCQNCSCVEGLWQCEGVACPASSPPCLEAEFACATGRCIPSQWLCDNEDDCGDGSDEICPSTCSCANGKCLASSHVCDGRPDCGFADGSDEQGVC----FLCPGR-RCILYLHRCDGHDDCGDFSDERGCMCAPGEFQCPVG-NCVPAHRVCDGHRDC 1343          

HSP 2 Score: 161.384 bits (407), Expect = 5.003e-39
Identity = 134/485 (27.63%), Postives = 198/485 (40.82%), Query Frame = 3
Query: 3030 VCPKNQVYMDSVSGCN-SCTNYDTCTDTSSIAN-------SCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLF-LKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQ-FAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTC-----DTIGSNAPSHCSTTHCVEGCSCPNGMI-DLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTC 4436
            VCP+ QV+ D VS C  SC +       +++A         C CP        GTC++  DCPC +    Y P D I  +C   +C +  W    E    C   C   G     T D + +S QG          GD    +   T++V                             G   T+P+    D+ + + +    LV  + G  VLW       L  L+P     V GLCG       +++       E ++  FAE FI+     P         APS   D C+    R S+AE++C V+   N VF  C + + ++   Y+  CL + C C     C   CT L  +A  CA  G+ V WR Q  CP+ C GG+ +  C   C  +C       + +++        CV GC CP G++ D  G+CVP + CPC  + + Y  G I++  NC  C C    FNCT+++   +  C
Sbjct:  333 VCPRGQVFSDCVSSCPPSCASPHPPGPAATMAQCREECVGGCECPPGLFLH-QGTCLKAEDCPCFHRRLTYQPGDSIQQRCNTCVCRSGQWQCTGER---CAGQCTLVGALQVTTFDKKKYSLQG----------GDFLFQLLKCTVTV----------------------------NGVRQTLPVV-SSDLAVHRASSSFILV-QTFGALVLWHLDGPFALIHLQPGLAHKVHGLCGTLTWSQHDDFTTPEGDVEMSVSAFAEKFISQPCTLP-------KAAPS---DPCSTYTQRISYAERVCSVIH--NPVFQKCHDVVEKEP--YFRLCLSEVCACALQRSCH--CTVLTAYAQHCAQEGVQVHWRNQTFCPVQCSGGQVFRECGRTCGFSCFDWQHGWLCNDSSGEIGQRVCVPGCQCPTGLVQDHLGQCVPVSLCPCVQDDKIYSPGTILQ-NNCNTCVCKHGAFNCTQEHCKSVQQC 756          

HSP 3 Score: 139.813 bits (351), Expect = 1.734e-32
Identity = 132/495 (26.67%), Postives = 210/495 (42.42%), Query Frame = 3
Query: 1590 QCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGR---------CICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDI-ILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY-ITGSC-DNTPQSIVDPPAGDNDICS-----TILNGPEFSGCMNSSKVDKEFYATYCRREQ---SSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDD-DCFPGCECPPNYYKTGTGQCVSESECTC-WNPSRPKDPEIPAGTNITINCQTCVCINGRLNCK 3005
            QCPG+ ++S     C +TC +L        Q+S V +         C+C  G   +G  C+ P+ CPC ++GQ +        DCNTC C    WHCT  +C   C   G   + TFDG +++F    CQYV          + + +F I   N          S  +   K VT  +  + I +L+  +         V ++G   T  LP +     + + K+  ++  +       L +DG   +Y+ ++  L+  + GLCG FD ++ENDFT    S+  +      S+ ++ SC D   Q + DP    + +        +L    FS C   ++V  + Y  +C  +     S  D    C+AI + A  C R G+     +     Q   PL    G +++ C   C  +C  + + + S+C+   C  GC CP      G G C+   +C C W  S       P GT+IT  CQ C C+ G   C+
Sbjct:  755 QCPGSLVYS--PRSCMLTCSSLDHQGQQ--QSSSVTKPSCREPLSGCVCPQGTFFHGDRCVLPDECPCHHNGQVYYTNETITKDCNTCVCQKRRWHCTRLVCDGVCVATGDPHYVTFDGRRYSFLG-DCQYVLA-------TETSGLFSITAENVPC------GSTGVTCTKSVTFSLGSTIIHLLRGKA---------VTVNGMPVT--LPKSYSGSGLTLEKV-GLFVSLSSRLGVTLMWDGGMRVYVHLAAHLRGQVGGLCGNFDEDTENDFTTHQGSVESTAEVFGNSWKVSPSCPDVENQDLQDPCLNPHRVTWAKKRCAVLTQDLFSVCH--TEVPFQHYYDWCVFDTCGCDSGGDCECLCTAIASYAEECNRRGV-----YVRWRSQELCPLQCEKGMIYEPCGPACSQSCPSVQQHSYSRCEVLSCVEGCFCPAGTIHHGDG-CILPLDCPCEWEGSM-----FPPGTSITQRCQNCSCVEGLWQCE 1206          

HSP 4 Score: 111.694 bits (278), Expect = 7.175e-24
Identity = 101/384 (26.30%), Postives = 168/384 (43.75%), Query Frame = 3
Query:  768 TCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENC---TSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCG-----XXXXXXXXXXXXXXXVASFGNSFK-GFGCPDIAN--TLSTC-KPDDQILANQQCSKIRLK-FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQN-SKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPST 1877
             C + G  +Y TFD + Y++ G C Y+L   ++ S +    +I  EN    ++   C K +    G  ++      +L          P+++  + S     G+ + + +   F+ LS   G + L WD    +++ +   +  G V GLCG       ++  ++  S       FGNS+K    CPD+ N      C  P     A ++C+ +    F  C   V    Y+  CV + C          D     + LCT +++Y++ C+ +G  ++WRS  LC  QC    I+  C   C  +C ++ Q   + C+  S V  C C +G + +G  CI P  CPC ++G   PPGT     C  C+C   LW C    CP++
Sbjct:  855 VCVATGDPHYVTFDGRRYSFLGDCQYVLA--TETSGL---FSITAENVPCGSTGVTCTKSVTFSLGSTIIH-----LLRGKAVTVNGMPVTLPKSYS-----GSGLTLEKVGLFVSLSSRLG-VTLMWDGGMRVYVHLAAHLR-GQVGGLCGNFDEDTENDFTTHQGSVESTAEVFGNSWKVSPSCPDVENQDLQDPCLNPHRVTWAKKRCAVLTQDLFSVCHTEVPFQHYYDWCVFDTCG--------CDSGGDCECLCTAIASYAEECNRRGVYVRWRSQELCPLQCEKGMIYEPCGPACSQSCPSVQQHSYSRCEVLSCVEGCFCPAGTIHHGDGCILPLDCPCEWEGSMFPPGTSITQRCQNCSCVEGLWQCEGVACPAS 1213          

HSP 5 Score: 93.9745 bits (232), Expect = 1.470e-18
Identity = 77/260 (29.62%), Postives = 116/260 (44.62%), Query Frame = 3
Query: 1506 CTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLF----QTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMGT-QFDTFD-------GAKFAFNDVGC--------QYVAVEPSVNNTDDRANVFVIIQSNTESMLG-TEGNSAYINEPKIVTVKVNGSDIILKA------TSPQLGDSQTNVFIDGEDHTTKLPFTIP 2204
            C  L+ Y+  C+ +   I WR+ +LC   CP  +++SDC S CP +C +          A C+   VG C C  G   +  TC+K E CPC +    + PG   Q  CNTC C S  W CT + C   C ++G  Q  TFD       G  F F  + C        Q + V  S       ++ F+++Q+    +L   +G  A I+    +  KV+G    L        T+P+ GD + +V    E   ++ P T+P
Sbjct:  305 CDTLATYARECAQQHIIIMWRTPSLCGRVCPRGQVFSDCVSSCPPSCASPHPPGPAATMAQCREECVGGCECPPGLFLHQGTCLKAEDCPCFHRRLTYQPGDSIQQRCNTCVCRSGQWQCTGERCAGQCTLVGALQVTTFDKKKYSLQGGDFLFQLLKCTVTVNGVRQTLPVVSSDLAVHRASSSFILVQTFGALVLWHLDGPFALIHLQPGLAHKVHGLCGTLTWSQHDDFTTPE-GDVEMSVSAFAEKFISQ-PCTLP 562          

HSP 6 Score: 90.5077 bits (223), Expect = 1.724e-17
Identity = 98/391 (25.06%), Postives = 148/391 (37.85%), Query Frame = 3
Query: 3309 EAVCIAYGDPHYKTLDGQMFSFQGSCMYTL--MDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKY-----EDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGC----NRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTT---HCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCT 4439
               C  +  PH      Q  S  G C  T    + PG  ++++ PI    + +  G S       V  I              T+ LFP + I +  L  F   V   +G+R+ +D    VYL +        +GLCG Y+ + +   +  T+ +      DA +   S     D+                          +  AE +C  + +    F  C      D   Y   CLY  C        GG C+    +LAT+A +CA   I + WRT +LC  +C  G+ +  C S CP +C +     P+         CV GC CP G+    G C+    CPCF+   +Y  G  I+ + C  C C   ++ CT +   C   CT
Sbjct:  101 RGCCEGWAGPHCT----QGVSLYGRCFSTWNCEEFPGLHNSSLMPIEKCCSTLW-GLSWKNTWGLVHKI--------------TV-LFPLW-ISVHWLGDFV-FVESGLGVRLKFDLINTVYLTVTAEHLAATRGLCGVYNNNPEEASLTETVSWLQQDCSDAAELGHSCDIVEDL------------------------TLRRQAESVCHQLLENP--FTHC--HFRVDPAAYIDTCLYLYCSLPTRERDGGACD----TLATYARECAQQHIIIMWRTPSLCGRVCPRGQVFSDCVSSCPPSCASPHPPGPAATMAQCREECVGGCECPPGLFLHQGTCLKAEDCPCFHRRLTYQPGDSIQ-QRCNTCVCRSGQWQCTGER--CAGQCT 434          

HSP 7 Score: 79.337 bits (194), Expect = 4.604e-14
Identity = 73/305 (23.93%), Postives = 126/305 (41.31%), Query Frame = 3
Query: 1026 LSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXX-----XXXXXXXXXXVASFGNSFKGFGCPDIANTLSTCKPDDQI--------LANQQCSKIR-LKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGR------CICGSGEVE-YGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPST 1877
            ++V      L +  + + V R  +  +L    G + L W  +    +          V GLCG    +      + +     +V++F   F    C     TL    P D           A + CS I    F  C D+V  + YF +C+  +C  +   +            CT L+AY+  C+ +G  + WR+ T C  QC G +++ +C   C  +C +          + ++G+      C C +G V+ +   C+    CPC+ D + + PGT+ Q +CNTC C    ++CT++ C S 
Sbjct:  465 VTVNGVRQTLPVVSSDLAVHRASSSFILVQTFGALVL-WHLDGPFALIHLQPGLAHKVHGLCGTLTWSQHDDFTTPEGDVEMSVSAFAEKFISQPC-----TLPKAAPSDPCSTYTQRISYAERVCSVIHNPVFQKCHDVVEKEPYFRLCLSEVCACALQRS----------CHCTVLTAYAQHCAQEGVQVHWRNQTFCPVQCSGGQVFRECGRTCGFSCFDWQHGWLCNDSSGEIGQRVCVPGCQCPTGLVQDHLGQCVPVSLCPCVQDDKIYSPGTILQNNCNTCVCKHGAFNCTQEHCKSV 753          

HSP 8 Score: 61.2326 bits (147), Expect = 1.287e-8
Identity = 76/314 (24.20%), Postives = 121/314 (38.54%), Query Frame = 3
Query: 2109 ILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSEN-DFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRR---EQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELN----EATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTN 3026
            I K  S   G S  N +      T   P  I   ++H       +  V+     +L FD   ++Y+ V+        GLCG ++ N E    TE  + +++   + A+  +  SCD      +   A    +C  +L  P F+ C    +VD   Y   C        + +     C  +   A  C     Q  +         C  +C  G  VF  C  +C  +C   +     AT ++C ++C  GCECPP  +    G C+   +C C++      P    G +I   C TCVC +G+  C T + C  
Sbjct:  142 IEKCCSTLWGLSWKNTWGLVHKITVLFPLWI---SVH---WLGDFVFVESGLGVRLKFDLINTVYLTVTAEHLAATRGLCGVYNNNPEEASLTETVSWLQQDCSDAAE--LGHSCDIVEDLTLRRQA--ESVCHQLLENP-FTHCH--FRVDPAAYIDTCLYLYCSLPTRERDGGACDTLATYAREC----AQQHIIIMWRTPSLCGRVCPRG-QVFSDCVSSCPPSCASPHPPGPAATMAQCREECVGGCECPPGLF-LHQGTCLKAEDCPCFHRRLTYQP----GDSIQQRCNTCVCRSGQWQC-TGERCAG 431          
BLAST of SCO-spondin vs. Ensembl Medaka
Match: vwf (von Willebrand factor [Source:NCBI gene;Acc:101162365])

HSP 1 Score: 342.043 bits (876), Expect = 1.791e-94
Identity = 350/1309 (26.74%), Postives = 551/1309 (42.09%), Query Frame = 3
Query:  771 CHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVV-VKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPM--YVLRQDNF-ILLSLE-AGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVAS-----FGNSFKGFG----CPDIANTLSTC---KPDDQILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQ-WRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY-ITGSCDNTPQSIVDPPAGD-------NDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKD-QLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATAS-KCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKD------------------NCTNPVCPKNQVYMDSVSG------CNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTP--GDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIV--IEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYE-DAIQFAESFIAN---ADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGK-------------HYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCS--CPNGMI--DLNGECVPPTTCP-CFYNGQ--SYVNGAIIKMEN---CKKCQCVQAKFNCTEDYSDCITTCTPS 4445
            C  +G  +  TFD  LY + G CSY+L    D S  ++++   + N    TG    + +  GD   +  S +G L   +    L P +     S  +  G+ +  Y L  + F   ++++ A NI L    ++                GLCGN +   +++++  + + +     F NS+   G    C  ++N   +C   K  + IL++    K    F  CA LV  + +  +C    C  +Q          + D  C  L  Y+ +C   G  +  W  ++ C  +CP    +S+C   C  TC +L       C++  +  C C +G+V  G  C++   C C + G+  PPG+    DCNTC C    W CT + CP  C ++G + F +FD   F F    CQY+  +  VNN       F +I  N +            N+  + T  V  S   L+  + +L      V ++  D  T + +     ++H+++       +  S   +L +DG   + +K++        GLCG ++GN  +DF      +        +++ I G C++T +   DP A +        + C+ I++   FS C     V+   +  +CR +  +  D +   CSA+   A +C   G+   V + S +L  C   C +GG V++ C   C  TC  L+ A A  + +  C  GC CP   Y + +GQCV+   C C +  +   P      + +I    C C NG + C + +                     +  CP   V  +  SG        +C N D    + S    C CP DTV +    C+ P  CPC + NR YA    IT  C   +C NR W    +    C+ VC + G+ HY T DG  FSF G C Y L+     G+  +      + V N ACG     CAK V +   G   ++  G        P+   V  I    F+T L+   I L   WDR TR+ + +  +++G V GLCGN+DG++ N++M    + E D+  F  S+      AD+    +              C+ N  +    EQ C +M  +  +F  C   +  D   Y   C+  AC C   GDC C C  +A +A  C+  GI + WR+ +LCP+ CE                 Y+ C   CP TC       P  CS T CVE C   CP G +  ++   CV P+ C  C +NGQ  S+ N  I+  +N   CK C C     +C ED +      TP+
Sbjct:   27 CSLFGRYHVHTFDGVLYEFPGDCSYLLAG--DCSHRSFTLLGDFHN-GKRTG----VTLFLGDAFELHLSVDGFLSQREKRLTL-PYA-----SHAVFAGSELGFYKLWSEEFGFTVTIDNAANIALTLSKHHA-----------NRTCGLCGNFNAVTADEYTAQEGLLTEDSYDFANSWAVKGADQSCRRVSNPSKSCNSTKGTEAILSSCSVLKTSGVFLHCAHLVPPEAFLLLCQAEACHCNQRD--------VEDCYCPILLEYARTCHAHGILLHGWLEESKCYPKCPIGMQYSECTKSCSTTCHSL--NIQEVCKDECMDGCTCPAGKVLDGNRCVEVSECSCTHMGRHFPPGSTVSQDCNTCVCRHGSWECTNEGCPGECLVVGQSHFKSFDNKFFTFTG-DCQYLLAKDCVNNE------FSVIIENVQ---------CADNQDAVCTRSVTLSLPSLENMTVKLKHGGV-VSVNNMDIQTPMHY----GHLHIQRAVQSSVRLVFSDDLRLDWDGQGRVLLKLTARWTGQTCGLCGNYNGNQGDDFMSDSGLVETKPQAFGQAWKINGDCESTHKYDPDPCAINPKRVRFAEEACAVIMSD-VFSPC--HILVNPSPFQRFCRYDVCACGDGEKCLCSALAAYAASCSAKGVL--VNWRSALL--CELEC-SGGQVYEACGTVCDRTCLSLSGAEAGCEGEKVCEEGCFCPVGKYLSPSGQCVTADLCPCLHDGQLYQPNDVYADHTSI----CYCENGSMRCSSSEVPSLLSDLFYDEDLGSTRERRSAHCPPPLVRTECGSGKKGLECARTCQNLDLPCVSLSCIPGCLCPPDTV-RHRRDCIAPEQCPCYHNNRPYAAGQTITTDCNTCVCENRKWRCTQKL---CDGVCRSVGEGHYITFDGLKFSFPGLCQYVLVQDMCLGEEGS----FRVLVENEACGIVGRRCAKAVTVFYQGGLIVMQHGEVTMKKPVPQSSQVEIIRSGQFYTLLLGKHISLS--WDRGTRLLVHISAAYRGRVCGLCGNFDGNVNNDFMSSNNQLEVDSSHFGNSWKVIPSCADVTQIPLP-------------CSDNIMKLVTVEQSCRLM--SGPLFKECNTQV--DAEPYVEMCVEAACSCPSVGDCACFCDVVAAYAQACSERGISISWRSNDLCPMSCEELNPKISGVGEELCQWRYNTCGPACPITCQ---HPEPLQCSFT-CVEACHAYCPPGQLLDEVAMRCVNPSQCQMCVHNGQRISHGNKVILNHDNPALCKICHCENNSLSC-EDCTSLSMLSTPT 1236          

