26S proteasome regulatory subunit 8

Overview
Name26S proteasome regulatory subunit 8
Smed IDSMED30008320
Length (bp)2129
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 26S proteasome regulatory subunit 8 (SMED30008320) t-SNE clustered cells

Violin plots show distribution of expression levels for 26S proteasome regulatory subunit 8 (SMED30008320) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 26S proteasome regulatory subunit 8 (SMED30008320) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 26S proteasome regulatory subunit 8 (SMED30008320) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008320

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30008320SMESG000066841.1 dd_Smed_v4_1176_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30008320SMESG000066841.1 dd_Smed_v4_1176_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30008320SMESG000066841.1 dd_Smed_v4_1176_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30008320SMESG000066841.1 Contig25911newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30008320SMESG000066841.1 Contig25911uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30008320SMESG000066841.1 PL08001A2H02ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
epidermisSMED30008320SMESG000066841.1 dd_Smed_v4_1176_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Human
Match: PSMC5 (proteasome 26S subunit, ATPase 5 [Source:HGNC Symbol;Acc:HGNC:9552])

HSP 1 Score: 689.878 bits (1779), Expect = 0.000e+0
Identity = 341/388 (87.89%), Postives = 374/388 (96.39%), Query Frame = 1
Query:  217 GIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            G+R YY+SKI+ELQ ++  K+QNLRR +AQRNELN+KVRLLREELQLLQEQGSYVGEV++ ++K KVLVK+HPEGK++VD+DK I+++ VTPN RVALRNDSY LHKILP+KVDPLVSLMMVEKVPDSTYEM+GGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHT+CTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDE+DSIGS+RL+ GSGGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILDSALLRPGRIDRKIEFP PNEEARLDILKIHSRKMNLTRGI+LRKIAELMPGASGAE+KGVCTEAGMYALRERRVHVTQEDFE+AVAK+MQKDSEKN+SIKKLWK
Sbjct:   11 GLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 398          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Human
Match: PSMC5 (proteasome 26S subunit, ATPase 5 [Source:HGNC Symbol;Acc:HGNC:9552])

HSP 1 Score: 689.878 bits (1779), Expect = 0.000e+0
Identity = 341/388 (87.89%), Postives = 374/388 (96.39%), Query Frame = 1
Query:  217 GIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            G+R YY+SKI+ELQ ++  K+QNLRR +AQRNELN+KVRLLREELQLLQEQGSYVGEV++ ++K KVLVK+HPEGK++VD+DK I+++ VTPN RVALRNDSY LHKILP+KVDPLVSLMMVEKVPDSTYEM+GGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHT+CTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDE+DSIGS+RL+ GSGGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILDSALLRPGRIDRKIEFP PNEEARLDILKIHSRKMNLTRGI+LRKIAELMPGASGAE+KGVCTEAGMYALRERRVHVTQEDFE+AVAK+MQKDSEKN+SIKKLWK
Sbjct:   11 GLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 398          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Human
Match: PSMC5 (proteasome 26S subunit, ATPase 5 [Source:HGNC Symbol;Acc:HGNC:9552])

HSP 1 Score: 689.878 bits (1779), Expect = 0.000e+0
Identity = 341/388 (87.89%), Postives = 374/388 (96.39%), Query Frame = 1
Query:  217 GIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            G+R YY+SKI+ELQ ++  K+QNLRR +AQRNELN+KVRLLREELQLLQEQGSYVGEV++ ++K KVLVK+HPEGK++VD+DK I+++ VTPN RVALRNDSY LHKILP+KVDPLVSLMMVEKVPDSTYEM+GGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHT+CTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDE+DSIGS+RL+ GSGGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILDSALLRPGRIDRKIEFP PNEEARLDILKIHSRKMNLTRGI+LRKIAELMPGASGAE+KGVCTEAGMYALRERRVHVTQEDFE+AVAK+MQKDSEKN+SIKKLWK
Sbjct:   11 GLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 398          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Human
Match: PSMC5 (proteasome 26S subunit, ATPase 5 [Source:HGNC Symbol;Acc:HGNC:9552])

HSP 1 Score: 689.108 bits (1777), Expect = 0.000e+0
Identity = 341/388 (87.89%), Postives = 374/388 (96.39%), Query Frame = 1
Query:  217 GIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            G+R YY+SKI+ELQ ++  K+QNLRR +AQRNELN+KVRLLREELQLLQEQGSYVGEV++ ++K KVLVK+HPEGK++VD+DK I+++ VTPN RVALRNDSY LHKILP+KVDPLVSLMMVEKVPDSTYEM+GGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHT+CTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDE+DSIGS+RL+ GSGGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILDSALLRPGRIDRKIEFP PNEEARLDILKIHSRKMNLTRGI+LRKIAELMPGASGAE+KGVCTEAGMYALRERRVHVTQEDFE+AVAK+MQKDSEKN+SIKKLWK
Sbjct:   19 GLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 406          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Human
Match: PSMC5 (proteasome 26S subunit, ATPase 5 [Source:HGNC Symbol;Acc:HGNC:9552])

HSP 1 Score: 414.461 bits (1064), Expect = 5.319e-141
Identity = 210/254 (82.68%), Postives = 237/254 (93.31%), Query Frame = 1
Query:  196 ESSENREGIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGG 957
            E  +   G+R YY+SKI+ELQ ++  K+QNLRR +AQRNELN+KVRLLREELQLLQEQGSYVGEV++ ++K KVLVK+HPEGK++VD+DK I+++ VTPN RVALRNDSY LHKILP+KVDPLVSLMMVEKVPDSTYEM+GGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHT+CTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDE+DSIGS+RL+ GSGG
Sbjct:    4 EEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGG 257          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Celegans
Match: rpt-6 (Proteasome Regulatory Particle, ATPase-like [Source:UniProtKB/TrEMBL;Acc:Q9XTT9])

HSP 1 Score: 648.662 bits (1672), Expect = 0.000e+0
Identity = 323/429 (75.29%), Postives = 366/429 (85.31%), Query Frame = 1
Query:   94 AIEVDPMPSTVQYKTNEQSSKVLYSTNAMLLSNKESSENREGIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            A   DP   T Q  T E   K L                    R Y+ +K+D+ QQ +  K+QN+RR +AQRNELN+KVR+L+EELQ L EQGSYVGEV K ++K KVLVK+HPEGKY+VD+DK I+++ +   +RVALR DSY LHK+LP+KVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELF+ALGIAQPKGVLL+GPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDE+DSIGS+R++  SGGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILD ALLRPGRIDRKIEFPAP+E+AR DILKIHSRKMNL RGI++ KIAE +PGASGAE+K VCTEAGM+ALRERR+HVTQEDFE+AV K+MQKDSEKN+SIKKLWK
Sbjct:    8 ASSADPSKPTAQKLTEESDEKTL--------------------RKYFSTKVDDAQQKVADKSQNVRRLQAQRNELNTKVRMLKEELQQLHEQGSYVGEVSKAMDKKKVLVKVHPEGKYVVDVDKSIDINSLNTGARVALRADSYALHKLLPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLFGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGSSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPAPDEKARADILKIHSRKMNLMRGINMAKIAEQIPGASGAEVKSVCTEAGMFALRERRIHVTQEDFEMAVGKVMQKDSEKNMSIKKLWK 416          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Celegans
Match: F56F11.4 (pep chromosome:WBcel235:III:2858558:2865497:1 gene:WBGene00018991.1 transcript:F56F11.4a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F56F11.4)

HSP 1 Score: 618.231 bits (1593), Expect = 0.000e+0
Identity = 302/395 (76.46%), Postives = 353/395 (89.37%), Query Frame = 1
Query:  196 ESSENREGIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            +++ + + +R Y+ +K+++ +Q + +K+ N+RR  AQ+ ELN KVRLL+EE+  L EQGS+VGEV K ++K KVLVK HP+GKYIVD+   +++S +   +RVALR D+Y +H++LPSKVDPLVSLMMVEKVPDSTYEMVGGLD QIKEIKEVIELPVKHPELF+ALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDE+DSIGS+R++   GGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILDSALLRPGRIDRKIEFPAP+E+AR  ILKIHSRKMNL RGI + KIAE +PGASGAE+K VCTEAGM+ALRERR+HVTQEDFE+AV K+MQKDSEKN+SIKKLWK
Sbjct:   17 DANSDEQTLRPYFKTKVEQAEQTVAEKSINVRRLMAQQKELNGKVRLLKEEISHLHEQGSHVGEVCKAMDKKKVLVKNHPDGKYIVDVAASVDISTLAAGTRVALRADNYAIHEVLPSKVDPLVSLMMVEKVPDSTYEMVGGLDTQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGSRGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPAPDEKARAQILKIHSRKMNLMRGIRMDKIAEQIPGASGAEVKSVCTEAGMFALRERRIHVTQEDFEMAVGKVMQKDSEKNMSIKKLWK 411          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Celegans
Match: F56F11.4 (pep chromosome:WBcel235:III:2858709:2865386:1 gene:WBGene00018991.1 transcript:F56F11.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F56F11.4)

