Histone-lysine N-methyltransferase SETMAR

Overview
NameHistone-lysine N-methyltransferase SETMAR
Smed IDSMED30008349
Length (bp)2843
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone-lysine N-methyltransferase SETMAR (SMED30008349) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone-lysine N-methyltransferase SETMAR (SMED30008349) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone-lysine N-methyltransferase SETMAR (SMED30008349) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone-lysine N-methyltransferase SETMAR (SMED30008349) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Human
Match: SETMAR (SET domain and mariner transposase fusion gene [Source:HGNC Symbol;Acc:HGNC:10762])

HSP 1 Score: 93.2041 bits (230), Expect = 8.269e-38
Identity = 56/205 (27.32%), Postives = 100/205 (48.78%), Query Frame = 2
Query:  209 IRIRRFEMNFAREDIRKLIYYNWKRGLVPSQIANEINLTLGKDTTNERSCRHWVANFKEGNFDVEDKERCGRPSLDINDKILALLEEH--NSTVEMSVEIGVCQQTIRNHLLAMVMRYLCNHWVPHKLSEQQMANREKICNELLCKYAANDFLSQLITMDEVWIYWSNDVTYHYRSWRGAGDVRDGEVRRTLSPRKNLNAVFWDV 817
            + +   +M   ++ IR +  + +K G   ++    IN   G  T NER+ + W   F +G+  +ED+ER GRPS   ND++ A++E     +T E++ E+ V   T+  HL  +      + WVPH+L+E Q   R ++ + L+ +     FL +++T DE WI + N        W    +      +  L P+K +  ++W  
Sbjct:  198 LTLETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDN--RRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSA 400          

HSP 2 Score: 58.5362 bits (140), Expect = 8.269e-38
Identity = 24/73 (32.88%), Postives = 46/73 (63.01%), Query Frame = 3
Query: 1041 NPPYSQDLALCDFYLFAPLKSTIRGRDFNGADEIQVVLDAWLDSKPRSFFADGIRKLPDRWRRCVLHNGAYFE 1259
            +PPYS DL   ++++F  L + ++G+ F+   + +     +++S+   F+A GI +L  RW++CV  NG+YF+
Sbjct:  473 HPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 545          

HSP 3 Score: 48.1358 bits (113), Expect = 8.269e-38
Identity = 25/75 (33.33%), Postives = 44/75 (58.67%), Query Frame = 1
Query:  823 GVIIMDILPQGTTITTDVYCEQLSLLVTAIQQMRRRLLGGGFHQIHYIHDNARPHTAAKSVQKLTDIGFTVQPIP 1047
            G+I    L  G TIT++ Y +++  +   +Q+++  L+      +  +HDNARPH A  ++QKL ++G+ V P P
Sbjct:  402 GLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPIL--LHDNARPHVAQPTLQKLNELGYEVLPHP 474          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Human
Match: SETMAR (SET domain and mariner transposase fusion gene [Source:HGNC Symbol;Acc:HGNC:10762])

HSP 1 Score: 92.8189 bits (229), Expect = 1.009e-37
Identity = 56/205 (27.32%), Postives = 100/205 (48.78%), Query Frame = 2
Query:  209 IRIRRFEMNFAREDIRKLIYYNWKRGLVPSQIANEINLTLGKDTTNERSCRHWVANFKEGNFDVEDKERCGRPSLDINDKILALLEEH--NSTVEMSVEIGVCQQTIRNHLLAMVMRYLCNHWVPHKLSEQQMANREKICNELLCKYAANDFLSQLITMDEVWIYWSNDVTYHYRSWRGAGDVRDGEVRRTLSPRKNLNAVFWDV 817
            + +   +M   ++ IR +  + +K G   ++    IN   G  T NER+ + W   F +G+  +ED+ER GRPS   ND++ A++E     +T E++ E+ V   T+  HL  +      + WVPH+L+E Q   R ++ + L+ +     FL +++T DE WI + N        W    +      +  L P+K +  ++W  
Sbjct:  337 LTLETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDN--RRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSA 539          

HSP 2 Score: 58.5362 bits (140), Expect = 1.009e-37
Identity = 24/73 (32.88%), Postives = 46/73 (63.01%), Query Frame = 3
Query: 1041 NPPYSQDLALCDFYLFAPLKSTIRGRDFNGADEIQVVLDAWLDSKPRSFFADGIRKLPDRWRRCVLHNGAYFE 1259
            +PPYS DL   ++++F  L + ++G+ F+   + +     +++S+   F+A GI +L  RW++CV  NG+YF+
Sbjct:  612 HPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 684          

HSP 3 Score: 48.1358 bits (113), Expect = 1.009e-37
Identity = 25/75 (33.33%), Postives = 44/75 (58.67%), Query Frame = 1
Query:  823 GVIIMDILPQGTTITTDVYCEQLSLLVTAIQQMRRRLLGGGFHQIHYIHDNARPHTAAKSVQKLTDIGFTVQPIP 1047
            G+I    L  G TIT++ Y +++  +   +Q+++  L+      +  +HDNARPH A  ++QKL ++G+ V P P
Sbjct:  541 GLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPIL--LHDNARPHVAQPTLQKLNELGYEVLPHP 613          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Human
Match: SETMAR (SET domain and mariner transposase fusion gene [Source:HGNC Symbol;Acc:HGNC:10762])