HSP 2 Score: 107.071 bits (266), Expect = 1.720e-22
Identity = 110/417 (26.38%), Postives = 172/417 (41.25%), Query Frame = 3
Query: 3297 TANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVAN-IACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEY-MHGTMKYEDAIQFAESF-IANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVK-WRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTED--YSDCITTCTPSQFRCDDGKCIESSKICDKV--TDCSNSE 4523
             A     C  +G  H  T DG ++ F G C Y L    GD S+    +     N    G +L     F ++ +    +L  R    T+P          +L F+ +L S+  G  V  D +  + L L         GLCGN++    +EY     +  ED+  FA S+ +  AD     +S      PSK    CN+    ++     C V+K T+GVF  C   +  +   +   C  +AC CN+    +C C  L  +A  C   GI +  W  ++ C   C  G  Y  C   C  TC ++  N    C    C++GC+CP G +     CV  + C C + G+ +  G+ +  ++C  C C    + CT +    +C+     S F+  D K    +  C  +   DC N+E
Sbjct:   20 VAGVTGRCSLFGRYHVHTFDGVLYEFPGDCSYLLA---GDCSHRSFTLLGDFHNGKRTGVTLFLGDAF-ELHLSVDGFLSQREKRLTLPYASHAVFAGSELGFY-KLWSEEFGFTVTIDNAANIALTLSKHHANRTCGLCGNFNAVTADEYTAQEGLLTEDSYDFANSWAVKGADQSCRRVS-----NPSKS---CNSTKGTEAILSS-CSVLK-TSGVFLHCAHLVPPEA--FLLLCQAEACHCNQRDVEDCYCPILLEYARTCHAHGILLHGWLEESKCYPKCPIGMQYSECTKSCSTTCHSL--NIQEVCK-DECMDGCTCPAGKVLDGNRCVEVSECSCTHMGRHFPPGSTVS-QDCNTCVCRHGSWECTNEGCPGECLVV-GQSHFKSFDNKFFTFTGDCQYLLAKDCVNNE 414          

HSP 3 Score: 71.2478 bits (173), Expect = 1.084e-11
Identity = 88/367 (23.98%), Postives = 148/367 (40.33%), Query Frame = 3
Query:  768 TCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVI-EAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIP-GTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCG-----XXXXXXXXXXXXXXXVASFGNSFKGF-GCPDIANTLSTCKPD--DQILANQQCSKIRLK-FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISD--VLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCP---------GNKI----WSDCASECPVTCRNLFQTPSAY-CQNSKVGRCICGSGEVEYGYTCIKPESCP-CLYDGQE 1784
             C S G  +Y TFD   +++ G C Y+L               V + C  + G  +V+V  EA  +V +     +  T      L  +          +P  + + ++R   F  L L   +I L WD      +   ++ Y G V GLCG       ++  S++     + + FGNS+K    C D+      C  +    +   Q C  +    F  C   V+++ Y  MCV+  C+           PS+ D    C  ++AY+ +CS++G  I WRS+ LC   C          G ++    ++ C   CP+TC++      ++ C  +    C  G    E    C+ P  C  C+++GQ 
Sbjct:  857 VCRSVGEGHYITFDGLKFSFPGLCQYVL---------------VQDMCLGEEGSFRVLVENEACGIVGRRCAKAV--TVFYQGGLIVMQHGEVTMKKPVPQSSQVEIIRSGQFYTLLL-GKHISLSWD-RGTRLLVHISAAYRGRVCGLCGNFDGNVNNDFMSSNNQLEVDSSHFGNSWKVIPSCADVTQIPLPCSDNIMKLVTVEQSCRLMSGPLFKECNTQVDAEPYVEMCVEAACS----------CPSVGDCACFCDVVAAYAQACSERGISISWRSNDLCPMSCEELNPKISGVGEELCQWRYNTCGPACPITCQHPEPLQCSFTCVEACHAYCPPGQLLDEVAMRCVNPSQCQMCVHNGQR 1194          

HSP 4 Score: 63.929 bits (154), Expect = 2.147e-9
Identity = 98/438 (22.37%), Postives = 170/438 (38.81%), Query Frame = 3
Query: 3222 PNDVITIKCAKY--------ICSNRMWNLLSEETANCE----AVCIAYGDPHYKTLDGQMFSF--QGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLA---TCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLF--------LKPSFQGNV-----QGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHC--------VEGCSCPNGMIDLNGECVPPTTC-PCF-YNGQSYVN-GAIIKMEN-CKKCQCV-QAKFNCT 4406
            P+  +T++  K          C N M  +  ++T +C      +C+     H    D        +G C YTL+    DS        + +    C  + +    C K +++  G    +L    +D   +  + ++ +    +  +L+    G  +L  +S + Y+            +FQG+       GLCG    +  N     +++   +     +FI++     +  + E+ V   K Q +C       S A   C  +     VF  C   +   V  + + C   AC  +        C  ++ +A  C   G+ V WR+ +LCP+ C     YDAC + C + CD+I +  PS  S             EGC C  G +  +G CV P  C  C   +G +Y +  + +  EN C  C C+ Q + NCT
Sbjct: 1924 PSGAVTVQSHKVSCDKLEPPACRNNMAPVKVQDTCSCHWECPCMCMGSSTNHVVRFDSLALRLDGEGLCSYTLLTVNSDSGEGS---EVKLHTGPCQETTSYNQICMKAMEVTHGPHKLIL---RDDMRAMIDREELALPWRFYGMELMR--YGGVMLQLKSNQGYMLTFTPQSNEFTITFQGSTNSAQTAGLCGACGEEKVNIL---SLRNGSSTTNQPAFISD-----WTAAGEDGVCLPKRQSVC------LSGAAMGCQALHSE--VFLPCHAFI--PVQIFLTKCEEQACEESDA------CEVISAYARLCRQRGVCVDWRSPHLCPLKCPSSMEYDACRTGCVEDCDSIQA-LPSDWSVARSNESCMDTPTEGCFCAGGTVLHHGRCVSPEACGQCVDQHGHTYTHMQSWVPDENPCLICMCLDQQRINCT 2328          

HSP 5 Score: 55.4546 bits (132), Expect = 6.469e-7
Identity = 30/102 (29.41%), Postives = 46/102 (45.10%), Query Frame = 3
Query: 1506 CTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAY--------CQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEH 1787
            C  +SAY+  C  +G C+ WRS  LC  +CP +  +  C + C   C ++   PS +        C ++    C C  G V +   C+ PE+C    D   H
Sbjct: 2198 CEVISAYARLCRQRGVCVDWRSPHLCPLKCPSSMEYDACRTGCVEDCDSIQALPSDWSVARSNESCMDTPTEGCFCAGGTVLHHGRCVSPEACGQCVDQHGH 2299          
BLAST of SCO-spondin vs. Ensembl Medaka
Match: otog (otogelin [Source:NCBI gene;Acc:101158818])

HSP 1 Score: 287.345 bits (734), Expect = 1.716e-77
Identity = 243/890 (27.30%), Postives = 405/890 (45.51%), Query Frame = 3
Query: 1593 CPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVG---RCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMGTQF-DTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSK-SIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGS-------------CDNTPQSIVDPPAGDNDICSTILNGPEFSGC---MNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPP-NYYKTGTGQCVSESECTCWNPSRPKDP-EIPAGTNITINCQTCVCINGRLNCKTKDN-CTNPVCPKNQVYMDSVSG---------------CNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIP-----LFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHG-TMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLC 4127
            CP    + +C S CP TC +L +T    C +S++     C C  G +     C++   CPC + G  +P G + Q +CN CTC   +W+CT+  CP  C + G  F  +FDG  F F    CQYV V+  ++         V IQ+   +  G + + A I    +V  +   +++ L      +G+    VF+ G+ +   LP+   D   H+++L++++ +V+ +   +L +  ++  +Y++  +  K++ +GLCG F+GN ++DF      I  +      S+   S             CD+  Q++    +  + +C  +LN   F+ C   ++ +   ++  A  CR            CS + + A  CR+F +   V F S+I   C   C A    +  C  +CQ  C  L  A   +C ++C  GC CP  ++Y   T  CV  S+C C       +P ++PA        Q    + G L C          +CP  Q+Y +   G               C S      C+   S  + C CP+  +   D  C +P+ CPC++  +EY P D ++  C +  C +  +         C ++C AYGD HY+T DG +F + G+C   L+ +  D+       +++  N+ C  +   C K++ I +G    LLS  ++   P     +     + I Q   FT +      + VLWD  T V++ + P +QG + GLCGN+D    NE      M      +F  S+ A   +   +I           +  C+ NP R+ +A+  C V+   + VF +C   +  DV+ +Y NCL D C C+RGGDCEC C+S+A +A +C   G+PV WR+ +LC
Sbjct:  413 CPAGLQYRECISCCPATC-SLERT----CIDSRLACLDGCYCPDGLIFQDGGCVEASDCPCEHHGVFYPAGQMLQEECNNCTCVGGVWNCTDHSCPGECSVTGDMFFQSFDGRIFTF-PASCQYVLVKSRLS-----GKFTVTIQN---APCGPDLDGACIQSVSLVVDEDPRTEMTLS----HMGE----VFMAGQ-YRISLPYY--DDVFHIQELSSMFLQVRTAFGLQLQYSWAEFRLYLQAEERWKDDTVGLCGTFNGNIQDDFLSPSGMIESTPQLFGNSWKVSSACSSSLSVSPIDPCDSHQQAV----SYASSMCD-VLNQDLFAACHDYLSPAPFHQQCRANTCR------CGTPCLCSTLAHYARHCRKFSVI--VDFRSHIPD-CAVSCPAT-MEYSSCVSSCQRRCSSL--AALQRCGEECEEGCACPQGSFYNHRTHTCVHRSQCPCSLFGADYEPGDLPA--------QLSWSLTGFLKCSGFSFFLPERLCPAGQLYQNCSDGDDAFLPGRGVACERTCESHLLNIPCSSHDSCVSGCVCPHGLLKHGD-ECFEPAACPCLWKGKEYFPGDRVSSPCYQCACQDGTFQCAFRP---CPSMCTAYGDRHYRTFDGLLFDYVGACKVYLVKSSADAV-----FSVTAENVDCFDTGVICKKYLLINVGAS--LLSLDDHMGKPNPSSVIDRNQRLFIWQAGLFTVVHFPEEDITVLWDHKTTVHVQVGPHWQGRLSGLCGNFDLKTVNEMRTPENMDSPTPQEFGNSWTATECVNSPDI-----------RHPCSLNPLREPYAKHQCAVL--LSEVFQTCHPVV--DVSWFYENCLADTCACSRGGDCECFCSSVAAYAQRCCHEGVPVDWRSPSLC 1226          

HSP 2 Score: 129.798 bits (325), Expect = 2.041e-29
Identity = 115/463 (24.84%), Postives = 204/463 (44.06%), Query Frame = 3
Query: 3027 PVCPKNQVYMDSVSGC-NSCTNYDTCTDTS-SIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSL-ATCAKFVQIIIG------------GQTYLLSRGNNDTIPLFPKYDIV--IEQLTFFTQLVSDSIGLRVLWDRST-RVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQ-FAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNL-CPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMI--DLNGECVPPTTCPCFYNGQSYVNGAI 4349
            P CP    Y + +S C  +C+   TC D+  +  + C CP+  + + DG CV+ SDCPC +    Y    ++  +C    C   +WN       +C   C   GD  +++ DG++F+F  SC Y L+ +           T+++ N  CG  L   C + V +++             G+ ++  +         P YD V  I++L+     V  + GL++ +  +  R+YL  +  ++ +  GLCG ++G++Q++++  +   E   Q F  S+  ++          ++       D C+++    S+A  MC V+     +FA+C + +      ++  C  + C C       CLC++LA +A  C    + V +R+    C + C     Y +C S C + C ++   A   C    C EGC+CP G         CV  + CPC   G  Y  G +
Sbjct:  411 PPCPAGLQYRECISCCPATCSLERTCIDSRLACLDGCYCPDGLIFQ-DGGCVEASDCPCEHHGVFYPAGQMLQEECNNCTCVGGVWNCTDH---SCPGECSVTGDMFFQSFDGRIFTFPASCQYVLVKSRLSGK-----FTVTIQNAPCGPDLDGACIQSVSLVVDEDPRTEMTLSHMGEVFMAGQYRIS----LPYYDDVFHIQELSSMFLQVRTAFGLQLQYSWAEFRLYLQAEERWKDDTVGLCGTFNGNIQDDFLSPSGMIESTPQLFGNSWKVSSA--------CSSSLSVSPIDPCDSHQQAVSYASSMCDVLN--QDLFAACHDYL--SPAPFHQQCRANTCRCGT----PCLCSTLAHYARHCRKFSVIVDFRSHIPDCAVSCPATMEYSSCVSSCQRRCSSLA--ALQRCGE-ECEEGCACPQGSFYNHRTHTCVHRSQCPCSLFGADYEPGDL 841          

HSP 3 Score: 97.4413 bits (241), Expect = 1.333e-19
Identity = 96/383 (25.07%), Postives = 161/383 (42.04%), Query Frame = 3
Query: 3309 EAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVAN-IACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIP------LFPKYDIVIEQLTFFTQLVSDSIGLRVLWD-RSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYM--HGTMKYEDAIQFAESFIANADICPYEISPENNVAP---SKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASC---IEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTE 4409
            E  C  +G  +++T DG  + F G C YTL+       ++I      V N   C  +  TC + V I +  +  +    +N T            + + +EQ++ +  LV+   G  + W+ R+  VY+ L P F G   GLCGN++ ++Q++    +G + + D   F  S++        E+ P  N  P   S         P      E++C ++   +  F SC   +  +    + Y+    Y                    F   C F    +    +++ P  C  G  Y  C S CP TC    +   S  +   C++GC CP+G+I  +G CV  + CPC ++G  Y  G +++ E C  C CV   +NCT+
Sbjct:  158 EMTCRTWGQYNFETFDGLYYYFPGRCSYTLLK-----DSHISFFVFKVHNDPECSSAPYTCQRSVSIFLPWEGEIRLHASNVTFKGRRLQLPHHLHHLQLEQISQYV-LVTQQQGFTLAWEGRTGSVYIKLSPDFVGGTCGLCGNFNAEVQDDMTTSYGLLTH-DVEMFGNSWM--------EMDPHQNTCPPVGSSFPSPYRPFPVSVQRVEEVCSML--LSPPFQSCHDFVSPLPYMASYYWKKDYYR------------------IFFGTCFFCDASLFLPPRSVPP--CPAGLQYRECISCCPATCSLERTCIDSRLA---CLDGCYCPDGLIFQDGGCVEASDCPCEHHGVFYPAGQMLQ-EECNNCTCVGGVWNCTD 499          