HSP 1 Score: 618.231 bits (1593), Expect = 0.000e+0
Identity = 302/395 (76.46%), Postives = 353/395 (89.37%), Query Frame = 1
Query:  196 ESSENREGIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            +++ + + +R Y+ +K+++ +Q + +K+ N+RR  AQ+ ELN KVRLL+EE+  L EQGS+VGEV K ++K KVLVK HP+GKYIVD+   +++S +   +RVALR D+Y +H++LPSKVDPLVSLMMVEKVPDSTYEMVGGLD QIKEIKEVIELPVKHPELF+ALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDE+DSIGS+R++   GGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILDSALLRPGRIDRKIEFPAP+E+AR  ILKIHSRKMNL RGI + KIAE +PGASGAE+K VCTEAGM+ALRERR+HVTQEDFE+AV K+MQKDSEKN+SIKKLWK
Sbjct:   17 DANSDEQTLRPYFKTKVEQAEQTVAEKSINVRRLMAQQKELNGKVRLLKEEISHLHEQGSHVGEVCKAMDKKKVLVKNHPDGKYIVDVAASVDISTLAAGTRVALRADNYAIHEVLPSKVDPLVSLMMVEKVPDSTYEMVGGLDTQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGSRGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPAPDEKARAQILKIHSRKMNLMRGIRMDKIAEQIPGASGAEVKSVCTEAGMFALRERRIHVTQEDFEMAVGKVMQKDSEKNMSIKKLWK 411          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Celegans
Match: F56F11.4 (pep chromosome:WBcel235:III:2855554:2865386:1 gene:WBGene00018991.1 transcript:F56F11.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F56F11.4)

HSP 1 Score: 617.461 bits (1591), Expect = 0.000e+0
Identity = 302/395 (76.46%), Postives = 353/395 (89.37%), Query Frame = 1
Query:  196 ESSENREGIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            +++ + + +R Y+ +K+++ +Q + +K+ N+RR  AQ+ ELN KVRLL+EE+  L EQGS+VGEV K ++K KVLVK HP+GKYIVD+   +++S +   +RVALR D+Y +H++LPSKVDPLVSLMMVEKVPDSTYEMVGGLD QIKEIKEVIELPVKHPELF+ALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDE+DSIGS+R++   GGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILDSALLRPGRIDRKIEFPAP+E+AR  ILKIHSRKMNL RGI + KIAE +PGASGAE+K VCTEAGM+ALRERR+HVTQEDFE+AV K+MQKDSEKN+SIKKLWK
Sbjct:   38 DANSDEQTLRPYFKTKVEQAEQTVAEKSINVRRLMAQQKELNGKVRLLKEEISHLHEQGSHVGEVCKAMDKKKVLVKNHPDGKYIVDVAASVDISTLAAGTRVALRADNYAIHEVLPSKVDPLVSLMMVEKVPDSTYEMVGGLDTQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGSRGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPAPDEKARAQILKIHSRKMNLMRGIRMDKIAEQIPGASGAEVKSVCTEAGMFALRERRIHVTQEDFEMAVGKVMQKDSEKNMSIKKLWK 432          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Celegans
Match: rpt-1 (26S proteasome regulatory subunit 7 [Source:UniProtKB/Swiss-Prot;Acc:Q18787])

HSP 1 Score: 355.91 bits (912), Expect = 6.892e-116
Identity = 166/309 (53.72%), Postives = 224/309 (72.49%), Query Frame = 1
Query:  412 KVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQ 1338
            + L+ +    K++VDL   +  + +    RV +  + Y +H  LP+K+DP V++M VE+ PD TY  VGG   QI++++EV+E P+ HPE +  LGI  PKGVLLYGPPGTGKTL ARAVA+ T+  FIRV GSELVQK++GEGARMVRELF MAR     +IF DE+D++G  R D G GGD+EVQRTMLEL+NQLDGF+P  NIK++MATNR D LD AL+RPGR+DRK+EF  P+   R  ILKIH+++M++ R I    +A L P ++GAE++ VCTEAGM+A+R RR   T++DF  A+ K+++
Sbjct:  112 RYLINVKQFAKFVVDLADSVAPTDIEEGMRVGVDRNKYQIHLPLPAKIDPTVTMMQVEEKPDVTYSDVGGCKDQIEKLREVVETPLLHPERYVNLGIEPPKGVLLYGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAVGGARFDDGQGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFALPDLAGRAHILKIHAKQMSVERDIRYDLLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAINKVVK 420          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Fly
Match: Rpt6 (gene:FBgn0020369 transcript:FBtr0077189)

HSP 1 Score: 691.804 bits (1784), Expect = 0.000e+0
Identity = 342/389 (87.92%), Postives = 375/389 (96.40%), Query Frame = 1
Query:  214 EGIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            EG R+YYI KI+ELQ ++ +K QNLRR +AQRNELN+KVR+LREELQLLQEQGSYVGEV+KP++K KVLVK+HPEGK++VDLDK I+++ VTPN RVALRN+SY LHKILP+KVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELF+ALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEG+RMVRELFVMAREH+PSIIFMDE+DSIGS+R++SGSGGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILD ALLRPGRIDRKIEFP PNEEARLDILKIHSRKMNLTRGI+LRKIAELMPGASGAE+KGVCTEAGMYALRERRVHVTQEDFE+AVAK+MQKDSEKN+SIKKLWK
Sbjct:   17 EGFRSYYIQKIEELQLVVAEKHQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 405          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Fly
Match: Rpt6R (gene:FBgn0039788 transcript:FBtr0085680)

HSP 1 Score: 654.055 bits (1686), Expect = 0.000e+0
Identity = 326/392 (83.16%), Postives = 362/392 (92.35%), Query Frame = 1
Query:  205 ENREGIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            E  EG  +YY  KI ELQ  + ++ +NL R +AQRNELN KVRLLREELQLLQEQGSY+ EV+KP++K KVLVK+HPEGKY+VD+DK I +  VTP+SRVALRN+SY LHKILP+KVDPLVSLM+VEKVPDSTYEMVGGLDKQI+EIKEVIELPVKHPELF+ALGI QPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEG+RMVRELFVMAREH+PSIIFMDE+DSIGS RL++G+ GDSEVQRTMLELLNQLDGFE T+NIK+IMATNRID+LD ALLRPGRIDRKIEFP PNEEARLDILKIHSRKMNLTRGI+LRKIAE MPGASGAE+KGVCTEAGMYALRERRVHVTQEDFE+AV+K+M KDSEKN+SI+K WK
Sbjct:    9 EGSEGFHSYYTQKISELQFTVNERQKNLLRLQAQRNELNLKVRLLREELQLLQEQGSYIAEVVKPMDKNKVLVKVHPEGKYVVDVDKTINIKDVTPSSRVALRNESYTLHKILPNKVDPLVSLMLVEKVPDSTYEMVGGLDKQIQEIKEVIELPVKHPELFDALGITQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARLETGT-GDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDVLDQALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAEEMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVSKVMMKDSEKNMSIRKFWK 399          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Fly
Match: Rpt1 (gene:FBgn0028687 transcript:FBtr0088947)

HSP 1 Score: 359.762 bits (922), Expect = 2.488e-117
Identity = 168/309 (54.37%), Postives = 224/309 (72.49%), Query Frame = 1
Query:  412 KVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQ 1338
            K ++ +    K++VDL   +  + +    RV +  + Y +H  LP K+DP V++M VE  PD TY  VGG  +QI++++EV+E P+ HPE F  LGI  PKGVLL+GPPGTGKTL ARAVA+ T+  FIRV GSELVQK++GEGARMVRELF MAR     +IF DE+D+IG  R D G+GGD+EVQRTMLEL+NQLDGF+P  NIK++MATNR D LD AL+RPGR+DRK+EF  P+++ R  I KIH+R M++ R I    +A L P ++GAE++ VCTEAGM+A+R RR   T++DF  AV K+++
Sbjct:  110 KYIINVKQFAKFVVDLADSVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEDKPDVTYSDVGGCKEQIEKLREVVETPLLHPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARSKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDQDGRSHIFKIHARSMSVERDIRFDLLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVKKVIK 418          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Fly
Match: Rpt2 (gene:FBgn0015282 transcript:FBtr0084520)