HSP 1 Score: 60.8474 bits (146), Expect = 1.082e-9
Identity = 34/111 (30.63%), Postives = 59/111 (53.15%), Query Frame = 2
Query:  209 IRIRRFEMNFAREDIRKLIYYNWKRGLVPSQIANEINLTLGKDTTNERSCRHWVANFKEGNFDVEDKERCGRPSLDINDKILALLEEH--NSTVEMSVEIGVCQQTIRNHL 535
            + +   +M   ++ IR +  + +K G   ++    IN   G  T NER+ + W   F +G+  +ED+ER GRPS   ND++ A++E     +T E++ E+ V   T+  HL
Sbjct:  101 LTLETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHL 211          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. UniProt/SwissProt
Match: sp|Q53H47|SETMR_HUMAN (Histone-lysine N-methyltransferase SETMAR OS=Homo sapiens OX=9606 GN=SETMAR PE=1 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 4.483e-37
Identity = 56/205 (27.32%), Postives = 100/205 (48.78%), Query Frame = 2
Query:  209 IRIRRFEMNFAREDIRKLIYYNWKRGLVPSQIANEINLTLGKDTTNERSCRHWVANFKEGNFDVEDKERCGRPSLDINDKILALLEEH--NSTVEMSVEIGVCQQTIRNHLLAMVMRYLCNHWVPHKLSEQQMANREKICNELLCKYAANDFLSQLITMDEVWIYWSNDVTYHYRSWRGAGDVRDGEVRRTLSPRKNLNAVFWDV 817
            + +   +M   ++ IR +  + +K G   ++    IN   G  T NER+ + W   F +G+  +ED+ER GRPS   ND++ A++E     +T E++ E+ V   T+  HL  +      + WVPH+L+E Q   R ++ + L+ +     FL +++T DE WI + N        W    +      +  L P+K +  ++W  
Sbjct:  337 LTLETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDN--RRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSA 539          

HSP 2 Score: 58.5362 bits (140), Expect = 4.483e-37
Identity = 24/73 (32.88%), Postives = 46/73 (63.01%), Query Frame = 3
Query: 1041 NPPYSQDLALCDFYLFAPLKSTIRGRDFNGADEIQVVLDAWLDSKPRSFFADGIRKLPDRWRRCVLHNGAYFE 1259
            +PPYS DL   ++++F  L + ++G+ F+   + +     +++S+   F+A GI +L  RW++CV  NG+YF+
Sbjct:  612 HPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 684          

HSP 3 Score: 48.1358 bits (113), Expect = 4.483e-37
Identity = 25/75 (33.33%), Postives = 44/75 (58.67%), Query Frame = 1
Query:  823 GVIIMDILPQGTTITTDVYCEQLSLLVTAIQQMRRRLLGGGFHQIHYIHDNARPHTAAKSVQKLTDIGFTVQPIP 1047
            G+I    L  G TIT++ Y +++  +   +Q+++  L+      +  +HDNARPH A  ++QKL ++G+ V P P
Sbjct:  541 GLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPIL--LHDNARPHVAQPTLQKLNELGYEVLPHP 613          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. UniProt/SwissProt
Match: sp|Q7JQ07|MOS1T_DROMA (Mariner Mos1 transposase OS=Drosophila mauritiana OX=7226 GN=mariner\T PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 2.625e-35
Identity = 50/166 (30.12%), Postives = 82/166 (49.40%), Query Frame = 2
Query:  323 TLGKDTTNERSCRHWVANFKEGNFDVEDKERCGRPSLDINDKILALLEEHNSTVE--MSVEIGVCQQTIRNHLLAMVMRYLCNHWVPHKLSEQQMANREKICNELLCKYAANDFLSQLITMDEVWIYWSNDVTYHYRSWRGAGDVRDGEVRRTLSPRKNLNAVFWD 814
              G+     + C  W   FK G+FDV+DKE    P    + ++ ALL+E ++  +  ++ ++ V QQ + N L  M        WVPH+L+E+QM  R+  C  LL +Y    FL +++T DE WI++ +      +S+   G       R     +K +  V+WD
Sbjct:   35 AFGEQVPTVKKCERWFQRFKSGDFDVDDKEHGKPPKRYEDAELQALLDEDDAQTQKQLAEQLEVSQQAVSNRLREMGKIQKVGRWVPHELNERQMERRKNTCEILLSRYKRKSFLHRIVTGDEKWIFFVS--PKRKKSYVDPGQPATSTARPNRFGKKTMLCVWWD 198          

HSP 2 Score: 60.8474 bits (146), Expect = 2.625e-35
Identity = 27/70 (38.57%), Postives = 41/70 (58.57%), Query Frame = 3
Query: 1050 YSQDLALCDFYLFAPLKSTIRGRDFNGADEIQVVLDAWLDSKPRSFFADGIRKLPDRWRRCVLHNGAYFE 1259
            YS DLA  D++LFA +   +  + F+  + ++  LD W  +K   F+  GI KLP+RW +CV  +G Y E
Sbjct:  276 YSPDLAPSDYHLFASMGHALAEQRFDSYESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYLE 345          