HSP 4 Score: 64.6994 bits (156), Expect = 9.851e-10
Identity = 74/283 (26.15%), Postives = 120/283 (42.40%), Query Frame = 3
Query:  771 CHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCT-SDTG--CVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVAS-----FGNSFKGFGC---PDIANTLSTCKPDDQILANQQCSKIRLK-FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLC 1583
            C +YG  +YRTFD  L+ Y G C   L   S   AV    ++  EN    DTG  C K ++I          G  +L   D      P SV + +  L       ++ +   F ++     +I + WD +           + G ++GLCGN D    N+    +N+ S     FGNS+    C   PDI +  S   P  +  A  QC+ +  + F  C  +V+   ++  C+ + C  S+  +         +  C+ ++AY+  C  +G  + WRS +LC
Sbjct:  973 CTAYGDRHYRTFDGLLFDYVGACKVYLVK-SSADAV---FSVTAENVDCFDTGVICKKYLLINV--------GASLLSLDDHMGKPNPSSVIDRNQRL-------FIWQAGLFTVVHFPEEDITVLWD-HKTTVHVQVGPHWQGRLSGLCGNFDLKTVNEMRTPENMDSPTPQEFGNSWTATECVNSPDIRHPCSL-NPLREPYAKHQCAVLLSEVFQTCHPVVDVSWFYENCLADTCACSRGGD--------CECFCSSVAAYAQRCCHEGVPVDWRSPSLC 1226          

HSP 5 Score: 55.8398 bits (133), Expect = 5.813e-7
Identity = 88/375 (23.47%), Postives = 145/375 (38.67%), Query Frame = 3
Query: 3303 NCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDS---------SNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGD------LQNEYMHGTMKYEDAIQFAESF-IANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDV--NRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPC-PQTCDTIGSNA-PSHCSTTHCVEGCSCPNGMI---DLNGECVPPTTCPCFYN-GQSYVNGAIIK 4355
            +C   C  + D +  T DG   +   + +Y +   P ++         +++   +  +  N+ C  SL    +   ++I      L          F KY   I   T    L+    GL++ W  ST + + ++   +    GLCG  DGD      L N  + G    ED   F +S+ ++N           + ++ S+ +D+  +  D  +     C  M + N  F +C    H  V  + +    + D+   N        C +LA +   C    I ++WR  N CP +C     Y AC   C  Q+C     +A P  CS     EGC CP G +     +  C+PP  C C  + G    NG + K
Sbjct: 2114 DCPCRCSMFPDLNVITFDGNSVAIYKAALYIVTQLPNETVTVMVQECPADSESLLLWNFTNL-CLVSLNITHQSNHVLINRLQRRLYVNTRYAKARFKKYGFEIYD-TGNMYLIRSPAGLKLQWYHSTGM-MVIETDSKVPTMGLCGVCDGDPTDDLTLPNGSVLGAG--EDPALFIDSWQVSNTT---------SYISQSRRRDLNCSTSDCST-----CLSMLE-NATFTAC----HAFVPPSTFCEVWVRDSEYVNNQ------CVALAAYVASCHKFNICIEWRRPNYCPFICAATLRYQACLPACTSQSCPNHDFDADPEQCSGL--TEGCVCPEGTLLHRQYSALCIPPEKCACTDSAGVPRANGEVWK 2456          

HSP 6 Score: 55.0694 bits (131), Expect = 1.012e-6
Identity = 44/147 (29.93%), Postives = 62/147 (42.18%), Query Frame = 3
Query: 4134 MCEGGKHYDACAS-----------PCPQTCDTIGSNAP--SHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTP---SQFRCDDGKCIESSKICDKVTDCSNSED 4526
            +C  G+ Y  C+             C +TC++   N P  SH S   CV GC CP+G++    EC  P  CPC + G+ Y  G  +    C +C C    F C   +  C + CT      +R  DG   +    C KV    +S D
Sbjct:  866 LCPAGQLYQNCSDGDDAFLPGRGVACERTCESHLLNIPCSSHDS---CVSGCVCPHGLLKHGDECFEPAACPCLWKGKEYFPGDRVS-SPCYQCACQDGTFQCA--FRPCPSMCTAYGDRHYRTFDGLLFDYVGAC-KVYLVKSSAD 1005          
BLAST of SCO-spondin vs. Ensembl Medaka
Match: FCGBP (Fc fragment of IgG binding protein [Source:NCBI gene;Acc:101155957])

HSP 1 Score: 234.958 bits (598), Expect = 1.836e-61
Identity = 302/1279 (23.61%), Postives = 495/1279 (38.70%), Query Frame = 3
Query:  759 NFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCG-----XXXXXXXXXXXXXXXVASFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRL---------KFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKG-SCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPS--AYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEH-------PPG--------------TVRQFDCN---TCTCNSSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTE--SMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLY--FDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITG----------------SCDNTPQSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQ-SSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDP-EIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTC-VQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIP-----LFPKYDIVIEQLTFF----TQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMK-YEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNAN------PDRKSWAEQMC--GVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVK-WRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNG 4343
            +++TC + G  +Y TFDN+ Y +QG C Y L A            ++ +N       V    +    V +K     IL     N+ L  L V+  +  + +  +  + +   +F L       +   W +   + +  +     G V GLCG       D+    + +       FG S++    P          P   I    Q  K  L          F  C   V+   +F  CV ++C                DVLC  ++AY+ +C   G +   WR+   C  +CP +  +  CAS CP +C  L   P   A+C+      C C  G +  G  C+    C CLY+   +       P G              T ++F C     C   + +  C   +    C   G   + +FDG KF F    C YV +  S    D     F +   N +   M G +     ++  ++V V+V G  +I+K+           V ++G      +P  + D  + V +    Y    ++++F L   +D    + + V    ++ + GLCG F+G+ ++DF   D  + + I    KS+                    CD   + +   PA     C  IL  P+    +  SK+D + Y   C  +  +SN D    C ++   A  C   G+      T +      P+     + +++C+ TC  +C  L++    +C + C  GC C   +   G   CV E+EC C++  +   P E+    + ++ C          N  T   C    CP++   M    G   C N D C D +              ++  TC V+  +  CI                 KY                  + C A+GDPHY T DG  F FQG+C Y +  T G+  N + P +I+  N   G +  +  + V + I      + +     +      L   + +   +++ F    + +V    GL V +D +  + + L  S+  +V GLCGN++GD  +E  + + K     I++ +S         ++   ++   P    D C  N       +R+ +  Q    G+   TN VF  C   +  D   + +NC+YD C  N+ GD   LC +L ++  QC   GI +K WR +  CP+ C+   HY+ CASPC  +C          CS   CVE C C  G +   G C+P  TC C Y G+ Y  G
Sbjct:  436 SYSTCKATGDPHYVTFDNKKYDFQGTCVYQLAALCSKDTELTPFEVLVQNEHRGRNVVSYTKL----VQIKVYSLNIL-----NDQLVNLPVSLVEGKVSVYKSGWFAVVTTDFGL------KVSFNWHSAAFVTLPSNYM---GAVCGLCGNYNGNMQDDLTPKNGNTPVKPTDFGTSWRVAEIPGCIEGCQGVCPSCDITQKVQYEKEDLCGIIRDTKGPFRDCHAKVDPAGFFEDCVYDVCMYEGRK----------DVLCQAVTAYTSACQGVGVNVYSWRTSNFCAVKCPIHSHYDICASACPASCEGLAPPPGCRAHCEEG----CSCDEGYILSGDQCVPFSQCGCLYNDLYYRINEVFYPNGQCEEECKCTQDGEVTCKKFKCGPNEKCKIENGIQKC-HPVGKGVCRASGDPHYTSFDGQKFDFQGT-CTYV-LSKSCGVEDTHLEAFSVQVENVQWDRMKGKKK----VSVTRLVAVEVFGFTLIMKS-------KMFGVLVNGV--LNNIPLNLNDGEVQVYQEGTNYL---IATNFGLLVTYDLVYHVTVTVPGNYRDKVCGLCGNFNGDRKDDFQMPDQILAKDINVFGKSWKVAIPNVVCENGCQGNECADCDPAHKDVFSKPA----YCG-ILTAPKGPFAVCHSKLDPQSYFDDCVFDVCASNGDGKVLCDSVAAYAYNCHMAGVNVNDWRTPSFC----PMKCPANSHYEVCAETCTYSCPGLSDMV--QCPEACTEGCVCDAGFLYDGQ-TCVKETECGCYDRGKTYKPGEVTYEEDCSLACS--------CNPATGLICEEYSCPEDTQCMIK-KGVKECYNKDPCKDANC-------------RVQETCRVEGGEAVCI----------------PKYT-----------------STCWAWGDPHYHTFDGFDFDFQGTCKYIISKTCGN-LNGLVPFSITERNDNRGNAAVSFVREVDVFIYDYNITIRKNQVGQVTVNGELLNLPFQLGDNEVSVFQSGSSAVVETKFGLIVSYDWNWHLVIKLPSSYYSSVCGLCGNFNGDTGDELQNPSGKAVASVIEWGKS---------WQTPDQDKGHPC--WDTCEKNCPTCDDDERELYKTQAFCGGLAAKTNSVFKICNSKL--DPQAFMNNCVYDMC-LNK-GDKRMLCQALTSYNKQCRDEGIIIKDWRKEFNCPMNCQRFSHYEHCASPCQPSCPF--PEQKQTCSGA-CVEACVCDEGYVLSAGVCIPAKTCGCSYQGRYYTPG 1577          

HSP 2 Score: 162.155 bits (409), Expect = 2.669e-39
Identity = 126/444 (28.38%), Postives = 188/444 (42.34%), Query Frame = 3
Query: 3165 GTCVQPSDCPCIYMNREYAPNDVI-----------------TIKCAKYICSNRMWNLLSEETANCE----AVCIAYGDPHYKTLDGQMFSFQGSCMYTLM----DTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGN----NDTIPLFP--KYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGD-LQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKS---WAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVK-WRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMEN--CKKCQC 4382
            G C+    C C Y  R Y P                      + C +  CS     ++ +    C+    A C A GDPHY T DG+ F+FQG+C+Y L       PG     + P  ++V N   G    +  K V   I G T  +S+ N    N  +   P    D +   L+    ++  + G+ + +D  + V + +  ++ G + GLCGNY+G  L +  M       D  +  ES         ++++     + + +   C A  D +     A Q CG++ D  G F  C + +  D   Y  +C+YD C     G    +C ++  + + C   GIP+  WRTQ  CP+ C    HY+ CAS CP TC +I S    H    HC E C C  G +     CVP   C C YNGQ Y  G +   E+   +KC C
Sbjct: 1557 GVCIPAKTCGCSYQGRYYTPGQQFWADEACSRLCVCDTTLGMVTCREASCSVNEKCIIQDGERVCQPISYATCTASGDPHYHTFDGRRFNFQGTCVYQLAGLCSQHPG-----LVPFNVTVENENRGSKAVSFTKTVTFSIYGSTLTISKENPYKLNGQLAALPLKSNDELAVFLSGSQAVIETAAGITITYDWWSTVRVTVPSNYHGAMCGLCGNYNGKALDDMTMQNGKTTPDEAKLGES---------WQVASVPGCSSACQGPWCQACSDSQKKVYQASQFCGIIADETGPFRECHKFV--DPAAYVEDCVYDVC--QFHGHHGSVCKAVEVYLSACQSQGIPIHPWRTQAFCPMECPANSHYNLCASGCPTTCASINSLTTCH---MHCSEACECDQGHLMSGDTCVPVRDCGCSYNGQYYQKGDVFYPEDTCMEKCIC 1979          

HSP 3 Score: 160.229 bits (404), Expect = 1.129e-38
Identity = 131/477 (27.46%), Postives = 205/477 (42.98%), Query Frame = 3
Query: 3033 CPKNQVYMDSVSGC-NSCTNYDTCTDTSSIANSCGCPNDTVSKIDG-TCVQPSDCPCIYMNREYAPNDVI----------------TIKCAKYICSNRMWNLLSEETANC----EAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEY-MHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQM--CGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVK-WRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCK-KCQC 4382
            CP N  Y    SGC  +C + ++ T T  +  S  C  D    + G TCV   DC C Y  + Y   DV                  + C K  C       L      C    E  C+A GDPHY + DGQ F FQG+C+Y L     D+ N + P T++  N   G    +  K V + +  +           +PL      +          V    GL+VL+D    V + +  ++QG + GLCGNY+   ++E+ + G    ++  +F +S++ +         PE ++    E+D            E++  CG+MK  +G F +C   +  D   Y S+C++D C    GG  E LC S+  +   C   G+ ++ WR+ + CP  C    HY+ CA  C  TC +        CS + C EGC C  G +    +CVP   C C ++G+      ++  ++C+ +C C
Sbjct: 1899 CPANSHYNLCASGCPTTCASINSLT-TCHMHCSEACECDQGHLMSGDTCVPVRDCGCSYNGQYYQKGDVFYPEDTCMEKCICGENGAVSCQKEKCRRGETCKLVNGVKGCHPEEEGKCVASGDPHYTSFDGQRFDFQGTCVYVLAKVCDDNDNQLTPFTVTQGNAKYGNGKVSVTKSVTVTVNNEEL--------NLPLSLDKGRLTVTREGHNTFVRTDFGLKVLYDTVYYVEVIVPSTYQGKMCGLCGNYNKKDRDEFRLPGGKGTKNVNEFGKSWVVDL--------PE-HICGGCEEDCPVCEKANAVLYEKLDSCGIMKAPDGPFQACHSKI--DPAAYVSDCVFDVCA--AGGSKEILCNSVQAYVLACQNAGVQIQPWRSSSFCPASCPPNSHYEVCADTCRGTCASFIQQLT--CSES-CFEGCECDAGFVFDGAQCVPLENCGCVHDGRYLTVNQVVVDKDCQSRCVC 2350          

HSP 4 Score: 151.369 bits (381), Expect = 5.560e-36
Identity = 115/378 (30.42%), Postives = 182/378 (48.15%), Query Frame = 3
Query: 3312 AVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPL---FPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYM--HGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPV-KWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSY-VNGAIIKMENC-KKCQCVQ------AKFNC 4403
            + C A GDPHY T D + + FQG+C+Y L       +  + P  + V N   G ++ +  K VQI    + Y L+  N+  + L     +  + + +  +F  + +D  GL+V ++  +  ++ L  ++ G V GLCGNY+G++Q++    +G    +    F  S+   A+I P  I     V PS     C+     +   E +CG+++DT G F  C   +  D   ++ +C+YD C     G  + LC ++  + + C  +G+ V  WRT N C + C    HYD CAS CP +C+ +   AP      HC EGCSC  G I    +CVP + C C YN   Y +N        C ++C+C Q       KF C
Sbjct:  438 STCKATGDPHYVTFDNKKYDFQGTCVYQLAALCSKDTE-LTPFEVLVQNEHRGRNVVSYTKLVQI----KVYSLNILNDQLVNLPVSLVEGKVSVYKSGWFAVVTTD-FGLKVSFNWHSAAFVTLPSNYMGAVCGLCGNYNGNMQDDLTPKNGNTPVK-PTDFGTSWRV-AEI-PGCIEGCQGVCPS-----CDITQKVQYEKEDLCGIIRDTKGPFRDCHAKV--DPAGFFEDCVYDVC--MYEGRKDVLCQAVTAYTSACQGVGVNVYSWRTSNFCAVKCPIHSHYDICASACPASCEGL---APPPGCRAHCEEGCSCDEGYILSGDQCVPFSQCGCLYNDLYYRINEVFYPNGQCEEECKCTQDGEVTCKKFKC 794          

HSP 5 Score: 149.828 bits (377), Expect = 1.406e-35
Identity = 126/451 (27.94%), Postives = 197/451 (43.68%), Query Frame = 3
Query: 3171 CVQPSDCPCIYMNREYAPNDVI----------------TIKCAKYICSN----RMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIAC----GFSLATCAKFVQIIIGGQTYL--------LSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEY-MHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVK-WRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCK-KCQCVQAKFNCTEDYS 4418
            CV  S C C+Y +  Y  N+V                  + C K+ C      ++ N + +     + VC A GDPHY + DGQ F FQG+C Y L  + G    ++   ++ V N+      G    +  + V + + G T +        L  G  + IPL      V         L++ + GL V +D    V + +  +++  V GLCGN++GD ++++ M   +  +D   F +S+     +    +  EN    ++  D   A+ D  S     CG++    G FA C   +  D   Y+ +C++D C  N  GD + LC S+A +A  C   G+ V  WRT + CP+ C    HY+ CA  C  +C   G +    C    C EGC C  G +     CV  T C C+  G++Y  G +   E+C   C C  A     E+YS
Sbjct:  748 CVPFSQCGCLYNDLYYRINEVFYPNGQCEEECKCTQDGEVTCKKFKCGPNEKCKIENGIQKCHPVGKGVCRASGDPHYTSFDGQKFDFQGTCTYVLSKSCGVEDTHLEAFSVQVENVQWDRMKGKKKVSVTRLVAVEVFGFTLIMKSKMFGVLVNGVLNNIPLNLNDGEVQVYQEGTNYLIATNFGLLVTYDLVYHVTVTVPGNYRDKVCGLCGNFNGDRKDDFQMPDQILAKDINVFGKSW----KVAIPNVVCENGCQGNECADCDPAHKDVFS-KPAYCGILTAPKGPFAVCHSKL--DPQSYFDDCVFDVCASN--GDGKVLCDSVAAYAYNCHMAGVNVNDWRTPSFCPMKCPANSHYEVCAETCTYSCP--GLSDMVQCPEA-CTEGCVCDAGFLYDGQTCVKETECGCYDRGKTYKPGEVTYEEDCSLACSCNPATGLICEEYS 1186          