HSP 1 Score: 342.428 bits (877), Expect = 1.296e-110
Identity = 161/324 (49.69%), Postives = 230/324 (70.99%), Query Frame = 1
Query:  379 VGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSE 1350
            VG + + I+    +V      ++ V +   ++  Q+ P   V L +  + +  +L    DP+V++M +EK P  TY  +GGLD QI+EIKE +ELP+ HPE +E +GI  PKGV+LYGPPGTGKTLLA+AVA+ T  TF+RV GSEL+QK++G+G ++VRELF +A EH+PSI+F+DE+D++G+ R DS SGG+ E+QRTMLELLNQLDGF+   ++K+IMATNRI+ LD AL+RPGRIDRKIEFP P+E+ +  I  IH+ +M L   ++L ++       SGA++K +CTEAG+ ALRERR+ VT EDF+ +   ++ +  E
Sbjct:  108 VGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLSELIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKE 431          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Fly
Match: Rpt2 (gene:FBgn0015282 transcript:FBtr0346154)

HSP 1 Score: 342.428 bits (877), Expect = 1.296e-110
Identity = 161/324 (49.69%), Postives = 230/324 (70.99%), Query Frame = 1
Query:  379 VGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSE 1350
            VG + + I+    +V      ++ V +   ++  Q+ P   V L +  + +  +L    DP+V++M +EK P  TY  +GGLD QI+EIKE +ELP+ HPE +E +GI  PKGV+LYGPPGTGKTLLA+AVA+ T  TF+RV GSEL+QK++G+G ++VRELF +A EH+PSI+F+DE+D++G+ R DS SGG+ E+QRTMLELLNQLDGF+   ++K+IMATNRI+ LD AL+RPGRIDRKIEFP P+E+ +  I  IH+ +M L   ++L ++       SGA++K +CTEAG+ ALRERR+ VT EDF+ +   ++ +  E
Sbjct:  108 VGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLSELIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKE 431          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Zebrafish
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-6547])

HSP 1 Score: 691.804 bits (1784), Expect = 0.000e+0
Identity = 343/395 (86.84%), Postives = 377/395 (95.44%), Query Frame = 1
Query:  196 ESSENREGIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            E S+   G+R YY+SKI+ELQ  + +K+QNLRR +AQRNELN+KVRLLREELQLLQEQGSYVGEV++ ++K KVLVK+HPEGK++VD+DK I+++ VTPN RVALRNDSY LHKILP+KVDPLVSLMMVEKVPDSTYEM+GGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHT+CTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDE+DSIGS+RL+ GSGGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILDSALLRPGRIDRKIEFP PNEEARLDILKIHSRKMNLTRGI+LRKIAELMPGASGAE+KGVCTEAGMYALRERRVHVTQEDFE+AVAK+MQKDSEKN+SIKKLWK
Sbjct:   12 EDSKGGSGLRQYYLSKIEELQLTVNEKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 406          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Zebrafish
Match: psmc2 (proteasome 26S subunit, ATPase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1327])

HSP 1 Score: 360.147 bits (923), Expect = 2.294e-117
Identity = 170/309 (55.02%), Postives = 224/309 (72.49%), Query Frame = 1
Query:  412 KVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQ 1338
            K ++ +    K++VDL   +  + +    RV +  + Y +H  LP K+DP V++M VE+ PD TY  VGG  +QI++++EV+E P+ HPE F  LGI  PKGVLL+GPPGTGKTL ARAVA+ T+  FIRV GSELVQK++GEGARMVRELF MAR     +IF DE+D+IG  R D G+GGD+EVQRTMLEL+NQLDGF+P  NIK++MATNR D LD AL+RPGR+DRKIEF  P+ E R  I KIH+R M++ R I    +A L P ++GAE++ VCTEAGM+A+R RR   T++DF  AV K+++
Sbjct:  110 KYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIK 418          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Zebrafish
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:ZFIN;Acc:ZDB-GENE-030131-304])

HSP 1 Score: 346.28 bits (887), Expect = 1.200e-112
Identity = 186/384 (48.44%), Postives = 253/384 (65.89%), Query Frame = 1
Query:  202 SENREGIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEK 1353
            +ENRE     Y  K+ E ++ I  + + LR    Q  EL  +      +L+ LQ  G  VGEV+K + + K +VK     +Y+V   + ++ S++ P +RVAL   +  + + LP +VDPLV  M  E     +Y  +GGL +QI+E++EVIELP+ +PELF+ +GI  PKG LLYGPPGTGKTLLARAVA   +C F++V  S +V K+IGE AR++RE+F  AR+H P IIFMDE+D+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR D LD ALLRPGR+DRKI    PNE+ARLDILKIHS  +     ID   I +L  G +GA+++ VCTEAGM+A+R    +VTQEDF  AV K+   DS+K
Sbjct:    2 AENREKGLQDYRKKLLEHKE-IDGRLKELRE---QLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGSVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIELPNEQARLDILKIHSGPITKHGDIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHEYVTQEDFMKAVRKVA--DSKK 379          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Zebrafish
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:ZFIN;Acc:ZDB-GENE-030131-304])

HSP 1 Score: 346.28 bits (887), Expect = 1.200e-112
Identity = 186/384 (48.44%), Postives = 253/384 (65.89%), Query Frame = 1
Query:  202 SENREGIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEK 1353
            +ENRE     Y  K+ E ++ I  + + LR    Q  EL  +      +L+ LQ  G  VGEV+K + + K +VK     +Y+V   + ++ S++ P +RVAL   +  + + LP +VDPLV  M  E     +Y  +GGL +QI+E++EVIELP+ +PELF+ +GI  PKG LLYGPPGTGKTLLARAVA   +C F++V  S +V K+IGE AR++RE+F  AR+H P IIFMDE+D+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR D LD ALLRPGR+DRKI    PNE+ARLDILKIHS  +     ID   I +L  G +GA+++ VCTEAGM+A+R    +VTQEDF  AV K+   DS+K
Sbjct:    2 AENREKGLQDYRKKLLEHKE-IDGRLKELRE---QLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGSVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIELPNEQARLDILKIHSGPITKHGDIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHEYVTQEDFMKAVRKVA--DSKK 379          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Zebrafish
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:ZFIN;Acc:ZDB-GENE-030131-304])

HSP 1 Score: 346.28 bits (887), Expect = 1.200e-112
Identity = 186/384 (48.44%), Postives = 253/384 (65.89%), Query Frame = 1
Query:  202 SENREGIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEK 1353
            +ENRE     Y  K+ E ++ I  + + LR    Q  EL  +      +L+ LQ  G  VGEV+K + + K +VK     +Y+V   + ++ S++ P +RVAL   +  + + LP +VDPLV  M  E     +Y  +GGL +QI+E++EVIELP+ +PELF+ +GI  PKG LLYGPPGTGKTLLARAVA   +C F++V  S +V K+IGE AR++RE+F  AR+H P IIFMDE+D+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR D LD ALLRPGR+DRKI    PNE+ARLDILKIHS  +     ID   I +L  G +GA+++ VCTEAGM+A+R    +VTQEDF  AV K+   DS+K
Sbjct:    2 AENREKGLQDYRKKLLEHKE-IDGRLKELRE---QLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGSVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIELPNEQARLDILKIHSGPITKHGDIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHEYVTQEDFMKAVRKVA--DSKK 379          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Xenopus
Match: map7 (microtubule associated protein 7 [Source:Xenbase;Acc:XB-GENE-961210])