HSP 3 Score: 41.5874 bits (96), Expect = 2.625e-35
Identity = 25/73 (34.25%), Postives = 38/73 (52.05%), Query Frame = 1
Query:  823 GVIIMDILPQGTTITTDVYCEQLSLLVTAIQQMRRRLLGGGFHQIHYIHDNARPHTAAKSVQKLTDIGFTVQP 1041
            GVI  ++L +G T+ T  Y +QL  L  A+Q+ R        H++ ++HDNA  HTA      L  + + V P
Sbjct:  201 GVIYYELLKRGETVNTARYQQQLINLNRALQRKRPEYQKRQ-HRVIFLHDNAPSHTARAVRDTLETLNWEVLP 272          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Match: A0A023F643 (Putative transposase (Fragment) OS=Triatoma infestans OX=30076 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 1.602e-41
Identity = 60/191 (31.41%), Postives = 96/191 (50.26%), Query Frame = 2
Query:  248 DIRKLIYYNWKRGLVPSQIANEINLTLGKDTTNERSCRHWVANFKEGNFDVEDKERCGRPSLDINDKILALLEEHN--STVEMSVEIGVCQQTIRNHLLAMVMRYLCNHWVPHKLSEQQMANREKICNELLCKYAANDFLSQLITMDEVWIYWSNDVTYHYRSWRGAGDVRDGEVRRTLSPRKNLNAVFWD 814
            +I  ++ + WK+    ++ A EIN   G+   +ER+ R W   F  G+  +E K+  GRPSLDI+D +   ++ +   ST +++ E G  + T+  HL +M     C+  VPH+L+ QQ   R +IC  LL       F  +++T DE W+YW N  T     W   G        R    +K++  VFW+
Sbjct:    1 EILVVLRHYWKKSCSAAEAAREINRIEGEGLLDERTARRWFQKFLSGDTTLERKKGSGRPSLDIDDALQETVDSNPAISTRDLARECGASKDTVCRHLHSMGKVKRCSRLVPHELTPQQSTKRVEICKNLLMYPTDLRFYKKIVTCDEKWVYWRNPDTSG--QWLSQGQTAFPVAVRGQFEKKSMLCVFWN 189          

HSP 2 Score: 68.9366 bits (167), Expect = 1.602e-41
Identity = 28/74 (37.84%), Postives = 48/74 (64.86%), Query Frame = 3
Query: 1041 NPPYSQDLALCDFYLFAPLKSTIRGRDFNGADEIQVVLDAWLDSKPRSFFADGIRKLPDRWRRCVLHNGAYFEH 1262
            +PPYS DLA  DFYLF  +   ++G+ F+   E++  +  + DS P+ ++  GI++L +RW+  + +NG YFE+
Sbjct:  264 HPPYSPDLAPSDFYLFRSMAHFLKGKRFDTFQEVETAVQEFFDSHPKEWYQQGIKQLAERWQATIDNNGLYFEY 337          

HSP 3 Score: 50.8322 bits (120), Expect = 1.602e-41
Identity = 27/76 (35.53%), Postives = 43/76 (56.58%), Query Frame = 1
Query:  823 GVIIMDILPQGTTITTDVYCEQLSLLVTAIQQMRRRLLGGGFHQIHYIHDNARPHTAAKSVQKLTDI-GFTVQPIP 1047
            GVI  + +P GTTI +D+YCEQL  +   + Q    L+      + +  DNARPHT+ ++ +K  ++ G  + P P
Sbjct:  192 GVIHHEFVPDGTTINSDLYCEQLDRVYAKLSQRYPALVNR--KGVLFQQDNARPHTSRQTKEKFKNLDGIELLPHP 265          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Match: A0A023F551 (Putative transposase (Fragment) OS=Triatoma infestans OX=30076 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 1.767e-41
Identity = 60/191 (31.41%), Postives = 96/191 (50.26%), Query Frame = 2
Query:  248 DIRKLIYYNWKRGLVPSQIANEINLTLGKDTTNERSCRHWVANFKEGNFDVEDKERCGRPSLDINDKILALLEEHN--STVEMSVEIGVCQQTIRNHLLAMVMRYLCNHWVPHKLSEQQMANREKICNELLCKYAANDFLSQLITMDEVWIYWSNDVTYHYRSWRGAGDVRDGEVRRTLSPRKNLNAVFWD 814
            +I  ++ + WK+    ++ A EIN   G+   +ER+ R W   F  G+  +E K+  GRPSLDI+D +   ++ +   ST +++ E G  + T+  HL +M     C+  VPH+L+ QQ   R +IC  LL       F  +++T DE W+YW N  T     W   G        R    +K++  VFW+
Sbjct:    6 EILVVLRHYWKKSCSAAEAAREINRIEGEGLLDERTARRWFQKFLSGDTTLERKKGSGRPSLDIDDALQETVDSNPAISTRDLARECGASKDTVCRHLHSMGKVKRCSRLVPHELTPQQSTKRVEICKNLLMYPTDLRFYKKIVTCDEKWVYWRNPDTSG--QWLSQGQTAFPVAVRGQFEKKSMLCVFWN 194          

HSP 2 Score: 68.5514 bits (166), Expect = 1.767e-41
Identity = 28/73 (38.36%), Postives = 47/73 (64.38%), Query Frame = 3
Query: 1041 NPPYSQDLALCDFYLFAPLKSTIRGRDFNGADEIQVVLDAWLDSKPRSFFADGIRKLPDRWRRCVLHNGAYFE 1259
            +PPYS DLA  DFYLF  +   ++G+ F+   E++  +  + DS P+ ++  GI++L +RW+  + +NG YFE
Sbjct:  269 HPPYSPDLAPSDFYLFRSMAHFLKGKRFDTFQEVETAVQEFFDSHPKEWYQQGIKQLAERWQATIDNNGLYFE 341          