HSP 6 Score: 124.405 bits (311), Expect = 9.096e-28
Identity = 104/378 (27.51%), Postives = 160/378 (42.33%), Query Frame = 3
Query: 3312 AVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPL---FPKYDIVIE--QLTFF----TQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGT-MKYEDAIQFAESFIANADICPYEISPENNVAPSKEQD------MCNANPDRKSWAEQMCGVM-KDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPV-KWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKM-ENCKK-CQCV 4385
              C A GDPHY+T DGQ F F G+C Y +    G+ S  +    +   N   G    +    V + +   T    R     + +        I++   +L  F    + ++    GL V +D +  + + L  ++ G   GLCGN++G+ ++++   +  +   A+ F  S+            P     P    D       C  +   K  ++  CG++ +  NG F +C   +  D   Y  NC YD   C   G  + LC +L T+A  C   G+ +  WR    C   C     Y+ C S CP TC     +APS C    CVE C+C  G +    ECVP T C C Y+G+    G      +NCK+ C+CV
Sbjct:   45 GTCWAMGDPHYRTFDGQRFDFMGTCTYVIAKNCGEDSR-LTAFEVHAQNENRGSHRVSYVGLVTVQVYDTTITAVRSETGRVRVDNSLWSLPIILNNGKLKIFQSGRSVVIEADFGLMVRYDWTHNLVVTLPDTYSGKTCGLCGNFNGNPKDDFTTPSGTQASGAVAFGSSWKV----------PGLVADPQCRNDCVGGCGSCTESQLNKWDSDLSCGIITRKENGPFKNCHAII--DPKAYLENCKYDL--CMGKGLRQFLCNALETYAEACQAAGVQIGDWRGLAKCSPRCPANSKYELCGSACPATCSD--PDAPSKCQRP-CVETCTCKEGFVLSGSECVPATKCGCTYDGRYIPAGQTFWADQNCKQLCKCV 404          

HSP 7 Score: 120.939 bits (302), Expect = 8.061e-27
Identity = 180/788 (22.84%), Postives = 287/788 (36.42%), Query Frame = 3
Query:  747 VNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTA--PSDVSAVTWSINIVYENCTSD----TGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGX-----XXXXXXXXXXXXXXVASFGNSFKGFGCP-------DIANTLSTCKPD--DQILANQQCSKIRLK----FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCI-QWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCN-----TCTCNSSLWHCTEKICP-------------------STCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY--------------ITGSCDNTPQSIVDPPAGDNDICSTILN--GPEFSGCMNSSKVDKEFYATYCRRE---QSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTC 2903
            V      TC + G  +YRTFD Q + + G C+Y++      D     + ++   EN  S      G V V V +     V+S    +      +N L  L +   +  L I  +   V+ + +F L+      ++  W    +  +      Y+G   GLCGN      D+  +   +      +FG+S+K  G         D      +C     ++  ++  C  I  K    F  C  +++   Y   C  ++C              +   LC  L  Y+++C   G  I  WR    C  +CP N  +  C S CP TC +    PS  CQ   V  C C  G V  G  C+    C C YDG+  P G     D N      C   +    C +K C                    STC   G   + TFD  K+ F       +A   ++ + D     F ++  N             ++  K+V +KV   +I+                    D    LP ++ +  + V K +  +  V      K+ F+   + ++ +       + GLCG ++GN ++D T K+ +      +   S+              +  SCD T +   +      D+C  I +  GP F  C   +KVD   +   C  +       KD L  C A+     AC+  G+      TSN      P+     + + IC+  C ++C  L  A    C   C  GC C   Y  +G  QCV  S+C C
Sbjct:   39 VPQSKMGTCWAMGDPHYRTFDGQRFDFMGTCTYVIAKNCGEDSRLTAFEVHAQNENRGSHRVSYVGLVTVQVYDTTITAVRSETGRVRV----DNSLWSLPIILNNGKLKIFQSGRSVVIEADFGLM------VRYDW---THNLVVTLPDTYSGKTCGLCGNFNGNPKDDFTTPSGTQASGAVAFGSSWKVPGLVADPQCRNDCVGGCGSCTESQLNKWDSDLSCGIITRKENGPFKNCHAIIDPKAYLENCKYDLCMGK----------GLRQFLCNALETYAEACQAAGVQIGDWRGLAKCSPRCPANSKYELCGSACPATCSDP-DAPSK-CQRPCVETCTCKEGFVLSGSECVPATKCGCTYDGRYIPAGQTFWADQNCKQLCKCVAGTRQVACQDKGCGVGQQCKVVDGIRKCQALSYSTCKATGDPHYVTFDNKKYDFQGTCVYQLA---ALCSKDTELTPFEVLVQNEHR------GRNVVSYTKLVQIKVYSLNIL-------------------NDQLVNLPVSLVEGKVSVYK-SGWFAVVTTDFGLKVSFNWHSAAFVTLPSNYMGAVCGLCGNYNGNMQDDLTPKNGNTPVKPTDFGTSWRVAEIPGCIEGCQGVCPSCDITQKVQYE----KEDLCGIIRDTKGP-FRDC--HAKVDPAGFFEDCVYDVCMYEGRKDVL--CQAVTAYTSACQGVGVNVYSWRTSNFCAVKCPI----HSHYDICASACPASCEGL--APPPGCRAHCEEGCSCDEGYILSGD-QCVPFSQCGC 756          

HSP 8 Score: 113.62 bits (283), Expect = 1.666e-24
Identity = 172/782 (21.99%), Postives = 292/782 (37.34%), Query Frame = 3
Query:  759 NFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNP------LTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCG-----XXXXXXXXXXXXXXXVASFGNSFKGFGCPDIANTLS-----TCKPDDQIL--ANQQCSKIRLK---FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQ-WRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFD---CNTCTC--NSSLWHCTEK-----ICPSTCGIMG--------------TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPAGDNDICST-------------ILNGPE--FSGCMNSSKVDKEFYATYCRREQ-SSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSR 2918
            ++ TC + G  +Y TFD + + +QG C Y L             N+  EN    +  V           V  S  G   T    NP      L  L + + D   +       V+           A  I + +D  + + +++ ++ + G + GLCG       D+    +     + A  G S++    P  ++         C    + +  A+Q C  I  +   F  C   V+   Y   CV ++C    +  +          +C  +  Y  +C  +G  I  WR+   C  +CP N  ++ CAS CP TC ++    + +   S+   C C  G +  G TC+    C C Y+GQ +  G V   +      C C  N ++    EK      C    G+ G                + +FDG +F F    C YV  +   +N D++   F + Q N +   G       ++  K VTV VN  ++ L      L   +  + +  E H T   F   D  + V   T  Y EV V S +                  +  + GLCG ++    ++F        +++    KS++     + P+ I      D  +C               I+  P+  F  C   SK+D   Y + C  +  ++   +   C+++    +AC+  G+Q +   +S+   A  P      + +++C+ TC+ TC    +     C + CF GCEC   +   G  QCV    C C +  R
Sbjct: 1625 SYATCTASGDPHYHTFDGRRFNFQGTCVYQLAGLCSQHPGLVPFNVTVENENRGSKAVSFTK------TVTFSIYGSTLTISKENPYKLNGQLAALPLKSNDELAVFLSGSQAVIET---------AAGITITYDWWSTVRVTVPSNYH-GAMCGLCGNYNGKALDDMTMQNGKTTPDEAKLGESWQVASVPGCSSACQGPWCQACSDSQKKVYQASQFCGIIADETGPFRECHKFVDPAAYVEDCVYDVCQFHGHHGS----------VCKAVEVYLSACQSQGIPIHPWRTQAFCPMECPANSHYNLCASGCPTTCASINSLTTCHMHCSEA--CECDQGHLMSGDTCVPVRDCGCSYNGQYYQKGDVFYPEDTCMEKCICGENGAVSCQKEKCRRGETCKLVNGVKGCHPEEEGKCVASGDPHYTSFDGQRFDFQGT-CVYVLAKVCDDN-DNQLTPFTVTQGNAKYGNGK------VSVTKSVTVTVNNEELNLP-----LSLDKGRLTVTREGHNT---FVRTDFGLKVLYDTVYYVEVIVPSTY------------------QGKMCGLCGNYNKKDRDEFRLPGGKGTKNVNEFGKSWVV----DLPEHICGGCEEDCPVCEKANAVLYEKLDSCGIMKAPDGPFQAC--HSKIDPAAYVSDCVFDVCAAGGSKEILCNSVQAYVLACQNAGVQIQPWRSSSFCPASCP----PNSHYEVCADTCRGTCASFIQQLT--CSESCFEGCECDAGFVFDG-AQCVPLENCGCVHDGR 2331          

HSP 9 Score: 92.8189 bits (229), Expect = 3.105e-18
Identity = 167/783 (21.33%), Postives = 285/783 (36.40%), Query Frame = 3
Query:  735 GGNDVNNENFT-TCHSYGLDYYRTFDNQLYTYQGRCSYIL--TAPSDVSAVTWSINIVYEN-CTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLT-PLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCG-----XXXXXXXXXXXXXXXVASFGNSF------KGFGCPDI-ANTLSTCKPDDQILANQQ--CSKIRLK----FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQ-WRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFD---CNTCTCNSSLWHCT-----------------EKICP----STCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPAGD-NDICSTILNGPEFSGCMNSSK---------VDKEFYATYCRREQ-SSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTC 2903
            GG  V    +T TC ++G  +Y TFD   + +QG C YI+  T  +    V +SI    +N   +    V+ + +   D  +    N +   T +   L  P  + + + ++   G+   V  +   I+      ++ +K  ++               V GLCG       D   +       +V  +G S+      KG  C D       TC  D++ L   Q  C  +  K    F  C   ++   + + CV ++C    +            +LC  L++Y+  C D+G  I+ WR +  C   C     +  CAS C  +C   F      C  + V  C+C  G V     CI  ++C C Y G+ + PG     D      C C+++L   T                 E++C     +TC   G   + TFDG +F F       +A   S +      NV V  ++           S  ++  K VT  + GS + +   +P   + Q             LP    D+      L+     ++ ++   + +D   ++ + V       + GLCG ++G + +D T ++         + +S+   S      +   P     +D    +    +F G +             VD   Y   C  +    +    S C A+     AC+  GI    P      QA  P+     + + +C+  C +TC  +N  T   C   C   CEC   +  +G   CV   +C C
Sbjct: 1223 GGEAVCIPKYTSTCWAWGDPHYHTFDGFDFDFQGTCKYIISKTCGNLNGLVPFSITERNDNRGNAAVSFVREVDVFIYDYNITIRKNQVGQVTVNGELLNLPFQLGDNEVSVFQSGSSAVVETKFGLIVSYDWNWHLVIKLPSSYYS-----------SVCGLCGNFNGDTGDELQNPSGKAVASVIEWGKSWQTPDQDKGHPCWDTCEKNCPTCDDDERELYKTQAFCGGLAAKTNSVFKICNSKLDPQAFMNNCVYDMCLNKGDKR----------MLCQALTSYNKQCRDEGIIIKDWRKEFNCPMNCQRFSHYEHCASPCQPSCP--FPEQKQTCSGACVEACVCDEGYVLSAGVCIPAKTCGCSYQGRYYTPGQQFWADEACSRLCVCDTTLGMVTCREASCSVNEKCIIQDGERVCQPISYATCTASGDPHYHTFDGRRFNFQGTCVYQLAGLCSQHPGLVPFNVTVENENR---------GSKAVSFTKTVTFSIYGSTLTISKENPYKLNGQ----------LAALPLKSNDE--LAVFLSGSQAVIETAAGITITYDWWSTVRVTVPSNYHGAMCGLCGNYNGKALDDMTMQNGKTTPDEAKLGESWQVASVPGCSSACQGPWCQACSDSQKKVYQASQFCGIIADETGPFRECHKFVDPAAYVEDCVYDVCQFHGHHGSVCKAVEVYLSACQSQGI----PIHPWRTQAFCPMECPANSHYNLCASGCPTTCASINSLTT--CHMHCSEACECDQGHLMSGD-TCVPVRDCGC 1954          

HSP 10 Score: 86.2705 bits (212), Expect = 3.486e-16
Identity = 132/602 (21.93%), Postives = 234/602 (38.87%), Query Frame = 3
Query:  756 ENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGT----PMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXX-----XXXVASFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSIS---DVLCTHLSAYSDSCSDKGSCIQ-WRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQF----DCNT-CTCNSS-LWHCTEKICPST--CGIMGT-----------------QFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQS----NTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY 2435
            E    C + G  +Y +FD Q + +QG C Y+L                 + C  +   +    +  G+      GNG +  T S      ++VT  +  L +P +     + V R+ +   +  + G +K+ +D    + + + ++   G + GLCGN +    ++F         NV  FG S+      D+   +     +D  +  +  + +  K   C  +   D  F  C   I   +  S+   D+ +     ++LC  + AY  +C + G  IQ WRS + C   CP N  +  CA  C  TC +  Q  +  C  S    C C +G V  G  C+  E+C C++DG+     TV Q     DC + C C +S L  C    C ST  C + G                  Q  +FDG   A    G    AVE +    +   N F ++      + +S         + NE  +     +G  +  K  SP              + T +L   + D+++ +++           S  ++ +  S+ + + V ++L + + G CG ++  SE+D    D  +   +  +  S+
Sbjct: 2010 EEEGKCVASGDPHYTSFDGQRFDFQGTCVYVLA----------------KVCDDNDNQLTPFTVTQGNA---KYGNGKVSVTKS------VTVTVNNEELNLPLSLDKGRLTVTREGHNTFVRTDFG-LKVLYDTVYYVEVIVPSTYQ-GKMCGLCGNYNKKDRDEFRLPGGKGTKNVNEFGKSW----VVDLPEHICGGCEEDCPVCEKANAVLYEKLDSCGIMKAPDGPFQACHSKIDPAAYVSDCVFDVCAAGGSKEILCNSVQAYVLACQNAGVQIQPWRSSSFCPASCPPNSHYEVCADTCRGTCASFIQQLT--CSESCFEGCECDAGFVFDGAQCVPLENCGCVHDGRYL---TVNQVVVDKDCQSRCVCEASGLVKCQRLSCSSTEVCDVRGGVRSCHIKQAHCTISHAGQLSSFDGMTAAVEAQG----AVEVASLCDETSENWFRVVVDVRVCHKKSAFAPATVHVFFNEATVTVNSQHGIWVNGKKVSPP------------NNLTNQLSVQVLDRSVVIQR----------KSAVRVTYSVSQEVTVTVDNSLASKVCGACGNYNSESEDDLKTADGKVTTDMSVVIGSW 2549          

HSP 11 Score: 77.0258 bits (188), Expect = 1.951e-13
Identity = 100/404 (24.75%), Postives = 158/404 (39.11%), Query Frame = 3
Query: 1875 TCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLY--FDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPAG------------DNDICSTIL----NGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSY-CSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITI--NC-QTCVCINGRLNCKTKDN 3017
            TC  MG   + TFDG +F F    C YV  +      D R   F +   N          S  ++   +VTV+V   D  + A   + G  +       ++    LP  + +  +   K+      V + + F L   +D + ++ + + D       GLCG F+GN ++DFT    +     V    S+        PQ   D   G            D+D+   I+    NGP F  C   + +D + Y   C+ +    K    + C+A+   A AC+  G+Q         L  C P C A  + +++C   C +TC + +    SKC   C   C C   +  +G+ +CV  ++C C    R     IPAG       NC Q C C+ G      +D 
Sbjct:   46 TCWAMGDPHYRTFDGQRFDFMGT-CTYVIAKNC--GEDSRLTAFEVHAQNENR------GSHRVSYVGLVTVQV--YDTTITAVRSETGRVRV------DNSLWSLPIILNNGKL---KIFQSGRSVVIEADFGLMVRYDWTHNLVVTLPDTYSGKTCGLCGNFNGNPKDDFTTPSGTQASGAVAFGSSWKVPGLVADPQCRNDCVGGCGSCTESQLNKWDSDLSCGIITRKENGP-FKNC--HAIIDPKAYLENCKYDLCMGKGLRQFLCNALETYAEACQAAGVQIG---DWRGLAKCSPRCPA-NSKYELCGSACPATCSDPD--APSKCQRPCVETCTCKEGFVLSGS-ECVPATKCGCTYDGR----YIPAGQTFWADQNCKQLCKCVAGTRQVACQDK 415          
BLAST of SCO-spondin vs. Ensembl Medaka
Match: zanl (zonadhesin [Source:NCBI gene;Acc:101162078])