HSP 1 Score: 688.337 bits (1775), Expect = 0.000e+0
Identity = 344/397 (86.65%), Postives = 378/397 (95.21%), Query Frame = 1
Query:  196 ESSENREGI--RNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            E  E+R GI  R YY+SKI++LQ ++  K+QNLRR +AQRNELN+KVRLLREELQLLQEQGSYVGEV++ ++K KVLVK+HPEGK++VD+DK I+++ VTPN RVALRNDSY LHKILP+KVDPLVSLMMVEKVPDSTYEM+GGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHT+CTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDE+DSIGS+RL+ GSGGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILDSALLRPGRIDRKIEFP PNEEARLDILKIHSRKMNLTRGI+LRKIAELMPGASGAE+KGVCTEAGMYALRERRVHVTQEDFE+AVAK+MQKDSEKN+SIKKLWK
Sbjct:   15 EMDESRGGIGLRQYYLSKIEDLQLVVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 411          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Xenopus
Match: map7 (microtubule associated protein 7 [Source:Xenbase;Acc:XB-GENE-961210])

HSP 1 Score: 688.337 bits (1775), Expect = 0.000e+0
Identity = 344/397 (86.65%), Postives = 378/397 (95.21%), Query Frame = 1
Query:  196 ESSENREGI--RNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            E  E+R GI  R YY+SKI++LQ ++  K+QNLRR +AQRNELN+KVRLLREELQLLQEQGSYVGEV++ ++K KVLVK+HPEGK++VD+DK I+++ VTPN RVALRNDSY LHKILP+KVDPLVSLMMVEKVPDSTYEM+GGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHT+CTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDE+DSIGS+RL+ GSGGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILDSALLRPGRIDRKIEFP PNEEARLDILKIHSRKMNLTRGI+LRKIAELMPGASGAE+KGVCTEAGMYALRERRVHVTQEDFE+AVAK+MQKDSEKN+SIKKLWK
Sbjct:    6 EMDESRGGIGLRQYYLSKIEDLQLVVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 402          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Xenopus
Match: map7 (microtubule associated protein 7 [Source:Xenbase;Acc:XB-GENE-961210])

HSP 1 Score: 687.952 bits (1774), Expect = 0.000e+0
Identity = 344/397 (86.65%), Postives = 378/397 (95.21%), Query Frame = 1
Query:  196 ESSENREGI--RNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            E  E+R GI  R YY+SKI++LQ ++  K+QNLRR +AQRNELN+KVRLLREELQLLQEQGSYVGEV++ ++K KVLVK+HPEGK++VD+DK I+++ VTPN RVALRNDSY LHKILP+KVDPLVSLMMVEKVPDSTYEM+GGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHT+CTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDE+DSIGS+RL+ GSGGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILDSALLRPGRIDRKIEFP PNEEARLDILKIHSRKMNLTRGI+LRKIAELMPGASGAE+KGVCTEAGMYALRERRVHVTQEDFE+AVAK+MQKDSEKN+SIKKLWK
Sbjct:    9 EMDESRGGIGLRQYYLSKIEDLQLVVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 405          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Xenopus
Match: map7 (microtubule associated protein 7 [Source:Xenbase;Acc:XB-GENE-961210])

HSP 1 Score: 687.567 bits (1773), Expect = 0.000e+0
Identity = 344/397 (86.65%), Postives = 378/397 (95.21%), Query Frame = 1
Query:  196 ESSENREGI--RNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            E  E+R GI  R YY+SKI++LQ ++  K+QNLRR +AQRNELN+KVRLLREELQLLQEQGSYVGEV++ ++K KVLVK+HPEGK++VD+DK I+++ VTPN RVALRNDSY LHKILP+KVDPLVSLMMVEKVPDSTYEM+GGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHT+CTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDE+DSIGS+RL+ GSGGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILDSALLRPGRIDRKIEFP PNEEARLDILKIHSRKMNLTRGI+LRKIAELMPGASGAE+KGVCTEAGMYALRERRVHVTQEDFE+AVAK+MQKDSEKN+SIKKLWK
Sbjct:   12 EMDESRGGIGLRQYYLSKIEDLQLVVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 408          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Xenopus
Match: map7 (microtubule associated protein 7 [Source:Xenbase;Acc:XB-GENE-961210])

HSP 1 Score: 687.567 bits (1773), Expect = 0.000e+0
Identity = 344/397 (86.65%), Postives = 378/397 (95.21%), Query Frame = 1
Query:  196 ESSENREGI--RNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            E  E+R GI  R YY+SKI++LQ ++  K+QNLRR +AQRNELN+KVRLLREELQLLQEQGSYVGEV++ ++K KVLVK+HPEGK++VD+DK I+++ VTPN RVALRNDSY LHKILP+KVDPLVSLMMVEKVPDSTYEM+GGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHT+CTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDE+DSIGS+RL+ GSGGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILDSALLRPGRIDRKIEFP PNEEARLDILKIHSRKMNLTRGI+LRKIAELMPGASGAE+KGVCTEAGMYALRERRVHVTQEDFE+AVAK+MQKDSEKN+SIKKLWK
Sbjct:   11 EMDESRGGIGLRQYYLSKIEDLQLVVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 407          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Mouse
Match: Psmc5 (protease (prosome, macropain) 26S subunit, ATPase 5 [Source:MGI Symbol;Acc:MGI:105047])

HSP 1 Score: 689.108 bits (1777), Expect = 0.000e+0
Identity = 341/388 (87.89%), Postives = 374/388 (96.39%), Query Frame = 1
Query:  217 GIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            G+R YY+SKI+ELQ ++  K+QNLRR +AQRNELN+KVRLLREELQLLQEQGSYVGEV++ ++K KVLVK+HPEGK++VD+DK I+++ VTPN RVALRNDSY LHKILP+KVDPLVSLMMVEKVPDSTYEM+GGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHT+CTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDE+DSIGS+RL+ GSGGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILDSALLRPGRIDRKIEFP PNEEARLDILKIHSRKMNLTRGI+LRKIAELMPGASGAE+KGVCTEAGMYALRERRVHVTQEDFE+AVAK+MQKDSEKN+SIKKLWK
Sbjct:   19 GLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 406          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Mouse
Match: Psmc5 (protease (prosome, macropain) 26S subunit, ATPase 5 [Source:MGI Symbol;Acc:MGI:105047])

HSP 1 Score: 524.628 bits (1350), Expect = 0.000e+0
Identity = 264/312 (84.62%), Postives = 293/312 (93.91%), Query Frame = 1
Query:  196 ESSENREGIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEE 1131
            E  +   G+R YY+SKI+ELQ ++  K+QNLRR +AQRNELN+KVRLLREELQLLQEQGSYVGEV++ ++K KVLVK+HPEGK++VD+DK I+++ VTPN RVALRNDSY LHKILP+KVDPLVSLMMVEKVPDSTYEM+GGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHT+CTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDE+DSIGS+RL+ GSGGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILDSALLRPGRIDRKIEFP PNEE
Sbjct:   12 EEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEE 323          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Mouse
Match: Psmc2 (proteasome (prosome, macropain) 26S subunit, ATPase 2 [Source:MGI Symbol;Acc:MGI:109555])

HSP 1 Score: 360.918 bits (925), Expect = 4.982e-117
Identity = 170/309 (55.02%), Postives = 224/309 (72.49%), Query Frame = 1
Query:  412 KVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQ 1338
            K ++ +    K++VDL   +  + +    RV +  + Y +H  LP K+DP V++M VE+ PD TY  VGG  +QI++++EV+E P+ HPE F  LGI  PKGVLL+GPPGTGKTL ARAVA+ T+  FIRV GSELVQK++GEGARMVRELF MAR     +IF DE+D+IG  R D G+GGD+EVQRTMLEL+NQLDGF+P  NIK++MATNR D LD AL+RPGR+DRKIEF  P+ E R  I KIH+R M++ R I    +A L P ++GAE++ VCTEAGM+A+R RR   T++DF  AV K+++
Sbjct:  152 KYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIK 460          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Mouse
Match: Psmc6 (proteasome (prosome, macropain) 26S subunit, ATPase, 6 [Source:MGI Symbol;Acc:MGI:1914339])

HSP 1 Score: 340.117 bits (871), Expect = 3.672e-110
Identity = 168/328 (51.22%), Postives = 227/328 (69.21%), Query Frame = 1
Query:  370 GSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEK 1353
            G  VGEV+K + + K +VK     +Y+V   + ++ S++ P +RVAL   +  + + LP +VDPLV  M  E   + +Y  +GGL +QI+E++EVIELP+ +PELF+ +GI  PKG LLYGPPGTGKTLLARAVA   +C F++V  S +V K+IGE AR++RE+F  AR+H P IIFMDE+D+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR D LD ALLRPGR+DRKI    PNE+ARLDILKIH+  +     ID   I +L  G +GA+++ VCTEAGM+A+R     V QEDF  AV K+   DS+K
Sbjct:   54 GQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVA--DSKK 379          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Mouse
Match: Psmc1 (protease (prosome, macropain) 26S subunit, ATPase 1 [Source:MGI Symbol;Acc:MGI:106054])