HSP 3 Score: 50.8322 bits (120), Expect = 1.767e-41
Identity = 27/76 (35.53%), Postives = 43/76 (56.58%), Query Frame = 1
Query:  823 GVIIMDILPQGTTITTDVYCEQLSLLVTAIQQMRRRLLGGGFHQIHYIHDNARPHTAAKSVQKLTDI-GFTVQPIP 1047
            GVI  + +P GTTI +D+YCEQL  +   + Q    L+      + +  DNARPHT+ ++ +K  ++ G  + P P
Sbjct:  197 GVIHHEFVPDGTTINSDLYCEQLDRVYAKLSQRYPALVNR--KGVLFQQDNARPHTSRQTKEKFKNLDGIELLPHP 270          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Match: A0A4Q0MJF7 (Uncharacterized protein OS=Desulfovibrio sp. DS-1 OX=2497683 GN=EKK70_17340 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 3.151e-41
Identity = 55/157 (35.03%), Postives = 83/157 (52.87%), Query Frame = 2
Query:  350 RSCRHWVANFKEGNFDVEDKERCGRPSLDINDKILALLEE--HNSTVEMSVEIGVCQQTIRNHLLAMVMRYLCNHWVPHKLSEQQMANREKICNELLCKYAANDFLSQLITMDEVWIYWSNDVTYHYRSWRGAGDVRDGEVRRTLSPRKNLNAVFWD 814
            R  + W   F+ GNFD++D  R GRP  D  D I   +E+  H S+ +++ E+G+  +T+  HL         + WVPH+L+E+ + NR  IC+ LL +     FL +LIT DE WI +  +V    RSW  AG       +  L+  K +  V+WD
Sbjct:    2 RVAQIWFKRFQSGNFDIKDARRSGRPVTDKIDAIFEKVEQDRHISSYDVAGELGIDHKTVLAHLKKAGYTKKLDIWVPHELTERNLMNRVLICDSLLRRNETEPFLKKLITGDEKWITYDKNV--RKRSWSKAGQASQTVAKPGLTRNKVMLCVWWD 156          

HSP 2 Score: 63.5438 bits (153), Expect = 3.151e-41
Identity = 27/72 (37.50%), Postives = 44/72 (61.11%), Query Frame = 3
Query: 1041 NPPYSQDLALCDFYLFAPLKSTIRGRDFNGADEIQVVLDAWLDSKPRSFFADGIRKLPDRWRRCVLHNGAYF 1256
            +PPYS DLA  DF+LF  L++++        ++ Q  L  + D KP++F+++GI  LP RW++ +  NG Y 
Sbjct:  230 HPPYSPDLAPSDFHLFRSLQNSLGSVRLTSREDCQNHLSQFFDQKPQNFYSNGITSLPTRWQKVIQQNGTYI 301          

HSP 3 Score: 60.077 bits (144), Expect = 3.151e-41
Identity = 31/74 (41.89%), Postives = 45/74 (60.81%), Query Frame = 1
Query:  823 GVIIMDILPQGTTITTDVYCEQLSLLVTAIQQMRRRLL---GGGFHQIHYIHDNARPHTAAKSVQKLTDIGFTV 1035
            G+I  ++LP G TI +++YCEQL  L   +++ R  L+   G  FH     HDNARPHT+  + QKL + G+ V
Sbjct:  159 GIIHYELLPPGRTIDSELYCEQLMRLKQKVERKRPELINRRGVVFH-----HDNARPHTSLATQQKLREFGWEV 227          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Match: A0A024FR99 (Transposase OS=Amegilla dulcifera OX=598022 GN=mariner PE=4 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.236e-40
Identity = 53/190 (27.89%), Postives = 95/190 (50.00%), Query Frame = 2
Query:  251 IRKLIYYNWKRGLVPSQIANEINLTLGKDTTNERSCRHWVANFKEGNFDVEDKERCGRPSLDINDKILALLEE--HNSTVEMSVEIGVCQQTIRNHLLAMVMRYLCNHWVPHKLSEQQMANREKICNELLCKYAANDFLSQLITMDEVWIYWSNDVTYHYRSWRGAGDVRDGEVRRTLSPRKNLNAVFWD 814
             R ++ Y +++G   SQ   ++    G +   ER CR+W   F+ G+F +++ +R GRP       I A+++   H++T +++ ++ V    I   L  +      + W+PH+L E  +  R  IC+ LL +   + FL  L+T DE WI + N+VT   RSW           +  +  +K + +V+WD
Sbjct:    8 FRHILLYYFRKGKNASQAQKKLCAVYGDEALKERQCRNWFERFRSGDFSLKNAQRSGRPVEVDETHIKAIIDSDRHSTTRDIAEKLNVSHTCIEKKLKTLGYVKKLDLWIPHQLKEIHLTQRISICDSLLKRNENDPFLKNLVTGDEKWIVY-NNVT-RKRSWVKQDQPAQTASKAEIHQKKIMLSVWWD 195          