HSP 1 Score: 221.861 bits (564), Expect = 2.278e-57
Identity = 320/1308 (24.46%), Postives = 507/1308 (38.76%), Query Frame = 3
Query:  765 TTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTW-SINIVYENC--TSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSN-----NPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVAS-----FGNSFKGFGCPDIAN-TLSTCKPDDQILANQQCSKIRLK---FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCI-QWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLY-DGQ--EHPPGTVRQFDCN-TCTCNSSLWHCTEKICPST------------------CGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITG------SCDNTPQSIVDPPAGDN----DICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLS-YCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREY-APNDVI---------------TIKCAKYICSNRMWNLLSEETANC---EAVCIAYGDPHYKTLDGQMFSFQGSCMYTL-----------MDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDI-VIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMH--GTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPV-KWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFY-NGQSYVNGAIIKMENCK-KCQCVQAKFNCTEDYSDC 4424
            +TC + G  +Y TFD + Y + G CSY+++   + +++ +  ++   EN   +     +K + +    V +     G++    +N     NP   +SV  +     +  T    +R D    + ++    + K                   + GLCG+ + N  +DF   D   +     FG+S+    C    N T+  C+P +Q L    C  +  K   F  C   VN + YF  C+ ++C          ++     +LC  + AY + C D+G  I  WR++T C  +CP N  +  CA  C  TC      PS+ C  +    C+C  G V     C+K +SC C + +GQ  E P       DC   C C+S    C    CP                    C + G   ++TFD   ++F    C Y       N++      F +   N E   G  G S Y+   K + V VN   + L  +   L + +   F         L             L+  Y  ++ +   ++ +DG+    I V  +  + + GLCG +DGN+ NDFT+ D +   ++ +   S+ T       S   TP    DP         D C  I +      C+    VD E +   C  +      +L   C  +     AC+  G         +    C        + + +C  +C  TC  L    +  C+D C  GCEC P +  +   +CV   +C C + S         GT                         +P CP N  Y++    C       +   + S  + C C    V K    CV    C C+  +  Y  P +V+               T++C    C             +C    + CIA GDPHY T D   + F G+C Y +            +   D+ N     TIS        ++      V+I I     +   G N  +PL P  ++ V +    +T  VS + G+ V +D +  + + +   +Q  + GLCG+Y+G+ ++++    GTM   DA +F  S+  N D C        N  P+     C   P  +   E  CG++ D NG FA C   ++   N Y+ +CL+D   C   G    LC ++  +  +C   G+ +  WR +  C + C    HY+ CA PC  TC    S  PS C    C EGC C  G +   G+CV   +C C + NGQ Y  G    +E+CK KC+C      C    SDC
Sbjct: 1413 STCIASGDPHYTTFDKRKYNFMGNCSYVMSGICNATSLPFFEVHADNENRYNSPTISYLKAVHVYVHMVKISILKGGVVQVNGTNVNLPVNPTPEVSVFQSGKHYTVSMTFGVTVRYDGNHFMDIKVIKYQDK-------------------LCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSWNTDPCNKQPNATIPGCEPGEQELYEGYCGILLDKNSPFAVCHGKVNPNNYFQDCLFDLC----------ELEGAKPILCEAIEAYVNECQDRGVDIGPWRNETFC-LKCPSNSHYEPCADPCQDTCSG---KPSS-CGGACSEGCVCDPGYVLSAGKCVKSDSCGCKHTNGQYYEQPGEEFYVEDCKLKCRCDSPFVTCVASDCPPMHECKLQDGELGCYPSIQDCIVSGDPHYNTFDKKFYSFMGT-CTYTLARTCRNDSP----WFSVEGKNEER--GASGVS-YL---KKLYVTVNDITVTLMKSKRTLVNGKRVAFPHNPSPLMSL------------SLSGQYVILQTTFGLRVRWDGNHHAQISVP-SYHDQMCGLCGDYDGNAGNDFTKPDGTPAGNVNDFGNSWQTEEDEDECSPGTTPDLDCDPELEAEVIKPDKCGKIEDPSGPFECIGV--VDPEPFFQSCVYDMCQFNGELHVLCDQLQAYTDACQSAGATVHHWRAPDFCLDC-----PANSSYSLCVSSCPETC--LGVIGSPGCEDVCVEGCECDPGFILSDD-KCVPLKDCGCVDTS---------GT------------------------YHPPCPPNAEYIECGPACIPTCQEPSTNCSGSCISGCFCKPGFVFK-GPRCVPIEKCGCLDEDGNYYEPGEVVLGDGCSKLCRCAGNYTLECTDNSCDPSEECREVNGIPSCYPKTSTCIASGDPHYTTFDKHRYDFMGNCSYVMSGICNTTSLPFFEVHADNENRYNSPTISYLK-----AVHVYVHMVKISILKGGVVQVNGTNVNLPLNPAPEVSVFQSGKHYT--VSMTFGVTVRYDGNHFMDIKVI-KYQDKLCGLCGDYNGNSKDDFQKPDGTMT-NDANEFGHSW--NTDPC--------NKQPNATIPGC--EPGEQELYEGYCGILLDKNGPFAVCHGKVNP--NNYFQDCLFDL--CELEGAKPILCEAIEAYVNECQDRGVDIGPWRNETFC-LKCPPNSHYEPCADPCQDTC----SGKPSSCGGA-CSEGCVCDPGYVLSAGKCVKRESCGCKHTNGQYYEPGEEFYVEDCKLKCRCDSPFVTCVA--SDC 2585          

HSP 2 Score: 140.198 bits (352), Expect = 1.524e-32
Identity = 131/467 (28.05%), Postives = 189/467 (40.47%), Query Frame = 3
Query: 3033 CPKNQVYMDSVSGCNSCTNYDTCTDTSSI---------ANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFS--------LATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMH--GTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPV-KWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKK 4373
            CP N  Y D  + C       TC+D   I            C C N      DG CV    C C+  + EY   D  T+                             GDPHY+T DG    +QG   Y L     +   ++ P+ +   N+  G +        +      V +    +  +L  G   T PL P   + I   +   QL +D  GL V +D  +R  + L  ++  +V+GLCGNYDG  +NEYM   GT+   D  +F +S+  + D    E  P++      E   C+ +      +   CG + D  G F++C  A+   +   Y +C++D C     G  E  C S   +AT C   G+ +  WR Q  C + C     Y AC SPCP +C  +   APS C  T CVEGC C  G +   G CVP   C C +  + Y        E+C +
Sbjct: 3474 CPPNSHYSDCTAPCPP-----TCSDLFPIFCHLPPTACVEGCEC-NAGYVLSDGKCVSLDKCGCVGSDGEYHDFDRCTVS----------------------------GDPHYRTFDGFTHHYQGPYTYVLTQD-HNLQGSLKPLMVRGKNLRRGGNKRVSFLDEMYVNVYGVDVRFLQKKTVLVNGERVTPPLSPVRGLTITMNSKQMQLTTD-FGLTVRFDGKSRG-VILPRTYSNSVRGLCGNYDGITRNEYMKPDGTV-VRDLNEFGDSWRVSRDT---ETDPDSGF----ETSDCSQSELDDYTSVTKCGALSDPEGPFSACHAALPPQI---YQDCVFDLCA--EDGSEELRCASYEAYATICQEAGVKLGSWRQQLGC-LPCPANSTYTACMSPCPSSCADLA--APSECDATACVEGCQCAAGFVMSEGACVPYPECGCTFLDRYYPLNENFVTEDCSQ 3887          

HSP 3 Score: 132.109 bits (331), Expect = 3.650e-30
Identity = 117/388 (30.15%), Postives = 175/388 (45.10%), Query Frame = 3
Query: 3312 AVCIAYGDPHYKTLDGQMFSFQGSCMYTL-----------MDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDI-VIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMH--GTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPV-KWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFY-NGQSYVNGAIIKMENCK-KCQCVQAKFNCTEDYSDC 4424
            + CIA GDPHY T D   + F G+C Y +            +   D+ N     TIS        ++      V+I I     +   G N  +PL P  ++ V +    +T  VS + G+ V +D +  + + +   +Q  + GLCG+Y+G+ ++++    GTM   DA +F  S+  N D C        N  P+     C   P  +   E  CG++ D NG FA C   ++   N Y+ +CL+D   C   G    LC ++  +  +C   G+ +  WR +  C + C    HY+ CA PC  TC    S  PS C    C EGC C  G +   G+CV   +C C + NGQ Y  G    +E+CK KC+C      C    SDC
Sbjct:  433 STCIASGDPHYTTFDKHRYDFMGNCSYLMSGICNATSLPFFEVHADNENRYNSPTISYLK-----AVHVYVHMVKISILKGGVVQVNGTNVNLPLNPAPEVSVFQSGKHYT--VSMTFGVTVRYDGNHFMDIKVI-KYQDKLCGLCGDYNGNSKDDFQKPDGTMT-NDANEFGHSW--NTDPC--------NKQPNATIPGC--EPGEQELYEGYCGILLDKNGPFAVCHGKVNP--NNYFQDCLFDL--CELEGAKPILCEAIEAYVNECQDRGVDIGPWRNETFC-LKCPPNSHYEPCADPCQDTC----SGKPSSCGGA-CSEGCVCDPGYVLSAGKCVKRESCGCKHTNGQYYEPGEEFYVEDCKLKCRCDSPFVTCVA--SDC 787          

HSP 4 Score: 122.479 bits (306), Expect = 3.773e-27
Identity = 100/348 (28.74%), Postives = 149/348 (42.82%), Query Frame = 3
Query: 3318 CIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGN----NDTIPLFPKYDIVIEQLTFFTQLV--SDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAI-QFAESFIANADICPYEISPENNVAPSKEQDM-CNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPV-KWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSY 4334
            CI  GDPHY T D   ++F G+C YTL  T     N+ P  ++   N   G S  +  K + + +   T  L +      N     FP     +  L+   Q V    + GLRV WD +    + + PS+   + GLCG+YDG+  N++          +  F  S+    D        E+  +P    D+ C+   + +      CG ++D +G F  CI  +  D   ++ +C+YD C  N  G+   LC  L  +   C   G+ V  WR  + C + C     Y  C S CP+TC  +G      C    CVEGC C  G I  + +CVP   C C     +Y
Sbjct:  809 CIVSGDPHYNTFDKNYYTFMGTCTYTLART---CRNDSPWFSVEGKNEERGVSGVSYLKKLYVTVNNITVTLMKSRTTLVNGKRVAFPHNPSPLMSLSLSGQYVILQTTFGLRVRWDGNHHAQISV-PSYHDQMCGLCGDYDGNAGNDFTKPDGTPAGNVNDFGNSWQTEED--------EDECSPGTTPDLDCDPELEAEVTKPDKCGKIEDPSGPF-ECIGVV--DPEPFFQSCVYDMCQFN--GELHVLCDQLQAYTDACQSAGVTVHHWRAPDFC-LDCPANSSYSLCVSSCPETC--LGVVGSPGCEDV-CVEGCECDPGFILSDDKCVPLKDCGCVDTSGTY 1135          

HSP 5 Score: 121.709 bits (304), Expect = 6.355e-27
Identity = 191/798 (23.93%), Postives = 311/798 (38.97%), Query Frame = 3
Query:  765 TTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTW-SINIVYENC--TSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSN-----NPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVAS-----FGNSFKGFGCPDIAN-TLSTCKPDDQILANQQCSKIRLK---FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCI-QWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLY-DGQEHPPGTVRQF---DCN-TCTCNSSLWHCTEKICPST------------------CGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITG------SCDNTPQSIVDP----PAGDNDICSTI--LNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLS-YCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINC-QTCVCING 2990
            +TC + G  +Y TFD   Y + G CSY+++   + +++ +  ++   EN   +     +K + +    V +     G++    +N     NP   +SV  +     +  T    +R D    + ++    + K                   + GLCG+ + N  +DF   D   +     FG+S+    C    N T+  C+P +Q L    C  +  K   F  C   VN + YF  C+ ++C          ++     +LC  + AY + C D+G  I  WR++T C  +CP N  +  CA  C  TC      PS+ C  +    C+C  G V     C+K ESC C + +GQ + PG   +F   DC   C C+S    C    CP                    C + G   ++TFD   ++F    C Y       N++      F +   N E   G  G S Y+   K + V VN   + L  +   L + +   F         L             L+  Y  ++ +   ++ +DG+    I V  +  + + GLCG +DGN+ NDFT+ D +   ++ +   S+ T       S   TP    DP         D C  I  L+GP    C+    VD E +   C  +      +L   C  +     AC+  G         +    C        + + +C  +C  TC  L    +  C+D C  GCEC P +  +   +CVS  +C C + S    P       +   C Q+C C++G
Sbjct: 2231 STCIASGDPHYTTFDKHRYDFMGNCSYVMSGICNTTSLPFFEVHADNENRYNSPTISYLKAVHVYVHMVKISILKGGVVQVNGTNVNLPLNPAPEVSVFQSGKHYTVSMTFGVTVRYDGNHFMDIKVIKYQDK-------------------LCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSWNTDPCNKQPNATIPGCEPGEQELYEGYCGILLDKNGPFAVCHGKVNPNNYFQDCLFDLC----------ELEGAKPILCEAIEAYVNECQDRGVDIGPWRNETFC-LKCPPNSHYEPCADPCQDTCSG---KPSS-CGGACSEGCVCDPGYVLSAGKCVKRESCGCKHTNGQYYEPG--EEFYVEDCKLKCRCDSPFVTCVASDCPPMHECKLQDGELGCYPSSQDCIVSGDPHYNTFDKKYYSFMGT-CTYTLARTCRNDSP----WFSVEGKNEER--GASGVS-YL---KKLYVTVNDITVTLMKSKRTLVNGKRVAFPHNPSPLMSL------------SLSGQYVILQTTFGLRVRWDGNHHAQISVP-SYHDQMCGLCGDYDGNAGNDFTKPDGTPAGNVNDFGNSWQTEEDEDECSPGTTPDLDCDPELEAEVTKPDKCGKIEDLSGP--FECIGV--VDPEPFFQSCVYDMCQFNGELHVLCDQLQAYTDACQSAGATVHHWRAPDFCLDC-----PANSSYSLCVSSCPETC--LGVVGSPGCEDVCVEGCECDPGFILS-DDKCVSLKDCGCVDTSGTYHPFQVDDEWLLEGCEQSCECLSG 2956          

HSP 6 Score: 120.553 bits (301), Expect = 1.215e-26
Identity = 185/783 (23.63%), Postives = 301/783 (38.44%), Query Frame = 3
Query:  765 TTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTW-SINIVYENC--TSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSN-----NPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVAS-----FGNSFKGFGCPDIAN-TLSTCKPDDQILANQQCSKIRLK---FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCI-QWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLY-DGQEHPPGTVRQF---DCN-TCTCNSSLWHCTEKICPST------------------CGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITG------SCDNTPQSIVDP----PAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLS-YCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPS-----RPKDPEIP 2939
            +TC + G  +Y TFD   Y + G CSY+++   + +++ +  ++   EN   +     +K + +    V +     G++    +N     NP   +SV  +     +  T    +R D    + ++    + K                   + GLCG+ + N  +DF   D   +     FG+S+    C    N T+  C+P +Q L    C  +  K   F  C   VN + YF  C+ ++C          ++     +LC  + AY + C D+G  I  WR++T C  +CP N  +  CA  C  TC      PS+ C  +    C+C  G V     C+K ESC C + +GQ + PG   +F   DC   C C+S    C    CP                    C + G   ++TFD   + F    C Y       N++      F +   N E   G  G S Y+   K + V VN   + L  +   L + +   F         L             L+  Y  ++ +   ++ +DG+    I V  +  + + GLCG +DGN+ NDFT+ D +   ++ +   S+ T       S   TP    DP         D C  I +      C+    VD E +   C  +      +L   C  +     AC+  G+        +    C        + + +C  +C  TC  L    +  C+D C  GCEC P +  +   +CV   +C C + S     RP  P  P
Sbjct:  433 STCIASGDPHYTTFDKHRYDFMGNCSYLMSGICNATSLPFFEVHADNENRYNSPTISYLKAVHVYVHMVKISILKGGVVQVNGTNVNLPLNPAPEVSVFQSGKHYTVSMTFGVTVRYDGNHFMDIKVIKYQDK-------------------LCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSWNTDPCNKQPNATIPGCEPGEQELYEGYCGILLDKNGPFAVCHGKVNPNNYFQDCLFDLC----------ELEGAKPILCEAIEAYVNECQDRGVDIGPWRNETFC-LKCPPNSHYEPCADPCQDTCSG---KPSS-CGGACSEGCVCDPGYVLSAGKCVKRESCGCKHTNGQYYEPG--EEFYVEDCKLKCRCDSPFVTCVASDCPPMHECKMQDGKLGCYPSFQDCIVSGDPHYNTFDKNYYTFMGT-CTYTLARTCRNDSP----WFSVEGKNEER--GVSGVS-YL---KKLYVTVNNITVTLMKSRTTLVNGKRVAFPHNPSPLMSL------------SLSGQYVILQTTFGLRVRWDGNHHAQISVP-SYHDQMCGLCGDYDGNAGNDFTKPDGTPAGNVNDFGNSWQTEEDEDECSPGTTPDLDCDPELEAEVTKPDKCGKIEDPSGPFECIGV--VDPEPFFQSCVYDMCQFNGELHVLCDQLQAYTDACQSAGVTVHHWRAPDFCLDC-----PANSSYSLCVSSCPETC--LGVVGSPGCEDVCVEGCECDPGFILS-DDKCVPLKDCGCVDTSGTYHPRPSTPNPP 1145          