HSP 1 Score: 340.502 bits (872), Expect = 1.095e-109
Identity = 164/324 (50.62%), Postives = 228/324 (70.37%), Query Frame = 1
Query:  379 VGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSE 1350
            VG + + I+    +V      ++ V +   ++   + P   V L +  + +  +L    DPLV++M VEK P  TY  +GGLD QI+EIKE +ELP+ HPE +E +GI  PKGV+LYGPPGTGKTLLA+AVA+ T  TF+RV GSEL+QK++G+G ++VRELF +A EH+PSI+F+DE+D+IG+ R DS SGG+ E+QRTMLELLNQLDGF+   ++K+IMATNRI+ LD AL+RPGRIDRKIEFP P+E+ +  I +IH+ +M L   + L  +       SGA++K +CTEAG+ ALRERR+ VT EDF+ +   ++ K  E
Sbjct:  109 VGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQE 432          
BLAST of 26S proteasome regulatory subunit 8 vs. UniProt/SwissProt
Match: sp|O18413|PRS8_DROME (26S proteasome regulatory subunit 8 OS=Drosophila melanogaster OX=7227 GN=Rpt6 PE=1 SV=2)

HSP 1 Score: 691.804 bits (1784), Expect = 0.000e+0
Identity = 342/389 (87.92%), Postives = 375/389 (96.40%), Query Frame = 1
Query:  214 EGIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            EG R+YYI KI+ELQ ++ +K QNLRR +AQRNELN+KVR+LREELQLLQEQGSYVGEV+KP++K KVLVK+HPEGK++VDLDK I+++ VTPN RVALRN+SY LHKILP+KVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELF+ALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEG+RMVRELFVMAREH+PSIIFMDE+DSIGS+R++SGSGGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILD ALLRPGRIDRKIEFP PNEEARLDILKIHSRKMNLTRGI+LRKIAELMPGASGAE+KGVCTEAGMYALRERRVHVTQEDFE+AVAK+MQKDSEKN+SIKKLWK
Sbjct:   17 EGFRSYYIQKIEELQLVVAEKHQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 405          
BLAST of 26S proteasome regulatory subunit 8 vs. UniProt/SwissProt
Match: sp|P54814|PRS8_MANSE (26S proteasome regulatory subunit 8 OS=Manduca sexta OX=7130 PE=2 SV=1)

HSP 1 Score: 689.878 bits (1779), Expect = 0.000e+0
Identity = 340/389 (87.40%), Postives = 375/389 (96.40%), Query Frame = 1
Query:  214 EGIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            EG R YYI+KI+ELQ ++ +K+QNLRR +AQRNELN+KVR+LREELQLLQEQGSYVGEV+KP++K KVLVK+HPEGK++VDLDK ++++ VT N RVALRN+SY LHKILP+KVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELF+ALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEG+RMVRELFVMAREH+PSIIFMDE+DSIGS+R++SGSGGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILD ALLRPGRIDRKIEFP PNEEARLDILKIHSRKMNLTRGI+LRKIAELMPGASGAE+KGVCTEAGMYALRERRVHVTQEDFE+AVAK+MQKDSEKN+SIKKLWK
Sbjct:   14 EGFRPYYITKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDLDKNVDINDVTANCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 402          
BLAST of 26S proteasome regulatory subunit 8 vs. UniProt/SwissProt
Match: sp|P62198|PRS8_RAT (26S proteasome regulatory subunit 8 OS=Rattus norvegicus OX=10116 GN=Psmc5 PE=1 SV=1)

HSP 1 Score: 689.108 bits (1777), Expect = 0.000e+0
Identity = 341/388 (87.89%), Postives = 374/388 (96.39%), Query Frame = 1
Query:  217 GIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            G+R YY+SKI+ELQ ++  K+QNLRR +AQRNELN+KVRLLREELQLLQEQGSYVGEV++ ++K KVLVK+HPEGK++VD+DK I+++ VTPN RVALRNDSY LHKILP+KVDPLVSLMMVEKVPDSTYEM+GGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHT+CTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDE+DSIGS+RL+ GSGGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILDSALLRPGRIDRKIEFP PNEEARLDILKIHSRKMNLTRGI+LRKIAELMPGASGAE+KGVCTEAGMYALRERRVHVTQEDFE+AVAK+MQKDSEKN+SIKKLWK
Sbjct:   19 GLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 406          
BLAST of 26S proteasome regulatory subunit 8 vs. UniProt/SwissProt
Match: sp|P62197|PRS8_PIG (26S proteasome regulatory subunit 8 OS=Sus scrofa OX=9823 GN=PSMC5 PE=2 SV=1)

HSP 1 Score: 689.108 bits (1777), Expect = 0.000e+0
Identity = 341/388 (87.89%), Postives = 374/388 (96.39%), Query Frame = 1
Query:  217 GIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            G+R YY+SKI+ELQ ++  K+QNLRR +AQRNELN+KVRLLREELQLLQEQGSYVGEV++ ++K KVLVK+HPEGK++VD+DK I+++ VTPN RVALRNDSY LHKILP+KVDPLVSLMMVEKVPDSTYEM+GGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHT+CTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDE+DSIGS+RL+ GSGGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILDSALLRPGRIDRKIEFP PNEEARLDILKIHSRKMNLTRGI+LRKIAELMPGASGAE+KGVCTEAGMYALRERRVHVTQEDFE+AVAK+MQKDSEKN+SIKKLWK
Sbjct:   19 GLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 406          
BLAST of 26S proteasome regulatory subunit 8 vs. UniProt/SwissProt
Match: sp|P62196|PRS8_MOUSE (26S proteasome regulatory subunit 8 OS=Mus musculus OX=10090 GN=Psmc5 PE=1 SV=1)

HSP 1 Score: 689.108 bits (1777), Expect = 0.000e+0
Identity = 341/388 (87.89%), Postives = 374/388 (96.39%), Query Frame = 1
Query:  217 GIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            G+R YY+SKI+ELQ ++  K+QNLRR +AQRNELN+KVRLLREELQLLQEQGSYVGEV++ ++K KVLVK+HPEGK++VD+DK I+++ VTPN RVALRNDSY LHKILP+KVDPLVSLMMVEKVPDSTYEM+GGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHT+CTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDE+DSIGS+RL+ GSGGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILDSALLRPGRIDRKIEFP PNEEARLDILKIHSRKMNLTRGI+LRKIAELMPGASGAE+KGVCTEAGMYALRERRVHVTQEDFE+AVAK+MQKDSEKN+SIKKLWK
Sbjct:   19 GLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 406          
BLAST of 26S proteasome regulatory subunit 8 vs. TrEMBL
Match: A0A0X3NPY0 (26S protease regulatory subunit 8 OS=Schistocephalus solidus OX=70667 GN=PRS8 PE=3 SV=1)

HSP 1 Score: 716.072 bits (1847), Expect = 0.000e+0
Identity = 366/432 (84.72%), Postives = 397/432 (91.90%), Query Frame = 1
Query:   88 MAAIEVDPMPSTVQYKTNEQSSKVLYSTNAMLLSNKE-SSENREGIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            MAA++V+ MP T     +  + + +Y    +    KE   E  +GI++YYISKIDELQ ++T+K QNLRR EAQRNELN+KVRLLREELQLLQEQGSYVGEVIKP++K KVLVK+ PEGK++VD+DK I++S +TPN RVALRNDSY LHKILPSKVDPLVSLMMVEKVPDSTYEM+GGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDEVDSIGSTRL+SGSGGDSEVQRTMLELLNQLDGFEP QNIK+IMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAE+KGVCTEAGMYALRERRVHVT EDFE+AVAK+MQKDSEKNVSIKKLWK
Sbjct:    1 MAAMDVEAMPVTSPRLMSSDTPRKIY--KEVEKDPKEIPVEISDGIKDYYISKIDELQYIVTEKVQNLRRLEAQRNELNAKVRLLREELQLLQEQGSYVGEVIKPMDKKKVLVKVQPEGKFVVDIDKNIDISSITPNCRVALRNDSYTLHKILPSKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEVDSIGSTRLESGSGGDSEVQRTMLELLNQLDGFEPKQNIKVIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTLEDFEMAVAKVMQKDSEKNVSIKKLWK 430          
BLAST of 26S proteasome regulatory subunit 8 vs. TrEMBL
Match: A0A183TJS9 (26S protease regulatory subunit 8 OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS16727 PE=3 SV=1)