HSP 2 Score: 70.0922 bits (170), Expect = 1.236e-40
Identity = 29/75 (38.67%), Postives = 51/75 (68.00%), Query Frame = 3
Query: 1032 CSANPPYSQDLALCDFYLFAPLKSTIRGRDFNGADEIQVVLDAWLDSKPRSFFADGIRKLPDRWRRCVLHNGAYF 1256
             S++PPYS DLA  D++LF  +++++ G+ FN AD+++  L  + +SK ++F+  GI  LP+RW++ +  NG Y 
Sbjct:  266 VSSHPPYSPDLAPSDYHLFRSMQNSLNGKIFNNADDVRSHLIQFFNSKDQTFYERGIFTLPERWKKVIDKNGQYL 340          

HSP 3 Score: 58.9214 bits (141), Expect = 1.236e-40
Identity = 32/78 (41.03%), Postives = 46/78 (58.97%), Query Frame = 1
Query:  823 GVIIMDILPQGTTITTDVYCEQLSLLVTAIQQMRRRL---LGGGFHQIHYIHDNARPHTAAKSVQKLTDIGFTVQPIP 1047
            G++  +++PQ  TI ++VY EQL  L  AI++ R  L    G  FH     HDNARPHT+  + QKL ++G+ V   P
Sbjct:  198 GILYFELMPQNQTINSNVYVEQLDKLKDAIEEKRPVLSNRKGVVFH-----HDNARPHTSLVTRQKLLELGWDVSSHP 270          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Match: A0A0J7KP80 (Transposase OS=Lasius niger OX=67767 GN=RF55_7904 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 3.053e-40
Identity = 56/185 (30.27%), Postives = 90/185 (48.65%), Query Frame = 2
Query:  269 YNWKRGLVPSQIANEINLTLGKDTTNERSCRHWVANFKEGNFDVEDKERCGRPSLDINDKILALLE--EHNSTVEMSVEIGVCQQTIRNHLLAMVMRYLCNHWVPHKLSEQQMANREKICNELLCKYAANDFLSQLITMDEVWIYWSNDVTYHYRSWRGAGDVRDGEVRRTLSPRKNLNAVFWDV 817
            Y++  GL  ++ A+ I    G D   ER  R W A F+  NF V+D +R GRP     D+I+ L++   H +  E+   + V   ++  HL         + WVPH+LS++ +  R   C+ LL K   + FL ++IT DE WI ++N      RSW           +    P+K +  ++WD+
Sbjct:    3 YHFHEGLNAAETAHRICTVYGPDALKERVVRKWFARFRAENFSVKDAKRSGRPHTVDTDEIITLVDANSHLTVEEIRKYVNVSHGSVVKHLRDAGYVSRADVWVPHELSDRNLQQRLDACDLLLKKNEEHPFLKKMITGDEKWIVYNN--VKRRRSWGPKNSRSQTTAKAGFHPKKMMLCIWWDI 185          

HSP 2 Score: 61.6178 bits (148), Expect = 3.053e-40
Identity = 28/72 (38.89%), Postives = 46/72 (63.89%), Query Frame = 3
Query: 1041 NPPYSQDLALCDFYLFAPLKSTIRGRDFNGADEIQVVLDAWLDSKPRSFFADGIRKLPDRWRRCVLHNGAYF 1256
            +PPYS DLA  D YLF  L++++ G++F   D +++ L+ +   KP++F+  GI  LP+RW + +   GAY 
Sbjct:  258 HPPYSPDLAPSD-YLFRSLQNSLDGKNFPNPDAMKIHLERFFAEKPKTFWEKGILDLPNRWAKVITQKGAYI 328          

HSP 3 Score: 59.6918 bits (143), Expect = 3.053e-40
Identity = 31/78 (39.74%), Postives = 43/78 (55.13%), Query Frame = 1
Query:  823 GVIIMDILPQGTTITTDVYCEQLSLLVTAIQQMRRRLL---GGGFHQIHYIHDNARPHTAAKSVQKLTDIGFTVQPIP 1047
            GV+  ++LP+  TI    YCEQL  L  A+ + R  L    G  FH     HDNARPHT+ ++ +KL +  + V P P
Sbjct:  187 GVVYYELLPENQTINAAKYCEQLDRLREAVAKKRPELANRRGVTFH-----HDNARPHTSLRTREKLLEFSWDVLPHP 259          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Planmine SMEST
Match: SMESG000017253.1 (SMESG000017253.1)

HSP 1 Score: 334.339 bits (856), Expect = 6.341e-109
Identity = 178/179 (99.44%), Postives = 179/179 (100.00%), Query Frame = 2
Query: 2216 MAMDGFVSAFHQXXXXXXXXXXXXXLNHYCEENNLKRNFTEKWLSLFDHDHDKIIHYEEFCRALGIESKRRYSNASAGNDDIVVFKETDMSNATKDAIIRKIYRKGKHEYNLKEDNIKDIIEELNMDHGPNWNVIVNPTEKEVKCCYDFDGKLYYSPNVKGKNKLLVWRIEEKKKKGLA 2752
            MAMDGFVSAFHQVDVDDDGIINEDDLNHYCEENNLKRNFTEKWLSLFDHD+DKIIHYEEFCRALGIESKRRYSNASAGNDDIVVFKETDMSNATKDAIIRKIYRKGKHEYNLKEDNIKDIIEELNMDHGPNWNVIVNPTEKEVKCCYDFDGKLYYSPNVKGKNKLLVWRIEEKKKKGLA
Sbjct:    1 MAMDGFVSAFHQVDVDDDGIINEDDLNHYCEENNLKRNFTEKWLSLFDHDNDKIIHYEEFCRALGIESKRRYSNASAGNDDIVVFKETDMSNATKDAIIRKIYRKGKHEYNLKEDNIKDIIEELNMDHGPNWNVIVNPTEKEVKCCYDFDGKLYYSPNVKGKNKLLVWRIEEKKKKGLA 179          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Planmine SMEST
Match: SMESG000017253.1 (SMESG000017253.1)