HSP 7 Score: 118.627 bits (296), Expect = 5.075e-26
Identity = 104/371 (28.03%), Postives = 158/371 (42.59%), Query Frame = 3
Query: 3318 CIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGN----NDTIPLFPKYDIVIEQLTFFTQLV--SDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAI-QFAESFIANADICPYEISPENNVAPSKEQDM-CNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPV-KWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAI---IKMENCKK-CQCVQA 4391
            CI  GDPHY T D + +SF G+C YTL  T     N+ P  ++   N   G S  +  K + + +   T  L +      N     FP     +  L+   Q V    + GLRV WD +    + + PS+   + GLCG+YDG+  N++          +  F  S+    D        E+  +P    D+ C+   + +      CG ++D +G F  CI  +  D   ++ +C+YD C  N  G+   LC  L  +   C   G  V  WR  + C + C     Y  C S CP+TC  +G      C    CVEGC C  G I  + +CV    C C     +Y    +     +E C++ C+C+  
Sbjct: 2607 CIVSGDPHYNTFDKKYYSFMGTCTYTLART---CRNDSPWFSVEGKNEERGASGVSYLKKLYVTVNDITVTLMKSKRTLVNGKRVAFPHNPSPLMSLSLSGQYVILQTTFGLRVRWDGNHHAQISV-PSYHDQMCGLCGDYDGNAGNDFTKPDGTPAGNVNDFGNSWQTEED--------EDECSPGTTPDLDCDPELEAEVTKPDKCGKIEDLSGPF-ECIGVV--DPEPFFQSCVYDMCQFN--GELHVLCDQLQAYTDACQSAGATVHHWRAPDFC-LDCPANSSYSLCVSSCPETC--LGVVGSPGCEDV-CVEGCECDPGFILSDDKCVSLKDCGCVDTSGTYHPFQVDDEWLLEGCEQSCECLSG 2956          

HSP 8 Score: 96.6709 bits (239), Expect = 2.324e-19
Identity = 130/571 (22.77%), Postives = 224/571 (39.23%), Query Frame = 3
Query: 1260 VASFGNSFKGFGCPD------IANTLSTCKPDDQILANQQCSKIRLK--FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCL-YDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMGTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKL--YFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY-ITGSCDNTPQS---IVDPPAGDNDICSTI-----LNGPE--FSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCD-DDCFPGCECPPNYYKTGTGQCVSESECTC 2903
            V   GNS+K  G  D        +    C  +++     QC ++ L   F  C  +V+ D +   C+ ++C  +           +   LC ++ AY+ +C   G  I WR+ T C   CP N  +SDC + CP TC +LF         + V  C C +G V     C+  + C C+  DG+ H        D + CT +                     + TFDG    +      Y  V    +N        ++   N     G     ++++E   + V V G D+            +  V ++GE        T P   +    +T    ++++++ F L   FDG KS  + +     N++ GLCG +DG + N++ + D ++   +     S+ ++   +  P S     D    + D  +++     L+ PE  FS C   + +  + Y        + +  +   C++    A  C+  G++     +      C+P C A  T +  C   C S+C +L  A  S+CD   C  GC+C   +  +  G CV   EC C
Sbjct: 3366 VIELGNSWKSEGDSDPCQPDNRPDVHPNCTAEEEEQFKAQCEQVILSSSFRPCHSVVSPDAFLGNCIYDMCEYN----------GMQATLCDNVEAYAQACQSAGVTITWRNSTFC-LPCPPNSHYSDCTAPCPPTCSDLFPIFCHLPPTACVEGCECNAGYVLSDGKCVSLDKCGCVGSDGEYH--------DFDRCTVSGD-----------------PHYRTFDGFTHHYQG---PYTYVLTQDHNLQGSLKPLMVRGKNLRR--GGNKRVSFLDE---MYVNVYGVDVRFL--------QKKTVLVNGER------VTPPLSPVRGLTITMNSKQMQLTTDFGLTVRFDG-KSRGVILPRTYSNSVRGLCGNYDGITRNEYMKPDGTVVRDLNEFGDSWRVSRDTETDPDSGFETSDCSQSELDDYTSVTKCGALSDPEGPFSAC--HAALPPQIYQDCVFDLCAEDGSEELRCASYEAYATICQEAGVKLG---SWRQQLGCLP-CPANST-YTACMSPCPSSCADL--AAPSECDATACVEGCQCAAGFVMS-EGACVPYPECGC 3867          

HSP 9 Score: 83.5741 bits (205), Expect = 2.367e-15
Identity = 85/351 (24.22%), Postives = 142/351 (40.46%), Query Frame = 3
Query: 3162 DGTCVQPSDCPCIYMNREYAPNDVIT-------------IKCAKYICSNRMWNLLSE---------ETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGF-SLATCAKFVQIIIGGQTYLLSRGN----NDTIPLFPKYDIVIEQLTFFTQLV--SDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLC 4127
            D  CV   DC C+  +  Y P  V               +   +  C N   N ++E         E +    +C   GDPHY T D +   + G+C YTL     +SS+++P  T+   N   G  +  +  + V I + G T +  +G     N T+ + P   I   ++ F  + V    S GLRV +D +    + L  S+ G + G+C   D    +          ++ +  +S+         +  P  N      Q+ C+   + ++     CG++ D N +F  C   +  +   Y+ NC+YD C    GG    LC +L ++A  CA  G+ + WR    C
Sbjct: 2915 DDKCVSLKDCGCVDTSGTYHPFQVDDEWLLEGCEQSCECLSGGQIQCHNTSCNPVTEVCQLQDGLYECSPLNGICSVSGDPHYTTFDKRTHHYMGACSYTLTKL-CNSSSDLPHFTVDTQNEHRGSNTKVSYVRAVVINVYGMTVVFGKGRSVQVNGTVVVPPVSSISGVKIYFSGKFVVLEASFGLRVRFDGNHHADVTLPSSYSGLLCGMCNFNDNPTDDNLKPDNTPAANSNELGDSWAVP------DPRPCTN---GGGQEECDEKVEEEAQKPTSCGMITDPN-IFKPCHAVVPPE--PYFENCVYDMCA--TGGQTVALCQALESYADICAAAGVNIPWRNSTFC 3250          

HSP 10 Score: 80.4925 bits (197), Expect = 1.706e-14
Identity = 125/471 (26.54%), Postives = 184/471 (39.07%), Query Frame = 3
Query: 1593 CPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCL-YDGQEHPPGTVRQFD--CNTCTC-NSSLWHCTEKIC------------------PSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDI-ILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDP-PAGDNDI----CSTIL--NGPEFSGCMNSSKVDKEFYATYCRR---EQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTC 2903
            CP N  + +C   C  TC    Q PS  C  S +  C C  G V  G  C+  E C CL  DG  + PG V   D     C C  +    CT+  C                   STC   G   + TFD  ++ F    C Y+ +    N T   +  F  + ++ E+      NS  I+  K V V V+   I ILK    Q+  +  N+ ++            P   + V +    YT V ++    + +DG+  + IKV    ++ L GLCG ++GNS++DF + D ++         S+ T  C+  P + +     G+ ++    C  +L  NGP F+ C    KV+   Y   C     E    K  L  C AI      C+  G+             C P      + ++ C+  CQ TC        S C   C  GC C P Y  +  G+CV    C C
Sbjct:  322 CPPNAEYIECGPACIPTC----QEPSTNCSGSCISGCFCKPGFVFKGPRCVPIEKCGCLDEDGNYYEPGEVVLGDGCSKLCRCVGNYTLECTDNSCDPSEECREVNGVPGCYPKTSTCIASGDPHYTTFDKHRYDFMG-NCSYL-MSGICNAT---SLPFFEVHADNENRY----NSPTISYLKAVHVYVHMVKISILKGGVVQVNGTNVNLPLN------------PAPEVSVFQSGKHYT-VSMTFGVTVRYDGNHFMDIKVI-KYQDKLCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSWNTDPCNKQPNATIPGCEPGEQELYEGYCGILLDKNGP-FAVC--HGKVNPNNYFQDCLFDLCELEGAKPIL--CEAIEAYVNECQDRGVDIGPWRNETFCLKCPP-----NSHYEPCADPCQDTC----SGKPSSCGGACSEGCVCDPGYVLS-AGKCVKRESCGC 750          

HSP 11 Score: 80.1073 bits (196), Expect = 2.140e-14
Identity = 63/242 (26.03%), Postives = 106/242 (43.80%), Query Frame = 3
Query: 3612 LVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMK-YEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSY 4334
            L+  + GL+V +D    + + +   +   + G+CGNY+ D  ++ +    +  +D I+   S+ +  D  P +     +V P+     C A  + +  A+    ++  +   F  C   +  D   +  NC+YD C  N  G    LC ++  +A  C   G+ + WR    C + C    HY  C +PCP TC  +      H   T CVEGC C  G +  +G+CV    C C  +   Y
Sbjct: 3311 LLDTNFGLQVKFDGVHHLEITVPGEYFNKLCGMCGNYNHDSTDDNLKPDKQPAKDVIELGNSWKSEGDSDPCQPDNRPDVHPN-----CTAEEEEQFKAQCEQVILSSS---FRPCHSVVSPDA--FLGNCIYDMCEYN--GMQATLCDNVEAYAQACQSAGVTITWRNSTFC-LPCPPNSHYSDCTAPCPPTCSDLFPIF-CHLPPTACVEGCECNAGYVLSDGKCVSLDKCGCVGSDGEY 3538          

HSP 12 Score: 75.485 bits (184), Expect = 6.653e-13
Identity = 130/602 (21.59%), Postives = 234/602 (38.87%), Query Frame = 3
Query:  783 GLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIV-YENCTSDTGCVKVIVIEAGDVVV------KSSGNGILYTTDSN-NPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCG-----XXXXXXXXXXXXXXXVASFGNSFKGFGCPDIANTLST----CKP--DDQILANQQCSKIR-LKFP-GCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCI-QWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVR------------------QFDCNTCTCN---------SSLWHCTEKICPSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIIL-KATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY 2435
            G  +Y TFD + Y++ G C+Y L       +  +S+     E   S    +K + +   D+ V      ++  NG       N +PL  LS++             YV+ Q  F         ++++WD N++  IS+ +      + GLCG       ++    D +   NV  FGNS++     D  +  +T    C P  + ++    +C KI  L  P  C  +V+ + +F  CV ++C  +   +          VLC  L AY+D+C   G+ +  WR+   C   CP N  +S C S CP TC  +  +P   C++  V  C C  G +     C+  + C C+     + P  V                   Q  C+  +CN           L+ C+       C + G   + TFD     +    C Y   +   N++ D  +  V  Q+         G++  ++  + V + V G  ++  K  S Q+            + T  +P       + +   +  +  ++ S   ++ FDG+    + +  +    L G+C  F+ N  +D  + DN+   +   +  S+
Sbjct: 2611 GDPHYNTFDKKYYSFMGTCTYTLARTCRNDSPWFSVEGKNEERGASGVSYLKKLYVTVNDITVTLMKSKRTLVNGKRVAFPHNPSPLMSLSLSG-----------QYVILQTTF--------GLRVRWDGNHHAQISVPSYHD--QMCGLCGDYDGNAGNDFTKPDGTPAGNVNDFGNSWQTEEDEDECSPGTTPDLDCDPELEAEVTKPDKCGKIEDLSGPFECIGVVDPEPFFQSCVYDMCQFNGELH----------VLCDQLQAYTDACQSAGATVHHWRAPDFC-LDCPANSSYSLCVSSCPETCLGVVGSPG--CEDVCVEGCECDPGFILSDDKCVSLKDCGCVDTSGTYHPFQVDDEWLLEGCEQSCECLSGGQIQCHNTSCNPVTEVCQLQDGLYECSPLN--GICSVSGDPHYTTFDKRTHHYMGA-CSYTLTK-LCNSSSDLPHFTVDTQNE------HRGSNTKVSYVRAVVINVYGMTVVFGKGRSVQV------------NGTVVVPPVSSISGVKIY-FSGKFVVLEASFGLRVRFDGNHHADVTLPSSYSGLLCGMC-NFNDNPTDDNLKPDNTPAANSNELGDSW 3154          

HSP 13 Score: 73.559 bits (179), Expect = 2.269e-12
Identity = 123/468 (26.28%), Postives = 180/468 (38.46%), Query Frame = 3
Query: 1602 NKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCL-YDGQEHPPGTVRQFD--CNTCTCNSSL-WHCTEKIC------------------PSTCGIMG-TQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDI-ILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDP-PAGDNDI----CSTIL--NGPEFSGCMNSSKVDKEFYATYCRR---EQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTC 2903
            N  + +C   C  TC    Q PS  C  S +  C C  G V  G  C+  E C CL  DG  + PG V   D     C C  +    CT+  C                   STC   G   + TFD  K+ F    C YV +    N T   +  F  + ++ E+      NS  I+  K V V V+   I ILK    Q+  +  N+ ++            P   + V +    YT V ++    + +DG+  + IKV    ++ L GLCG ++GNS++DF + D ++         S+ T  C+  P + +     G+ ++    C  +L  N P F+ C    KV+   Y   C     E    K  L  C AI      C+  G+             C        + ++ C+  CQ TC        S C   C  GC C P Y  +  G+CV    C C
Sbjct: 1305 NAEYIECGPACIPTC----QEPSTNCSGSCISGCFCKPGFVFKGPRCVPIEKCGCLDEDGNYYEPGEVVLGDGCSKLCRCAGNYTLECTDNSCDPSEECREVNGIPGCYPKTSTCIASGDPHYTTFDKRKYNFMG-NCSYV-MSGICNAT---SLPFFEVHADNENRY----NSPTISYLKAVHVYVHMVKISILKGGVVQVNGTNVNLPVN------------PTPEVSVFQSGKHYT-VSMTFGVTVRYDGNHFMDIKVI-KYQDKLCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSWNTDPCNKQPNATIPGCEPGEQELYEGYCGILLDKNSP-FAVC--HGKVNPNNYFQDCLFDLCELEGAKPIL--CEAIEAYVNECQDRGVDIGPWRNETFCLKC-----PSNSHYEPCADPCQDTC----SGKPSSCGGACSEGCVCDPGYVLS-AGKCVKSDSCGC 1730          

HSP 14 Score: 67.781 bits (164), Expect = 1.197e-10
Identity = 91/365 (24.93%), Postives = 150/365 (41.10%), Query Frame = 3
Query:  759 NFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNT---DSALIIPGTP---MYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCG-----XXXXXXXXXXXXXXXVASFGNSFKGFGCPDIANTLST----CKP--DDQILANQQCSKIRLKFPG--CADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCI-QWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCL-YDGQEHP 1790
            +F  C   G  +Y TFD   YT+ G C+Y L       +  +S+    E    + G   V  ++             LY T +N  +T +    T      +  P  P   M +     +++L    G ++++WD N++  IS+ +      + GLCG       ++    D +   NV  FGNS++     D  +  +T    C P  + ++    +C KI        C  +V+ + +F  CV ++C  +   +          VLC  L AY+D+C   G  +  WR+   C   CP N  +S C S CP TC  +  +P   C++  V  C C  G +     C+  + C C+   G  HP
Sbjct:  805 SFQDCIVSGDPHYNTFDKNYYTFMGTCTYTLARTCRNDSPWFSV----EGKNEERGVSGVSYLKK------------LYVTVNNITVTLMKSRTTLVNGKRVAFPHNPSPLMSLSLSGQYVILQTTFG-LRVRWDGNHHAQISVPSYHD--QMCGLCGDYDGNAGNDFTKPDGTPAGNVNDFGNSWQTEEDEDECSPGTTPDLDCDPELEAEVTKPDKCGKIEDPSGPFECIGVVDPEPFFQSCVYDMCQFNGELH----------VLCDQLQAYTDACQSAGVTVHHWRAPDFC-LDCPANSSYSLCVSSCPETCLGVVGSPG--CEDVCVEGCECDPGFILSDDKCVPLKDCGCVDTSGTYHP 1137          
BLAST of SCO-spondin vs. Planmine SMEST
Match: SMESG000042718.1 (SMESG000042718.1)