HSP 1 Score: 712.22 bits (1837), Expect = 0.000e+0
Identity = 356/392 (90.82%), Postives = 379/392 (96.68%), Query Frame = 1
Query:  205 ENREGIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            E  +GI++YYISKIDELQ ++T+K QNLRR EAQRNELN+KVRLLREELQLLQEQGSYVGEVIKP++K KVLVK+ PEGK++VD+DK I++S +TPN RVALRNDSY LHKILPSKVDPLVSLMMVEKVPDSTYEM+GGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDEVDSIGSTRL+SGSGGDSEVQRTMLELLNQLDGFEP QNIK+IMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAE+KGVCTEAGMYALRERRVHVT EDFE+AVAK+MQKDSEKNVSIKKLWK
Sbjct:   37 EISDGIKDYYISKIDELQYIVTEKVQNLRRLEAQRNELNAKVRLLREELQLLQEQGSYVGEVIKPMDKKKVLVKVQPEGKFVVDIDKNIDISSITPNCRVALRNDSYTLHKILPSKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEVDSIGSTRLESGSGGDSEVQRTMLELLNQLDGFEPKQNIKVIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTLEDFEMAVAKVMQKDSEKNVSIKKLWK 428          
BLAST of 26S proteasome regulatory subunit 8 vs. TrEMBL
Match: R7URK7 (AAA domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_183959 PE=3 SV=1)

HSP 1 Score: 710.679 bits (1833), Expect = 0.000e+0
Identity = 352/391 (90.03%), Postives = 381/391 (97.44%), Query Frame = 1
Query:  208 NREGIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            N+EGI+ YY+SKI+ELQ +++ KTQNLRR EAQRNELN+KVRLLREELQLLQEQGSYVGEV+KP++K KVLVK+HPEGK++VDLDK I+++ VTPN RVALRNDSY LHKILP+KVDPLVSLMMVEKVPDSTY+MVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEG+RMVRELFVMAREH+PSIIFMDE+DSIGSTRL+SGSGGDSEVQRTMLELLNQLDGFEP QNIK+IMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGI+LRKIAE+MPGASGAE+KGVCTEAGMYALRERRVHVTQEDFELAVAK+MQKDSEKN+SIKKLWK
Sbjct:   16 NKEGIKQYYVSKIEELQLVVSGKTQNLRRLEAQRNELNAKVRLLREELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYDMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRLESGSGGDSEVQRTMLELLNQLDGFEPKQNIKVIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGINLRKIAEMMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFELAVAKVMQKDSEKNMSIKKLWK 406          
BLAST of 26S proteasome regulatory subunit 8 vs. TrEMBL
Match: A0A2C9JJZ0 (AAA domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106073436 PE=3 SV=1)

HSP 1 Score: 708.753 bits (1828), Expect = 0.000e+0
Identity = 350/391 (89.51%), Postives = 380/391 (97.19%), Query Frame = 1
Query:  208 NREGIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            N +GI+ YYISKI+ELQ ++T++TQNLRR EAQRNELN+KVR+LREELQLLQEQGSYVGEV+KP++K KVLVK+HPEGK++VD+DK I+M+QVTPN RVALRNDSY+LHKILP+KVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEG+RMVRELFVMAREH+PSIIFMDE+DSIGS+RL+SGSGGDSEVQRTMLELLNQLDGFEP QNIK+IMATNRIDILDSALLRPGRIDRKIEFP PNEEARLDILKIHSRKMNLTRGI+LRKIAE+MPGASGAE+KGVCTEAGMYALRERRVHVTQEDFELAVAKIM KDSEKN+SIKK WK
Sbjct:   15 NHQGIKQYYISKIEELQLVVTERTQNLRRLEAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDIDKNIDMNQVTPNCRVALRNDSYVLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRLESGSGGDSEVQRTMLELLNQLDGFEPKQNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAEMMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFELAVAKIMVKDSEKNISIKKQWK 405          
BLAST of 26S proteasome regulatory subunit 8 vs. TrEMBL
Match: A0A0R3W1M9 (AAA domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS3653 PE=3 SV=1)

HSP 1 Score: 708.753 bits (1828), Expect = 0.000e+0
Identity = 363/432 (84.03%), Postives = 394/432 (91.20%), Query Frame = 1
Query:   88 MAAIEVDPMPSTVQYKTNEQSSKVLYSTNAMLLSNKESS-ENREGIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            MAA++V+ MP T         S+ +  T  +    KE   E  +GIR+YY SKIDELQ ++T+K QNLRR  AQRNELN+KVRLLREELQLLQEQGSYVGEVIKP++K KVLVK+ PEGK++VD+DK I+++ VTPN RVALRNDSY LHKILPSKVDPLVSLMMVEKVPDSTYEM+GGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDEVDSIGSTRL+SGSGGDSEVQRTMLELLNQLDGFEP QNIK++MATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDIL+IHSRKMNLTRGIDLRKIAELMPGASGAE+KGVCTEAGMYALRERRVHVT EDFE+AVAK+MQKDS+KNVSIKKLWK
Sbjct:    1 MAAMDVEHMPFTSPRLMTSDPSRKMRKT--LEKDAKEVVVEGTDGIRDYYCSKIDELQFVVTEKMQNLRRLGAQRNELNAKVRLLREELQLLQEQGSYVGEVIKPMDKKKVLVKVQPEGKFVVDIDKNIDIASVTPNCRVALRNDSYTLHKILPSKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEVDSIGSTRLESGSGGDSEVQRTMLELLNQLDGFEPKQNIKVVMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILRIHSRKMNLTRGIDLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTLEDFEMAVAKVMQKDSDKNVSIKKLWK 430          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Cavefish
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:NCBI gene;Acc:103027731])

HSP 1 Score: 691.419 bits (1783), Expect = 0.000e+0
Identity = 343/395 (86.84%), Postives = 377/395 (95.44%), Query Frame = 1
Query:  196 ESSENREGIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            E S+   G+R YY+SKI+ELQ  + +K+QNLRR +AQRNELN+KVRLLREELQLLQEQGSYVGEV++ ++K KVLVK+HPEGK++VD+DK I+++ VTPN RVALRNDSY LHKILP+KVDPLVSLMMVEKVPDSTYEM+GGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHT+CTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDE+DSIGS+RL+ GSGGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILDSALLRPGRIDRKIEFP PNEEARLDILKIHSRKMNLTRGI+LRKIAELMPGASGAE+KGVCTEAGMYALRERRVHVTQEDFE+AVAK+MQKDSEKN+SIKKLWK
Sbjct:   12 EESKGGSGLRQYYLSKIEELQLTVNEKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 406          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Cavefish
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:NCBI gene;Acc:103027731])

HSP 1 Score: 656.366 bits (1692), Expect = 0.000e+0
Identity = 333/395 (84.30%), Postives = 363/395 (91.90%), Query Frame = 1
Query:  196 ESSENREGIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            E S+   G+R YY+SKI+ELQ  + +K+QNLRR +AQRNELN+KVRLLREELQLLQEQGSYVGEV++ ++K KVLVK++            +    VTPN RVALRNDSY LHKILP+KVDPLVSLMMVEKVPDSTYEM+GGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHT+CTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDE+DSIGS+RL+ GSGGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILDSALLRPGRIDRKIEFP PNEEARLDILKIHSRKMNLTRGI+LRKIAELMPGASGAE+KGVCTEAGMYALRERRVHVTQEDFE+AVAK+MQKDSEKN+SIKKLWK
Sbjct:    4 EESKGGSGLRQYYLSKIEELQLTVNEKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVNI-----------LLYCWVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 387          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Cavefish
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:NCBI gene;Acc:103027731])