HSP 1 Score: 329.331 bits (843), Expect = 4.308e-107
Identity = 176/177 (99.44%), Postives = 177/177 (100.00%), Query Frame = 2
Query: 2222 MDGFVSAFHQXXXXXXXXXXXXXLNHYCEENNLKRNFTEKWLSLFDHDHDKIIHYEEFCRALGIESKRRYSNASAGNDDIVVFKETDMSNATKDAIIRKIYRKGKHEYNLKEDNIKDIIEELNMDHGPNWNVIVNPTEKEVKCCYDFDGKLYYSPNVKGKNKLLVWRIEEKKKKGLA 2752
            MDGFVSAFHQVDVDDDGIINEDDLNHYCEENNLKRNFTEKWLSLFDHD+DKIIHYEEFCRALGIESKRRYSNASAGNDDIVVFKETDMSNATKDAIIRKIYRKGKHEYNLKEDNIKDIIEELNMDHGPNWNVIVNPTEKEVKCCYDFDGKLYYSPNVKGKNKLLVWRIEEKKKKGLA
Sbjct:    1 MDGFVSAFHQVDVDDDGIINEDDLNHYCEENNLKRNFTEKWLSLFDHDNDKIIHYEEFCRALGIESKRRYSNASAGNDDIVVFKETDMSNATKDAIIRKIYRKGKHEYNLKEDNIKDIIEELNMDHGPNWNVIVNPTEKEVKCCYDFDGKLYYSPNVKGKNKLLVWRIEEKKKKGLA 177          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Planmine SMEST
Match: SMESG000040468.1 (SMESG000040468.1)

HSP 1 Score: 181.415 bits (459), Expect = 1.128e-52
Identity = 85/93 (91.40%), Postives = 88/93 (94.62%), Query Frame = 2
Query:  230 MNFAREDIRKLIYYNWKRGLVPSQIANEINLTLGKDTTNERSCRHWVANFKEGNFDVEDKERCGRPSLDINDKILALLEEHNSTVEMSVEIGV 508
            MNFAREDIRKLIYYNWKRGLVPSQI NEINLTLGKDTTNER+CR WV NFKEGNFDVEDKERCGRPS+DINDKIL LLEEHNSTVE+SVE GV
Sbjct:    1 MNFAREDIRKLIYYNWKRGLVPSQIENEINLTLGKDTTNERTCRRWVVNFKEGNFDVEDKERCGRPSIDINDKILTLLEEHNSTVEVSVEHGV 93          

HSP 2 Score: 95.1301 bits (235), Expect = 1.518e-22
Identity = 52/97 (53.61%), Postives = 63/97 (64.95%), Query Frame = 1
Query:  784 QEKSQCRLLGCDLGVIIMDILPQGTTITTDVYCEQ----LSLLVTAIQQMRRRLLGGGFHQIHYIHDNARPHTAAKSVQKLTDIGFTVQPIPLTPKT 1062
            ++K +C     D+   I+ +L +  + T +V  E     LS LVTAIQQ RRR LGG FHQIHY+HDNAR HTAAKSVQ LTDIGF V P P   +T
Sbjct:   58 EDKERCGRPSIDINDKILTLLEEHNS-TVEVSVEHGVFLLSSLVTAIQQKRRRFLGGEFHQIHYLHDNARVHTAAKSVQNLTDIGFAVLPHPPYSQT 153          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Planmine SMEST
Match: SMESG000068326.1 (SMESG000068326.1)

HSP 1 Score: 147.132 bits (370), Expect = 1.092e-39
Identity = 73/122 (59.84%), Postives = 88/122 (72.13%), Query Frame = 2
Query:  287 LVPSQIANEINLTLGKDTTNERSCRHWVANFKEGNFDVEDKERCGRPSLDINDKILALLEEHNSTVEMSVEIGVCQQTIRNHLLAMVMRYLCNHWVPHKLSEQQMANREKICNELLCKYAAN 652
              PSQ+A + + T         +     ++++ G+     KER  RPSLDI+DKILALLEEHNS VEMSV++GV QQ IRNHLLAM MRYLCNHWVPH+LSEQQMAN EKICN+L CKYA +
Sbjct:   95 FAPSQLAYQASTTNPTPVATPSTIPS--SSYRPGH-----KERFARPSLDIDDKILALLEEHNSIVEMSVDLGVSQQIIRNHLLAMGMRYLCNHWVPHRLSEQQMANYEKICNDLPCKYAVS 209          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Planmine SMEST
Match: SMESG000049199.1 (SMESG000049199.1)

HSP 1 Score: 143.28 bits (360), Expect = 2.730e-39
Identity = 67/84 (79.76%), Postives = 73/84 (86.90%), Query Frame = 3
Query: 1026 FYCSANPPYSQDLALCDFYLFAPLKSTIRGRDFNGADEIQVVLDAWLDSKPRSFFADGIRKLPDRWRRCVLHNGAYFEHLSDTD 1277
            F    +PPYS DLA  DFYLF+PLKS+IRGRDFNG +EIQVVLDA  +SKPRSFFADGIRKLPDRWRRCVLH+GAYFEH SDTD
Sbjct:   65 FTVLLHPPYSPDLATSDFYLFSPLKSSIRGRDFNGDNEIQVVLDAGFNSKPRSFFADGIRKLPDRWRRCVLHSGAYFEHFSDTD 148          