HSP 1 Score: 3425.18 bits (8880), Expect = 0.000e+0
Identity = 1676/1676 (100.00%), Postives = 1676/1676 (100.00%), Query Frame = 3
Query:   12 MGTKTHTIWQMNFNQXXXXXXXXXXXTSQSVESDKVLIGVKPKSVTSPNNCIYDYNEDVDTVTESCNKYIGLMMENYNLDEKSVPIAEQYQDPSIPVSKQQSLSMQLYVSSGMPEPQCNFTLQNIVSEENCCVGYENFPYCNISVCYSDNGGCYNGGICMSPNQCKCQENYAGMQCDEDNPIIIQSQHPSQLYCYQSDQCFAFKKSDFLGKAVSYDECCADKTGSWGSQSGSCVSCKANFAGGNDVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVASFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMGTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNCEIF 5039
            MGTKTHTIWQMNFNQLLLSILLYAILTSQSVESDKVLIGVKPKSVTSPNNCIYDYNEDVDTVTESCNKYIGLMMENYNLDEKSVPIAEQYQDPSIPVSKQQSLSMQLYVSSGMPEPQCNFTLQNIVSEENCCVGYENFPYCNISVCYSDNGGCYNGGICMSPNQCKCQENYAGMQCDEDNPIIIQSQHPSQLYCYQSDQCFAFKKSDFLGKAVSYDECCADKTGSWGSQSGSCVSCKANFAGGNDVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDNNNNIFISIHNSIYNGDVTGLCGNADNNPSNDFSNFDNVASFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMGTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKCDGQDDCGDGSDEHGCECICKEPEMILCETERTSTTEERNCQCINGTKQCDGVYDCWNGFDEKNCEIF
Sbjct:    1 MGTKTHTIWQMNFNQLLLSILLYAILTSQSVESDKVLIGVKPKSVTSPNNCIYDYNEDVDTVTESCNKYIGLMMENYNLDEKSVPIAEQYQDPSIPVSKQQSLSMQLYVSSGMPEPQCNFTLQNIVSEENCCVGYENFPYCNISVCYSDNGGCYNGGICMSPNQCKCQENYAGMQCDEDNPIIIQSQHPSQLYCYQSDQCFAFKKSDFLGKAVSYDECCADKTGSWGSQSGSCVSCKANFAGGNDVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDNNNNIFISIHNSIYNGDVTGLCGNADNNPSNDFSNFDNVASFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMGTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKCDGQDDCGDGSDEHGCECICKEPEMILCETERTSTTEERNCQCINGTKQCDGVYDCWNGFDEKNCEIF 1676          
BLAST of SCO-spondin vs. Planmine SMEST
Match: SMESG000042718.1 (SMESG000042718.1)

HSP 1 Score: 3129.35 bits (8112), Expect = 0.000e+0
Identity = 1517/1517 (100.00%), Postives = 1517/1517 (100.00%), Query Frame = 3
Query:  489 MSPNQCKCQENYAGMQCDEDNPIIIQSQHPSQLYCYQSDQCFAFKKSDFLGKAVSYDECCADKTGSWGSQSGSCVSCKANFAGGNDVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVASFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMGTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNCEIF 5039
            MSPNQCKCQENYAGMQCDEDNPIIIQSQHPSQLYCYQSDQCFAFKKSDFLGKAVSYDECCADKTGSWGSQSGSCVSCKANFAGGNDVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDNNNNIFISIHNSIYNGDVTGLCGNADNNPSNDFSNFDNVASFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMGTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKCDGQDDCGDGSDEHGCECICKEPEMILCETERTSTTEERNCQCINGTKQCDGVYDCWNGFDEKNCEIF
Sbjct:    1 MSPNQCKCQENYAGMQCDEDNPIIIQSQHPSQLYCYQSDQCFAFKKSDFLGKAVSYDECCADKTGSWGSQSGSCVSCKANFAGGNDVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDNNNNIFISIHNSIYNGDVTGLCGNADNNPSNDFSNFDNVASFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMGTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKCDGQDDCGDGSDEHGCECICKEPEMILCETERTSTTEERNCQCINGTKQCDGVYDCWNGFDEKNCEIF 1517          
BLAST of SCO-spondin vs. Planmine SMEST
Match: SMESG000042718.1 (SMESG000042718.1)

HSP 1 Score: 3128.19 bits (8109), Expect = 0.000e+0
Identity = 1517/1517 (100.00%), Postives = 1517/1517 (100.00%), Query Frame = 3
Query:  489 MSPNQCKCQENYAGMQCDEDNPIIIQSQHPSQLYCYQSDQCFAFKKSDFLGKAVSYDECCADKTGSWGSQSGSCVSCKANFAGGNDVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVASFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMGTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNCEIF 5039
            MSPNQCKCQENYAGMQCDEDNPIIIQSQHPSQLYCYQSDQCFAFKKSDFLGKAVSYDECCADKTGSWGSQSGSCVSCKANFAGGNDVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDNNNNIFISIHNSIYNGDVTGLCGNADNNPSNDFSNFDNVASFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMGTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKCDGQDDCGDGSDEHGCECICKEPEMILCETERTSTTEERNCQCINGTKQCDGVYDCWNGFDEKNCEIF
Sbjct:    1 MSPNQCKCQENYAGMQCDEDNPIIIQSQHPSQLYCYQSDQCFAFKKSDFLGKAVSYDECCADKTGSWGSQSGSCVSCKANFAGGNDVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDNNNNIFISIHNSIYNGDVTGLCGNADNNPSNDFSNFDNVASFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMGTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKCDGQDDCGDGSDEHGCECICKEPEMILCETERTSTTEERNCQCINGTKQCDGVYDCWNGFDEKNCEIF 1517          
BLAST of SCO-spondin vs. Planmine SMEST
Match: SMESG000042718.1 (SMESG000042718.1)

HSP 1 Score: 3127.81 bits (8108), Expect = 0.000e+0
Identity = 1517/1517 (100.00%), Postives = 1517/1517 (100.00%), Query Frame = 3
Query:  489 MSPNQCKCQENYAGMQCDEDNPIIIQSQHPSQLYCYQSDQCFAFKKSDFLGKAVSYDECCADKTGSWGSQSGSCVSCKANFAGGNDVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVASFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMGTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNCEIF 5039
            MSPNQCKCQENYAGMQCDEDNPIIIQSQHPSQLYCYQSDQCFAFKKSDFLGKAVSYDECCADKTGSWGSQSGSCVSCKANFAGGNDVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDNNNNIFISIHNSIYNGDVTGLCGNADNNPSNDFSNFDNVASFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMGTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKCDGQDDCGDGSDEHGCECICKEPEMILCETERTSTTEERNCQCINGTKQCDGVYDCWNGFDEKNCEIF
Sbjct:    1 MSPNQCKCQENYAGMQCDEDNPIIIQSQHPSQLYCYQSDQCFAFKKSDFLGKAVSYDECCADKTGSWGSQSGSCVSCKANFAGGNDVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDNNNNIFISIHNSIYNGDVTGLCGNADNNPSNDFSNFDNVASFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMGTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKCDGQDDCGDGSDEHGCECICKEPEMILCETERTSTTEERNCQCINGTKQCDGVYDCWNGFDEKNCEIF 1517          
BLAST of SCO-spondin vs. Planmine SMEST
Match: SMESG000042718.1 (SMESG000042718.1)