HSP 1 Score: 654.825 bits (1688), Expect = 0.000e+0
Identity = 333/395 (84.30%), Postives = 360/395 (91.14%), Query Frame = 1
Query:  196 ESSENREGIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            E S+   G+R YY+SKI+ELQ  + +K+QNLRR +AQRNELN+KVRLLREELQLLQEQGSYVGEV++ ++K KVLVK                   VTPN RVALRNDSY LHKILP+KVDPLVSLMMVEKVPDSTYEM+GGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHT+CTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDE+DSIGS+RL+ GSGGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILDSALLRPGRIDRKIEFP PNEEARLDILKIHSRKMNLTRGI+LRKIAELMPGASGAE+KGVCTEAGMYALRERRVHVTQEDFE+AVAK+MQKDSEKN+SIKKLWK
Sbjct:   12 EESKGGSGLRQYYLSKIEELQLTVNEKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVK-------------------VTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 387          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Cavefish
Match: psmc2 (proteasome 26S subunit, ATPase 2 [Source:NCBI gene;Acc:103035644])

HSP 1 Score: 360.147 bits (923), Expect = 5.644e-118
Identity = 170/309 (55.02%), Postives = 224/309 (72.49%), Query Frame = 1
Query:  412 KVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQ 1338
            K ++ +    K++VDL   +  + +    RV +  + Y +H  LP K+DP V++M VE+ PD TY  VGG  +QI++++EV+E P+ HPE F  LGI  PKGVLL+GPPGTGKTL ARAVA+ T+  FIRV GSELVQK++GEGARMVRELF MAR     +IF DE+D+IG  R D G+GGD+EVQRTMLEL+NQLDGF+P  NIK++MATNR D LD AL+RPGR+DRKIEF  P+ E R  I KIH+R M++ R I    +A L P ++GAE++ VCTEAGM+A+R RR   T++DF  AV K+++
Sbjct:   70 KYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIK 378          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Cavefish
Match: psmc2 (proteasome 26S subunit, ATPase 2 [Source:NCBI gene;Acc:103035644])

HSP 1 Score: 360.918 bits (925), Expect = 1.066e-117
Identity = 170/309 (55.02%), Postives = 224/309 (72.49%), Query Frame = 1
Query:  412 KVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQ 1338
            K ++ +    K++VDL   +  + +    RV +  + Y +H  LP K+DP V++M VE+ PD TY  VGG  +QI++++EV+E P+ HPE F  LGI  PKGVLL+GPPGTGKTL ARAVA+ T+  FIRV GSELVQK++GEGARMVRELF MAR     +IF DE+D+IG  R D G+GGD+EVQRTMLEL+NQLDGF+P  NIK++MATNR D LD AL+RPGR+DRKIEF  P+ E R  I KIH+R M++ R I    +A L P ++GAE++ VCTEAGM+A+R RR   T++DF  AV K+++
Sbjct:  110 KYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIK 418          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Sea Lamprey
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-6547])

HSP 1 Score: 690.263 bits (1780), Expect = 0.000e+0
Identity = 344/407 (84.52%), Postives = 381/407 (93.61%), Query Frame = 1
Query:  175 AMLLSNKESSENRE-----GIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            AM++   E  E  +     G+R YY +KI+ELQ ++ +K+QNLRR +AQRNELN+KVR+LREELQLLQEQGSYVGEV+KP++K KVLVK+HPEGK++VD+DK I+++ VTPN RVALRNDSY LHKILP+KVDPLVSLMMVEKVPDSTYEM+GGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEG+RMVRELFVMAREH+PSIIFMDE+DSIGS+RL+ GSGGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILD ALLRPGRIDRKIEFP PNEEARLDILKIHSRKMNLTRGI+LRKIAELMPGASGAE+KGVCTEAGMYALRERRVHVTQEDFE+AVAK+MQKDSEKN+SIKKLWK
Sbjct:    4 AMVMGGGEQMETDDVKGGDGLRQYYQTKIEELQLVVNEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 410          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001244.1 (pep scaffold:Pmarinus_7.0:GL482260:6416:9764:-1 gene:ENSPMAG00000001115.1 transcript:ENSPMAT00000001244.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 356.681 bits (914), Expect = 1.285e-116
Identity = 170/310 (54.84%), Postives = 225/310 (72.58%), Query Frame = 1
Query:  409 TKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQ 1338
             K ++ +    K++VDL   +  + +    RV +  + Y +H  LP K+DP V++M VE+ PD TY  VGG  +QI++++EV+E P+ HPE F  LGI  PKGVLL+GPPGTGKTL ARAVA+ T+  FIRV GSELVQK++GEGARMVRELF MAR+    +IF DE+D+IG  R D G+GGD+EVQRTMLEL+NQLDGF+P  NIK++MATNR D LD AL+RPGR+DRKIEF  P+ E R  I KIH+R M++ R I    +A L P ++GAE++ VCTEAGM+A+R RR   T++DF  AV K+++
Sbjct:  119 AKYIINVKQFAKFVVDLGDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARKAC--LIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFGLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVNKVIK 426          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010299.1 (pep scaffold:Pmarinus_7.0:GL479893:343:6144:1 gene:ENSPMAG00000009320.1 transcript:ENSPMAT00000010299.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 331.643 bits (849), Expect = 2.356e-107
Identity = 155/291 (53.26%), Postives = 209/291 (71.82%), Query Frame = 1
Query:  469 IEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQK 1341
            ++  ++ P   V +  DSY++ + LP++ D  V  M V++ P   Y  VGGLDKQI+E+ E I LP+ H E FE LGI  PKGVL+YGPPGTGKTLLARA A  T+ TF++++G +LVQ FIG+GA++VR+ F +A+E +P+IIF+DE+D+IG+ R DS   GD EVQRTMLELLNQLDGF+P   +K+I ATNR+DILD ALLR GR+DRKIEFP PNEEAR  I++IHSRKMN++  ++  ++A      +GA+ K VC EAGM ALR     +T ED+   + ++  K
Sbjct:  116 VDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDVGGLDKQIQELVEAIVLPMTHKERFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNFEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDYMDGILEVQAK 406          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006168.1 (pep scaffold:Pmarinus_7.0:GL486395:211235:217029:-1 gene:ENSPMAG00000005566.1 transcript:ENSPMAT00000006168.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 282.722 bits (722), Expect = 7.810e-90
Identity = 130/272 (47.79%), Postives = 192/272 (70.59%), Query Frame = 1
Query:  379 VGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDL 1194
            +G+ ++ +++   +V       Y V +   I+   + P++ VAL   S  L  +LP + D  ++++  ++ PD TY  +GG+D Q +E++E +ELP+ H +L++ +GI  P+GVL+YGPPG GKT+LA+AVAHHT   FIRV GSE VQK++GEG RMVR++F +A+E++P+IIF+DE+D+I + R D+ +G D EVQR +LELLNQ+DGF+ T N+K+IMATNR D LD ALLRPGR+DRKIEFP P+   +  I    + KMNL+  +DL
Sbjct:   44 IGQFLEAVDQNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSITMLTADQKPDVTYVDIGGMDIQKQEVREAVELPLTHFDLYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPMPDRRQKRLIFSTVTAKMNLSEEVDL 315          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Sea Lamprey
Match: vcp (valosin containing protein [Source:NCBI gene;Acc:327197])

HSP 1 Score: 204.527 bits (519), Expect = 7.763e-59
Identity = 105/278 (37.77%), Postives = 170/278 (61.15%), Query Frame = 1
Query:  448 IVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRE 1281
            ++DLD     +++  +  V + +  + L +  PS +       MV +VP+ T+E +GGL+   +E++E+++ PV+HPE F   G+   KGVL YGPPG GKTLLA+A+A+  +  FI + G EL+  + GE    VR++F  AR+ SP+++F+DE+DSI   R      G     R + ++L ++DG    +N+ II ATNR DI+D A+LRPGR+D+ I  P P+E++R  ILK + RK  + + +D+  +++   G SGA++  +C  A   A+RE
Sbjct:   69 VIDLDDETIDAEIMNSLAVTMDDFRWALAQSNPSALRE-----MVVEVPNVTWEDIGGLESVKRELQELVQYPVEHPEKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDVFDKARQASPTVLFLDELDSIAKARGGGVGDGGGAADRVINQILTEMDGMGVNKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRTAILKANLRKSPIAKDVDIGYLSKTTNGFSGADLMEICQRACKLAIRE 341          

HSP 2 Score: 62.3882 bits (150), Expect = 1.746e-10
Identity = 31/83 (37.35%), Postives = 52/83 (62.65%), Query Frame = 1
Query: 1087 GRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIM 1335
            GR DR+++   P+   RL+IL+IH++ M L+  +DL +IA    G  GA++  +C+EA + A+R +++ V   D E   A+IM
Sbjct:    1 GRFDREVDIGIPDSTGRLEILQIHTKNMKLSVDVDLEQIANQTHGHVGADLAALCSEAALQAIR-KKMDVIDLDDETIDAEIM 82          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Yeast
Match: RPT6 (ATPase of the 19S regulatory particle of the 26S proteasome; one of six ATPases of the regulatory particle; involved in the degradation of ubiquitinated substrates; bound by ubiquitin-protein ligases Ubr1p and Ufd4p; localized mainly to the nucleus throughout the cell cycle; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003016])