HSP 2 Score: 116.316 bits (290), Expect = 7.035e-30
Identity = 61/89 (68.54%), Postives = 68/89 (76.40%), Query Frame = 1
Query:  835 MDILPQGTTITTDVYCEQLSLLVTAIQQMRRRLLGGGFHQIHYIHDNARPHTAAKSVQKLTDIGFTV--QPIPLTPKTSHYAIFICLPL 1095
            M+ILPQGTTIT DVY EQLS LVTAIQ  RRRLLGGGFH+IHY+  NARPHTAAKSVQKL DIGFTV   P P +P  +    ++  PL
Sbjct:    1 MNILPQGTTITADVYYEQLSRLVTAIQHKRRRLLGGGFHKIHYLQYNARPHTAAKSVQKLIDIGFTVLLHP-PYSPDLATSDFYLFSPL 88          
The following BLAST results are available for this feature:
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SETMAR8.269e-3827.32SET domain and mariner transposase fusion gene [So... [more]
SETMAR1.009e-3727.32SET domain and mariner transposase fusion gene [So... [more]
SETMAR1.082e-930.63SET domain and mariner transposase fusion gene [So... [more]
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q53H47|SETMR_HUMAN4.483e-3727.32Histone-lysine N-methyltransferase SETMAR OS=Homo ... [more]
sp|Q7JQ07|MOS1T_DROMA2.625e-3530.12Mariner Mos1 transposase OS=Drosophila mauritiana ... [more]
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A023F6431.602e-4131.41Putative transposase (Fragment) OS=Triatoma infest... [more]
A0A023F5511.767e-4131.41Putative transposase (Fragment) OS=Triatoma infest... [more]
A0A4Q0MJF73.151e-4135.03Uncharacterized protein OS=Desulfovibrio sp. DS-1 ... [more]
A0A024FR991.236e-4027.89Transposase OS=Amegilla dulcifera OX=598022 GN=mar... [more]
A0A0J7KP803.053e-4030.27Transposase OS=Lasius niger OX=67767 GN=RF55_7904 ... [more]
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017253.16.341e-10999.44SMESG000017253.1[more]
SMESG000017253.14.308e-10799.44SMESG000017253.1[more]
SMESG000040468.11.128e-5291.40SMESG000040468.1[more]
SMESG000068326.11.092e-3959.84SMESG000068326.1[more]
SMESG000049199.12.730e-3979.76SMESG000049199.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008349 ID=SMED30008349|Name=Histone-lysine N-methyltransferase SETMAR|organism=Schmidtea mediterranea sexual|type=transcript|length=2843bp
GTCCGGTGCTCATACTCAGCTTTCCAATGCTGTAATGAGTGTATAGGTCT
GCAACTTTGTGTGTCTATGCTATATATGTTGTAGATTTGTAAAATTAAAA
AAAATCACTTATTAATAATTTTTAACATTGCTATTAACTTTGATATGTCT
TACATGGATTAAGCACTTTTAATAAATTTCTTGTTTGACTGAAATACTTT
TTGTTTTCATTAGAATACGTCGATTTGAAATGAATTTCGCACGAGAGGAT
ATCCGCAAGTTAATCTACTACAATTGGAAACGTGGATTAGTGCCTTCCCA
GATTGCAAATGAAATAAATTTGACACTGGGGAAGGACACAACAAATGAGC
GCTCTTGTCGACACTGGGTTGCAAACTTCAAGGAGGGAAACTTTGATGTT
GAAGACAAAGAGCGATGTGGGAGGCCCTCTCTTGATATCAACGACAAAAT
TCTAGCTCTTTTGGAGGAGCACAACAGTACTGTGGAAATGAGCGTGGAGA
TTGGAGTTTGTCAGCAGACAATTCGAAATCATCTGCTTGCAATGGTCATG
CGTTACCTGTGCAACCACTGGGTCCCACACAAGTTGTCCGAGCAACAAAT
GGCCAACCGTGAGAAAATATGCAACGAGCTTCTGTGCAAGTATGCTGCTA
ATGACTTCCTCAGTCAGCTCATTACAATGGACGAAGTCTGGATCTATTGG
AGCAACGACGTAACCTATCACTACCGTTCGTGGAGAGGCGCAGGTGATGT
CCGTGATGGGGAAGTTCGCCGCACACTCTCACCCAGGAAAAATCTCAATG
CCGTCTTTTGGGATGTGATTTAGGTGTGATTATTATGGATATTCTACCGC
AAGGTACTACAATCACTACCGATGTTTACTGCGAGCAGCTGTCCCTTCTG
GTTACGGCAATACAACAAATGCGACGCCGTCTTCTTGGTGGTGGGTTTCA
TCAAATTCACTATATCCACGACAATGCACGACCTCATACGGCAGCCAAAT
CTGTGCAAAAACTTACTGACATTGGTTTTACTGTTCAGCCAATCCCCCTT
ACTCCCAAGACCTCGCACTATGCGATTTTTATTTGTTTGCCCCTTTGAAA
TCTACGATTCGTGGAAGAGATTTCAACGGAGCTGATGAAATTCAAGTGGT
TCTGGACGCTTGGTTGGACAGTAAACCACGCAGCTTCTTCGCCGATGGAA
TCAGGAAACTGCCTGATCGATGGCGCCGATGTGTCCTTCATAATGGTGCA
TATTTTGAACATCTCTCTGACACAGATGATTGACATTTTTGCTGTTTTTA
AATTTACACATGTTTCACCGGACAAAACTTATTGGTTTATCCTGTATTTC
AAGACTTTATGAAATAGATATGTGTAACGTTTTGTTTCGTTTTTCATATG
ATTTTAACCGCAATAAATTGTTCGACACGATGTACAAAAATATGACTGTA
ATGAAATGGACTTACACTTTTTAGTCTCCGCGTTTTAGTCCTAAGTCCCT
TTGGGTGACTCGCTCAATTTTGTGGCGCCAATATACAAGAAGTTATTCAT
TTTATGGGAATTAAAAGCGATTTGGATGCGTTAATTCTCAAGCTCCTCGC
AGTTCTTTTTACAGTGAATTTTTACAATTGTTTCCTGTGAATCCTTCGAA
TCTGTATGGAGTCTTTTGAGAACCACTGATTTTTACCGACAAATTCCTGT
TTGTCATAAGTGAGTGATTTTCATTAAAGATTTAACTAATCAGATAAACT
ATAAACTTTTCAACTGTTAGAATTACAATGAAATTTATAATTTAAAAAAA
ACCAGAATCAAATTACTCACTCATTTGTCAGTAGGCATTATGATCAAATT
TAGTCAAGTTAAATAACAATTAAAGTCAATTTTTAAACGTCCAATTAGAA
CAGTTTTAAGTTGAACCATTTTTGAGTATGTTTACAACAATCGATAAATC
TGAACGTAAATAATTTAACAATTTGCAGAGTTATTCTAAAATAACAAGTT
AGAAATAAAATTTAGAATAACTGTAGCAAGTGTGCTCAACGTACCGATCA
TTCTAATAAAAAGATTTTTGTTTGCAGAATACATTTCAATTTTTTGTTGA
TCCGATGGATACACAAAGTGAATAGTGCACAAAACATTGATAGACCAATA
GATGAATTGGTACAGTTGTATATAATACTATTTCAATACTTGAAAGAATC
AAATAAACTTTAACAATGGCCATGGATGGATTTGTGTCAGCTTTTCATCA
AGTCGATGTCGATGATGATGGCATCATTAATGAGGACGACTTGAACCATT
ATTGTGAGGAGAACAACTTAAAACGGAATTTTACAGAGAAATGGCTAAGT
CTATTCGATCACGACCACGACAAAATTATTCACTATGAAGAATTTTGCAG
GGCTTTGGGAATAGAATCCAAACGCAGATATAGCAACGCGAGTGCCGGAA
ACGACGACATTGTCGTATTCAAAGAGACCGACATGTCCAATGCAACGAAA
GATGCGATAATCAGAAAGATATATAGAAAAGGAAAACACGAATACAATTT
AAAAGAAGACAATATCAAAGACATCATAGAAGAATTGAACATGGATCATG
GACCAAATTGGAATGTCATTGTGAATCCCACAGAAAAAGAAGTCAAGTGT
TGTTATGATTTCGATGGGAAATTATACTACTCTCCAAATGTAAAAGGAAA
AAACAAACTTTTGGTTTGGAGAATAGAAGAGAAAAAGAAAAAGGGACTGG
CATGCTGTTGTTGTTAAATTTTAGACCTAAACAATTGTTGATGGATTACG
TAATATTTAATAGTTATTTCAAAAATATATTTTGCTTGCATTT
back to top