HSP 1 Score: 3127.42 bits (8107), Expect = 0.000e+0
Identity = 1517/1517 (100.00%), Postives = 1517/1517 (100.00%), Query Frame = 3
Query:  489 MSPNQCKCQENYAGMQCDEDNPIIIQSQHPSQLYCYQSDQCFAFKKSDFLGKAVSYDECCADKTGSWGSQSGSCVSCKANFAGGNDVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDXXXXXXXXXXXXXXXGDVTGLCGXXXXXXXXXXXXXXXVASFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMGTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKXXXXXXXXXXXXEHGCECICKEPEMILCXXXXXXXXXXXNCQCINGTKQCDGVYDCWNGFDEKNCEIF 5039
            MSPNQCKCQENYAGMQCDEDNPIIIQSQHPSQLYCYQSDQCFAFKKSDFLGKAVSYDECCADKTGSWGSQSGSCVSCKANFAGGNDVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDNNNNIFISIHNSIYNGDVTGLCGNADNNPSNDFSNFDNVASFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMGTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKCDGQDDCGDGSDEHGCECICKEPEMILCETERTSTTEERNCQCINGTKQCDGVYDCWNGFDEKNCEIF
Sbjct:    1 MSPNQCKCQENYAGMQCDEDNPIIIQSQHPSQLYCYQSDQCFAFKKSDFLGKAVSYDECCADKTGSWGSQSGSCVSCKANFAGGNDVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLRQDNFILLSLEAGNIKLKWDNNNNIFISIHNSIYNGDVTGLCGNADNNPSNDFSNFDNVASFGNSFKGFGCPDIANTLSTCKPDDQILANQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPSTCGIMGTQFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSYITGSCDNTPQSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCDDGKCIESSKICDKVTDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISCGCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKCDGQDDCGDGSDEHGCECICKEPEMILCETERTSTTEERNCQCINGTKQCDGVYDCWNGFDEKNCEIF 1517          
The following BLAST results are available for this feature:
BLAST of SCO-spondin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MUC5AC3.548e-10826.48mucin 5AC, oligomeric mucus/gel-forming [Source:HG... [more]
MUC5AC3.548e-10826.48mucin 5AC, oligomeric mucus/gel-forming [Source:HG... [more]
MUC21.583e-9225.39mucin 2, oligomeric mucus/gel-forming [Source:HGNC... [more]
MUC24.693e-9225.41mucin 2, oligomeric mucus/gel-forming [Source:HGNC... [more]
MUC27.042e-9225.49mucin 2, oligomeric mucus/gel-forming [Source:NCBI... [more]
back to top
BLAST of SCO-spondin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrp-29.198e-1636.40Low-density lipoprotein RecePtor related [Source:... [more]
lrp-12.433e-1533.98Low-density lipoprotein receptor-related protein ... [more]
egg-21.058e-1436.49LDL receptor repeat-containing protein egg-2 [Sou... [more]
egg-21.058e-1436.49LDL receptor repeat-containing protein egg-2 [Sou... [more]
egg-12.031e-1134.98LDL receptor repeat-containing protein egg-1 [Sou... [more]
back to top
BLAST of SCO-spondin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hml4.596e-9225.15gene:FBgn0029167 transcript:FBtr0333020[more]
Hml5.464e-9225.15gene:FBgn0029167 transcript:FBtr0075753[more]
trol5.837e-1935.29gene:FBgn0284408 transcript:FBtr0342805[more]
trol1.859e-1835.29gene:FBgn0284408 transcript:FBtr0342810[more]
trol1.970e-1835.29gene:FBgn0284408 transcript:FBtr0342819[more]
back to top
BLAST of SCO-spondin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scospondin7.192e-16129.84subcommissural organ spondin [Source:ZFIN;Acc:ZDB-... [more]
otog7.730e-9326.30otogelin [Source:ZFIN;Acc:ZDB-GENE-120228-1][more]
CABZ01080550.18.907e-9025.54pep chromosome:GRCz11:25:8269956:8292650:1 gene:EN... [more]
otogl1.931e-8725.71otogelin-like [Source:ZFIN;Acc:ZDB-GENE-050419-93][more]
vwf2.738e-8725.08von Willebrand factor [Source:ZFIN;Acc:ZDB-GENE-07... [more]
back to top
BLAST of SCO-spondin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000006505.11.563e-16830.09SCO-spondin [Source:NCBI gene;Acc:100497129][more]
ndufs83.134e-10326.08NADH:ubiquinone oxidoreductase core subunit S8 [So... [more]
ndufs81.619e-10225.78NADH:ubiquinone oxidoreductase core subunit S8 [So... [more]
ndufs81.542e-10125.89NADH:ubiquinone oxidoreductase core subunit S8 [So... [more]
ndufs82.411e-10125.80NADH:ubiquinone oxidoreductase core subunit S8 [So... [more]
back to top
BLAST of SCO-spondin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sspo7.486e-13527.56SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311][more]
Sspo1.105e-13427.56SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311][more]
Sspo2.381e-12428.95SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311][more]
Muc5ac4.696e-11228.20mucin 5, subtypes A and C, tracheobronchial/gastri... [more]
Muc5ac7.403e-11128.20mucin 5, subtypes A and C, tracheobronchial/gastri... [more]
back to top
BLAST of SCO-spondin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2PC93|SSPO_CHICK7.016e-16429.43SCO-spondin OS=Gallus gallus OX=9031 GN=SSPO PE=2 ... [more]
sp|Q700K0|SSPO_RAT7.537e-13828.00SCO-spondin OS=Rattus norvegicus OX=10116 GN=Sspo ... [more]
sp|Q8CG65|SSPO_MOUSE1.666e-12328.95SCO-spondin OS=Mus musculus OX=10090 GN=Sspo PE=2 ... [more]
sp|A2VEC9|SSPO_HUMAN1.876e-12028.00SCO-spondin OS=Homo sapiens OX=9606 GN=SSPO PE=2 S... [more]
sp|P98167|SSPO_BOVIN3.339e-11127.53SCO-spondin OS=Bos taurus OX=9913 GN=SSPO PE=2 SV=... [more]
back to top
BLAST of SCO-spondin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FQZ00.000e+040.21Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FNX50.000e+040.21Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IM200.000e+037.72Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FR151.656e-2139.86Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FD043.378e-2637.12Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of SCO-spondin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scospondin9.635e-15428.47subcommissural organ spondin [Source:ZFIN;Acc:ZDB-... [more]
vwf3.594e-9025.37von Willebrand factor [Source:NCBI gene;Acc:103041... [more]
otog2.235e-8926.17otogelin [Source:ZFIN;Acc:ZDB-GENE-120228-1][more]
ENSAMXT00000041370.11.785e-8725.99pep primary_assembly:Astyanax_mexicanus-2.0:5:1809... [more]
ENSAMXT00000019204.27.618e-8625.50pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of SCO-spondin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010519.11.908e-8527.94pep scaffold:Pmarinus_7.0:GL477612:23664:47127:1 g... [more]
ENSPMAT00000008773.16.082e-8226.75pep scaffold:Pmarinus_7.0:GL476328:703641:749596:1... [more]
ENSPMAT00000008716.16.043e-7826.87pep scaffold:Pmarinus_7.0:GL476328:595486:663084:-... [more]
ENSPMAT00000008652.11.359e-7528.46pep scaffold:Pmarinus_7.0:GL477625:577100:586386:1... [more]
ENSPMAT00000009153.18.296e-3929.53pep scaffold:Pmarinus_7.0:GL479660:8329:29413:-1 g... [more]
back to top
BLAST of SCO-spondin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SCO-spondin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO441991.304e-6825.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418775.978e-5133.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418761.473e-3426.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330618.492e-2324.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494989.552e-2043.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SCO-spondin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scospondin1.469e-10629.88SCO-spondin [Source:NCBI gene;Acc:101172449][more]
vwf1.791e-9426.74von Willebrand factor [Source:NCBI gene;Acc:101162... [more]
otog1.716e-7727.30otogelin [Source:NCBI gene;Acc:101158818][more]
FCGBP1.836e-6123.61Fc fragment of IgG binding protein [Source:NCBI ge... [more]
zanl2.278e-5724.46zonadhesin [Source:NCBI gene;Acc:101162078][more]
back to top
BLAST of SCO-spondin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042718.10.000e+0100.00SMESG000042718.1[more]
SMESG000042718.10.000e+0100.00SMESG000042718.1[more]
SMESG000042718.10.000e+0100.00SMESG000042718.1[more]
SMESG000042718.10.000e+0100.00SMESG000042718.1[more]
SMESG000042718.10.000e+0100.00SMESG000042718.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008350 ID=SMED30008350|Name=SCO-spondin|organism=Schmidtea mediterranea sexual|type=transcript|length=5142bp
AGATCATTGAAATGGGAACCAAAACTCATACTATTTGGCAAATGAATTTC
AATCAACTTTTACTCTCAATATTGCTTTATGCTATACTAACGAGTCAATC
TGTTGAATCAGACAAAGTTTTAATTGGAGTTAAACCAAAATCAGTTACAT
CTCCAAACAATTGTATATATGATTACAATGAAGATGTTGATACCGTCACA
GAGTCATGCAACAAATACATTGGCTTGATGATGGAAAACTACAACTTGGA
CGAAAAATCAGTGCCTATCGCTGAGCAGTACCAAGATCCTTCAATTCCTG
TTTCGAAACAGCAATCATTATCCATGCAGCTCTACGTCAGTAGCGGTATG
CCCGAACCTCAATGCAATTTTACTTTACAAAATATCGTCAGTGAAGAAAA
TTGTTGCGTCGGTTATGAAAATTTCCCATACTGCAATATATCGGTTTGTT
ATTCCGATAACGGGGGTTGCTATAATGGAGGAATCTGCATGTCACCAAAC
CAATGCAAATGCCAAGAAAATTATGCTGGTATGCAATGTGATGAAGACAA
TCCTATCATAATTCAAAGTCAACATCCTTCTCAACTTTATTGTTACCAAA
GTGATCAATGCTTTGCATTCAAAAAGTCAGACTTTCTCGGAAAAGCGGTT
TCATATGACGAATGCTGTGCCGATAAAACAGGATCATGGGGTAGTCAGTC
AGGCTCATGTGTATCCTGTAAAGCGAACTTTGCAGGAGGTAATGATGTGA
ATAACGAGAATTTTACAACTTGTCACAGCTATGGATTGGACTATTATCGT
ACATTCGACAATCAACTATACACCTATCAAGGAAGATGTTCATACATTTT
AACGGCACCATCAGACGTTTCTGCTGTAACTTGGTCAATCAATATTGTAT
ATGAAAACTGTACTTCTGATACTGGATGTGTTAAGGTCATTGTTATCGAA
GCCGGCGACGTTGTTGTTAAAAGTTCCGGTAATGGTATTCTCTATACAAC
TGATTCAAACAACCCATTAACACCATTATCAGTTACCAACACTGACAGCG
CTCTAATTATACCAGGAACTCCTATGTATGTACTAAGACAAGACAACTTC
ATATTACTATCATTAGAAGCAGGAAATATAAAATTAAAATGGGACAATAA
TAACAACATTTTTATTTCGATACATAATTCAATATATAACGGGGACGTAA
CTGGTTTGTGCGGTAATGCAGACAATAATCCTAGCAATGACTTCAGCAAC
TTCGACAATGTAGCTTCATTTGGAAATTCATTCAAAGGATTTGGATGTCC
TGATATTGCAAACACTCTTTCAACTTGCAAACCTGACGATCAAATATTAG
CAAATCAACAGTGTAGCAAAATAAGACTCAAATTTCCCGGATGTGCAGAT
TTAGTTAATTCTGATACCTATTTTTCTATGTGTGTACAAAACATCTGCAC
AAAATCCCAGAACTCAAATACCACTCTGGACATTCCAAGCATTTCCGATG
TATTATGCACTCATTTATCAGCATATTCAGATTCCTGTTCAGACAAAGGC
TCGTGTATCCAATGGAGAAGCGATACTCTTTGTGAAACTCAATGCCCTGG
AAATAAAATATGGTCAGACTGTGCTTCTGAATGTCCAGTTACATGTAGAA
ATCTTTTCCAAACACCAAGTGCATACTGTCAGAATTCAAAAGTCGGACGA
TGTATATGTGGTTCAGGTGAAGTGGAATATGGATATACTTGTATTAAACC
AGAAAGCTGTCCATGTCTATATGATGGTCAAGAGCATCCTCCTGGAACTG
TCAGACAATTCGATTGTAACACATGTACTTGTAATTCTTCACTTTGGCAC
TGCACAGAAAAAATATGTCCATCAACTTGTGGAATAATGGGGACTCAGTT
TGATACATTTGATGGGGCAAAATTTGCTTTTAATGACGTAGGATGTCAAT
ATGTTGCTGTTGAGCCCTCAGTGAATAATACAGATGATAGAGCTAATGTG
TTTGTAATCATTCAAAGTAATACAGAAAGTATGCTGGGTACGGAAGGAAA
TTCTGCATATATAAATGAACCAAAAATTGTGACTGTAAAAGTGAATGGAT
CAGATATTATTTTAAAAGCTACATCACCGCAATTGGGAGATTCTCAGACC
AATGTATTTATTGATGGAGAAGATCACACCACGAAACTACCATTTACCAT
ACCGGATAAAAATATTCACGTTAGAAAATTGACAAATATTTATACCGAAG
TTAAAGTCAGTAGTCATTTTAAATTATACTTTGATGGCAGCAAATCTATT
TATATCAAAGTCAGCGATGCTTTAAAAAATAATTTAATCGGATTATGTGG
GAAATTTGATGGAAACTCAGAAAATGATTTCACGGAAAAAGATAATTCAA
TCCGTGAATCAATCGTCAATATTGCAAAATCATATATAACGGGTTCATGT
GACAATACACCTCAATCTATTGTTGACCCACCCGCGGGAGATAATGACAT
TTGTTCGACAATTCTAAATGGTCCCGAATTCAGCGGCTGCATGAACAGCA
GTAAAGTAGACAAAGAATTTTATGCAACCTATTGCCGCCGAGAACAATCG
TCAAATAAAGACCAACTATCATACTGTTCGGCAATTCTTAATGCAGCTAT
TGCATGTAGACGATTTGGCATCCAATATGAAGTACCTTTTACATCGAATA
TCCTACAAGCATGCATTCCATTGTGTCAAGCTGGAGGAACAGTTTTCCAA
ATATGTTCTCGCACTTGTCAAAGTACATGTCGAGAATTAAATGAAGCTAC
GGCTAGTAAATGCGATGACGATTGTTTTCCTGGATGCGAATGCCCACCGA
ATTATTATAAAACTGGAACAGGACAATGTGTTTCAGAGTCTGAATGTACC
TGCTGGAACCCTTCAAGACCAAAAGATCCTGAAATTCCTGCAGGAACGAA
TATTACTATCAACTGTCAAACTTGTGTATGTATTAACGGAAGATTGAATT
GCAAAACCAAAGATAATTGTACTAATCCAGTGTGCCCAAAAAATCAAGTC
TATATGGATTCTGTAAGTGGCTGCAATAGTTGTACGAATTACGATACCTG
CACCGATACTTCTTCAATTGCTAATTCATGTGGCTGTCCCAATGATACCG
TTTCAAAAATAGATGGAACCTGCGTTCAACCATCTGATTGTCCATGCATC
TACATGAATCGAGAATACGCACCGAATGATGTCATTACAATTAAATGTGC
AAAATATATTTGTTCAAACAGAATGTGGAATCTTTTGTCTGAAGAAACAG
CAAACTGCGAGGCTGTTTGCATAGCCTATGGCGATCCACATTACAAGACC
TTGGATGGTCAAATGTTTTCATTTCAAGGAAGTTGCATGTATACACTGAT
GGATACTCCAGGGGATTCATCAAACAATATTCCACCAATTACAATTTCTG
TTGCCAATATCGCTTGCGGATTTAGTCTGGCAACATGCGCTAAATTTGTA
CAAATCATAATTGGAGGTCAAACCTATCTATTATCAAGAGGAAATAATGA
CACCATTCCATTGTTTCCAAAATACGACATAGTTATAGAACAGCTGACAT
TCTTCACCCAACTTGTTAGTGATTCGATTGGTCTACGAGTGTTATGGGAC
AGAAGCACGCGAGTTTACCTGTTTTTGAAACCCTCATTTCAAGGAAATGT
GCAAGGTCTTTGCGGTAACTATGACGGAGATCTTCAAAATGAATATATGC
ATGGAACAATGAAATATGAAGACGCAATACAATTCGCTGAATCTTTTATC
GCAAATGCAGATATTTGTCCTTATGAAATTTCTCCCGAAAACAATGTAGC
TCCTTCAAAAGAGCAAGATATGTGCAACGCTAATCCTGATAGAAAAAGTT
GGGCCGAACAAATGTGTGGGGTGATGAAAGATACCAATGGTGTTTTTGCA
TCCTGCATTGAAGCAATGCATCAAGATGTTAACAGATACTACAGTAATTG
TTTGTATGATGCATGCGGATGCAATCGTGGAGGTGATTGCGAGTGTCTTT
GTACCTCTTTAGCAACATTTGCAACACAATGTGCGTTTCTCGGAATTCCA
GTTAAATGGCGAACTCAGAACTTGTGCCCTATAATGTGCGAAGGTGGAAA
GCATTACGATGCTTGTGCATCTCCGTGCCCACAAACTTGTGATACGATTG
GTTCTAATGCACCTTCACACTGTAGTACAACCCATTGTGTTGAGGGTTGC
TCATGTCCTAATGGAATGATAGATCTTAACGGAGAATGTGTTCCACCAAC
AACCTGTCCTTGTTTCTATAACGGTCAAAGTTATGTTAATGGCGCTATTA
TTAAAATGGAAAATTGTAAAAAATGTCAATGTGTACAAGCTAAATTCAAT
TGCACAGAAGACTACAGCGACTGTATAACGACATGTACACCAAGCCAATT
CCGTTGTGACGATGGAAAATGCATTGAATCTAGCAAGATATGCGATAAAG
TTACTGATTGTTCAAATTCGGAAGATGAGAAAAACTGCAATGTGTGTGAT
CTACAACAATTTCAATGCATTTCGAATGGAGCTTGCATCCCAATGACAAA
AAAGTGTGATGGAACTCAAAACTGCGAAGATAATTCCGATGAAATATCTT
GTGGATGTTTACCGCATCAAATTGTGTGTAATATATCAAGAACATGCATA
GAAGAAAAAAAAATATGCGATGGAAATTATGACTGCGGAGTTAATGACAA
ATCAGATGAGGAAAACTGTAAAAAATGCCAGATGACAGAATACAAATGTA
ATAATAGCCAAATTTGTATATTGTTAAATAACAAATGTGATGGCCAAGAC
GACTGTGGGGACGGAAGTGACGAACACGGATGTGAATGCATATGCAAAGA
ACCAGAAATGATACTGTGCGAAACAGAAAGAACCTCTACAACGGAAGAAA
GAAACTGTCAATGTATAAATGGAACTAAACAATGTGACGGAGTATATGAT
TGTTGGAATGGTTTTGACGAAAAGAATTGTGAAATATTCACAAGTTCCAT
TTCGACAATAACAACTGAGAGTAAAACTGAAACTGAGACAACAGCTTCAA
AATATACAACGTCAACCTCGAAAACAACAACAATTCCAACAC
back to top

protein sequence of SMED30008350-orf-1

>SMED30008350-orf-1 ID=SMED30008350-orf-1|Name=SMED30008350-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1713bp
IIEMGTKTHTIWQMNFNQLLLSILLYAILTSQSVESDKVLIGVKPKSVTS
PNNCIYDYNEDVDTVTESCNKYIGLMMENYNLDEKSVPIAEQYQDPSIPV
SKQQSLSMQLYVSSGMPEPQCNFTLQNIVSEENCCVGYENFPYCNISVCY
SDNGGCYNGGICMSPNQCKCQENYAGMQCDEDNPIIIQSQHPSQLYCYQS
DQCFAFKKSDFLGKAVSYDECCADKTGSWGSQSGSCVSCKANFAGGNDVN
NENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVY
ENCTSDTGCVKVIVIEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSA
LIIPGTPMYVLRQDNFILLSLEAGNIKLKWDNNNNIFISIHNSIYNGDVT
GLCGNADNNPSNDFSNFDNVASFGNSFKGFGCPDIANTLSTCKPDDQILA
NQQCSKIRLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDV
LCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRN
LFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQEHPPGTV
RQFDCNTCTCNSSLWHCTEKICPSTCGIMGTQFDTFDGAKFAFNDVGCQY
VAVEPSVNNTDDRANVFVIIQSNTESMLGTEGNSAYINEPKIVTVKVNGS
DIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDKNIHVRKLTNIYTEV
KVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSI
RESIVNIAKSYITGSCDNTPQSIVDPPAGDNDICSTILNGPEFSGCMNSS
KVDKEFYATYCRREQSSNKDQLSYCSAILNAAIACRRFGIQYEVPFTSNI
LQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPN
YYKTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNC
KTKDNCTNPVCPKNQVYMDSVSGCNSCTNYDTCTDTSSIANSCGCPNDTV
SKIDGTCVQPSDCPCIYMNREYAPNDVITIKCAKYICSNRMWNLLSEETA
NCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISV
ANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDIVIEQLTF
FTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYMH
GTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSW
AEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLC
TSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIG
SNAPSHCSTTHCVEGCSCPNGMIDLNGECVPPTTCPCFYNGQSYVNGAII
KMENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCDDGKCIESSKICDKV
TDCSNSEDEKNCNVCDLQQFQCISNGACIPMTKKCDGTQNCEDNSDEISC
GCLPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCN
NSQICILLNNKCDGQDDCGDGSDEHGCECICKEPEMILCETERTSTTEER
NCQCINGTKQCDGVYDCWNGFDEKNCEIFTSSISTITTESKTETETTASK
YTTSTSKTTTIPT
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000418head
PLANA:0000419prepharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR036055LDL_receptor-like_sf
IPR030119SCO-spondin
IPR036084Ser_inhib-like_sf
IPR002172LDrepeatLR_classA_rpt
IPR014853Unchr_dom_Cys-rich
IPR001846VWF_type-D
IPR002919TIL_dom
IPR013032EGF-like_CS
IPR000742EGF-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005615extracellular space
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
GO:0007399nervous system development
GO:0030154cell differentiation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPRINTSPR00261LDLRECEPTORcoord: 717..738
score: 30.71
coord: 757..778
score: 48.67
coord: 680..701
score: 51.22
coord: 642..663
score: 42.13
coord: 806..827
score: 43.13
IPR002172Low-density lipoprotein (LDL) receptor class A repeatSMARTSM00192LDLa_2coord: 784..832
e-value: 0.016
score: 20.3
coord: 631..667
e-value: 2.0E-9
score: 47.3
coord: 668..704
e-value: 1.3E-6
score: 37.9
coord: 745..783
e-value: 9.2E-11
score: 51.8
coord: 705..744
e-value: 6.3E-5
score: 32.4
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPFAMPF00057Ldl_recept_acoord: 630..666
e-value: 1.5E-8
score: 34.7
coord: 669..704
e-value: 3.4E-8
score: 33.6
coord: 744..781
e-value: 4.8E-9
score: 36.3
coord: 706..743
e-value: 8.7E-6
score: 25.9
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 631..667
score: 13.262
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 745..782
score: 12.85
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 668..705
score: 12.775
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 705..744
score: 8.663
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 784..831
score: 9.975
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 706..743
e-value: 9.09843E-4
score: 35.6454
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 669..704
e-value: 1.84344E-6
score: 42.9642
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 746..781
e-value: 3.55764E-6
score: 42.1938
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 632..666
e-value: 5.67722E-8
score: 47.2014
IPR001846von Willebrand factor, type D domainSMARTSM00216VWD_2coord: 246..410
e-value: 2.2E-28
score: 110.3
IPR001846von Willebrand factor, type D domainPFAMPF00094VWDcoord: 260..403
e-value: 6.4E-22
score: 78.5
IPR001846von Willebrand factor, type D domainPROSITEPS51233VWFDcoord: 259..475
score: 31.564
IPR014853Uncharacterised domain, cysteine-richSMARTSM00832c8_acoord: 452..530
e-value: 2.5E-25
score: 100.2
IPR014853Uncharacterised domain, cysteine-richPFAMPF08742C8coord: 458..529
e-value: 2.6E-15
score: 56.6
IPR002919Trypsin Inhibitor-like, cysteine rich domainPFAMPF01826TILcoord: 533..589
e-value: 2.0E-9
score: 37.6
coord: 64..119
e-value: 2.6E-6
score: 27.6
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 707..748
e-value: 4.5E-8
score: 35.1
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 629..667
e-value: 2.4E-10
score: 42.1
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 668..706
e-value: 7.9E-11
score: 43.6
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 749..783
e-value: 3.5E-10
score: 41.6
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 668..707
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 805..832
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 745..783
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 629..666
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 158..257
e-value: 1.0E-11
score: 47.0
coord: 52..157
e-value: 2.6E-12
score: 49.0
coord: 521..628
e-value: 2.1E-20
score: 75.0
NoneNo IPR availableGENE3DG3DSA:2.40.128.620coord: 792..865
e-value: 3.2E-6
score: 29.5
NoneNo IPR availablePANTHERPTHR11339EXTRACELLULAR MATRIX GLYCOPROTEIN RELATEDcoord: 717..856
NoneNo IPR availablePANTHERPTHR11339EXTRACELLULAR MATRIX GLYCOPROTEIN RELATEDcoord: 5..743
IPR030119SCO-spondinPANTHERPTHR11339:SF358SCO-SPONDINcoord: 5..743
IPR030119SCO-spondinPANTHERPTHR11339:SF358SCO-SPONDINcoord: 717..856
IPR036084Serine protease inhibitor-like superfamilySUPERFAMILYSSF57567Serine protease inhibitorscoord: 528..591
IPR036084Serine protease inhibitor-like superfamilySUPERFAMILYSSF57567Serine protease inhibitorscoord: 164..218
IPR036084Serine protease inhibitor-like superfamilySUPERFAMILYSSF57567Serine protease inhibitorscoord: 65..119