protein sequence of SMED30008349-orf-1

>SMED30008349-orf-1 ID=SMED30008349-orf-1|Name=SMED30008349-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=198bp
MNFAREDIRKLIYYNWKRGLVPSQIANEINLTLGKDTTNERSCRHWVANF
KEGNFDVEDKERCGRPSLDINDKILALLEEHNSTVEMSVEIGVCQQTIRN
HLLAMVMRYLCNHWVPHKLSEQQMANREKICNELLCKYAANDFLSQLITM
DEVWIYWSNDVTYHYRSWRGAGDVRDGEVRRTLSPRKNLNAVFWDVI*
back to top

protein sequence of SMED30008349-orf-2

>SMED30008349-orf-2 ID=SMED30008349-orf-2|Name=SMED30008349-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=184bp
MAMDGFVSAFHQVDVDDDGIINEDDLNHYCEENNLKRNFTEKWLSLFDHD
HDKIIHYEEFCRALGIESKRRYSNASAGNDDIVVFKETDMSNATKDAIIR
KIYRKGKHEYNLKEDNIKDIIEELNMDHGPNWNVIVNPTEKEVKCCYDFD
GKLYYSPNVKGKNKLLVWRIEEKKKKGLACCCC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008168methyltransferase activity
GO:0016740transferase activity
GO:0005509calcium ion binding
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0032259methylation
GO:0007017microtubule-based process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR001888Transposase_1
IPR011992EF-hand-dom_pair
IPR001372Dynein_light_chain_typ-1/2
IPR002048EF_hand_dom
IPR018247EF_Hand_1_Ca_BS
Vocabulary: cellular component
TermDefinition
GO:0030286dynein complex