HSP 1 Score: 595.119 bits (1533), Expect = 0.000e+0
Identity = 297/404 (73.51%), Postives = 345/404 (85.40%), Query Frame = 1
Query:  169 TNAMLLSNKESSENREGIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            T A+  SN     +  GI+ Y+  KI E +  I  KT+N+RR EAQRN LN KVR +++EL+LLQE GSYVGEVIK ++  KVLVK+ PEGKYIVD+ K I +  +  + RV LR+DSYMLHK+L +K DPLVSLMMVEKVPDSTY+MVGGL KQIKEIKEVIELPVKHPELFE+LGIAQPKGV+LYGPPGTGKTLLARAVAHHT+C FIRVSG+ELVQK+IGEG+RMVRELFVMAREH+PSIIFMDE+DSIGSTR++   GGDSEVQRTMLELLNQLDGFE ++NIKIIMATNR+DILD ALLRPGRIDRKIEFP P+  AR +IL+IHSRKMNLTRGI+LRK+AE M G SGA++KGVCTEAGMYALRERR+HVTQEDFELAV K+M K+ E  +S+ KL+K
Sbjct:    2 TAAVTSSNIVLETHESGIKPYFEQKIQETELKIRSKTENVRRLEAQRNALNDKVRFIKDELRLLQEPGSYVGEVIKIVSDKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVGKVMNKNQETAISVAKLFK 405          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Yeast
Match: RPT1 (ATPase of the 19S regulatory particle of the 26S proteasome; one of six ATPases of the regulatory particle; involved in the degradation of ubiquitinated substrates; required for optimal CDC20 transcription; interacts with Rpn12p and Ubr1p; mutant has aneuploidy tolerance [Source:SGD;Acc:S000001628])

HSP 1 Score: 350.132 bits (897), Expect = 4.880e-114
Identity = 166/308 (53.90%), Postives = 221/308 (71.75%), Query Frame = 1
Query:  412 KVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIM 1335
            K ++ +    K++V L + +  + +    RV +    Y +   LP ++DP V++M VE+ PD TY  VGG   QI++++EV+ELP+  PE F  LGI  PKG+LLYGPPGTGKTL ARAVA+ T+ TFIRV GSELVQK++GEGARMVRELF MAR     IIF DE+D++G  R D G+GGD+EVQRTMLEL+ QLDGF+P  NIK++ ATNR + LD ALLRPGRIDRK+EF  P+ E R +I +IHS+ M++ RGI    I+ L P ++GAE++ VCTEAGM+A+R RR   T++DF  AV K++
Sbjct:  144 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVI 451          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Yeast
Match: RPT2 (ATPase of the 19S regulatory particle of the 26S proteasome; one of six ATPases of the regulatory particle; involved in the degradation of ubiquitinated substrates; required for normal peptide hydrolysis by the core 20S particle; N-myristoylation of Rpt2p at Gly2 is involved in regulating the proper intracellular distribution of proteasome activity by controlling the nuclear localization of the 26S proteasome [Source:SGD;Acc:S000002165])

HSP 1 Score: 326.25 bits (835), Expect = 2.926e-105
Identity = 153/305 (50.16%), Postives = 221/305 (72.46%), Query Frame = 1
Query:  445 YIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNV 1359
            Y V +   ++   + P   V L + +  +  +L    DP+VS+M ++K P  +Y  +GGL+ QI+EIKE +ELP+ HPEL+E +GI  PKGV+LYG PGTGKTLLA+AVA+ T  TF+R+ GSEL+QK++G+G R+ R++F +A E++PSI+F+DE+D+IG+ R DS SGG+ E+QRTMLELLNQLDGF+   ++K+IMATN+I+ LD AL+RPGRIDRKI F  P+   +  IL IH+ KMNL+  ++L  +       SGA+++ +CTEAG+ ALRERR+ VT EDF+ A  ++M+   E+N+
Sbjct:  128 YYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRKILFENPDLSTKKKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQAKERVMKNKVEENL 432          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Yeast
Match: RPT4 (ATPase of the 19S regulatory particle of the 26S proteasome; one of six ATPases of the regulatory particle; involved in degradation of ubiquitinated substrates; contributes preferentially to ERAD; required for spindle pole body duplication; mainly nuclear localization [Source:SGD;Acc:S000005785])

HSP 1 Score: 315.464 bits (807), Expect = 4.326e-101
Identity = 158/336 (47.02%), Postives = 222/336 (66.07%), Query Frame = 1
Query:  370 GSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQ-KDSEKNVSIKKL 1374
            G  +GEV+K +++ K +VK     +YIV +   ++ S++    RV L   +  + +ILP + DPLV  M   +  + T++ +GGL +QI+E++EVIELP+K+PE+F+ +GI  PKGVLLYGPPGTGKTLLA+AVA      FI    S +V K+IGE AR++RE+F  A+EH P IIFMDEVD+IG  R   G+  D E+QRT++ELL Q+DGF+     KIIMATNR D LD ALLRPGR+DRK+E P PNE  RL+I KIH+ K+  T   D     ++  G +GA+++   TEAG +A+R+ R H+  +D   AV K+ + K  E  +  +KL
Sbjct:  102 GQLIGEVMKELSEEKYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQGEITFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEAGRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDDLMKAVRKVAEVKKLEGTIEYQKL 437          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Yeast
Match: RPT5 (ATPase of the 19S regulatory particle of the 26S proteasome; one of six ATPases of the regulatory particle; involved in the degradation of ubiquitinated substrates; recruited to the GAL1-10 promoter region upon induction of transcription; similar to human TBP1 [Source:SGD;Acc:S000005643])

HSP 1 Score: 314.309 bits (804), Expect = 1.062e-100
Identity = 151/299 (50.50%), Postives = 209/299 (69.90%), Query Frame = 1
Query:  469 IEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSI 1365
            ++  ++ PN  V +  DSY++   LPS+ D  V  M V++ P  TY  VGGLDKQI+E+ E I LP+K  + F+ +GI  PKG L+YGPPGTGKTLLARA A  T  TF++++  +LVQ +IGEGA++VR+ F +A+E +P+IIF+DE+D+IG+ R DS   GD EVQRTMLELLNQLDGF     +K++ ATNR+D+LD ALLR GR+DRKIEFP P+E++R  IL+IHSRKM     I+ +++A      +GA++K V  EAGM ALR  +  V  EDF   ++++  + S K+VS 
Sbjct:  135 VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLDKQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLAAPQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLELLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRKMTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEVQARKS-KSVSF 432          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Nematostella
Match: EDO49524 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGH4])

HSP 1 Score: 696.041 bits (1795), Expect = 0.000e+0
Identity = 344/395 (87.09%), Postives = 377/395 (95.44%), Query Frame = 1
Query:  196 ESSENREGIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            E  +  EGI+ YYI+KI+ELQ ++T+K +NLRR EAQRNELN+KVR+LREELQLLQEQGSYVGEV+KP++K KVLVK+HPEGK++VD+DKGI+M++VTPN RVALRNDSY LHKILP+KVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGI QPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDE+DSIGS+RL+ GSGGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILDSALLRPGRIDRKIEFP PNEEAR DILKIHSRKMNLTRGI+L+KIAELMPGASGAE+KGVCTEAGMYALRERRVHVTQEDFE+AV K+MQKDSEKN+SIKK WK
Sbjct:    4 EVEKQHEGIQQYYITKIEELQLVVTEKIKNLRRLEAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDIDKGIDMAEVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIDQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARQDILKIHSRKMNLTRGINLKKIAELMPGASGAEIKGVCTEAGMYALRERRVHVTQEDFEMAVTKVMQKDSEKNMSIKKQWK 398          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Nematostella
Match: EDO37473 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFJ3])

HSP 1 Score: 357.066 bits (915), Expect = 9.511e-117
Identity = 168/310 (54.19%), Postives = 223/310 (71.94%), Query Frame = 1
Query:  409 TKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQ 1338
             K ++ +    K++VDL   +  + +    RV +  + Y +H  LP K+DP V++M VE+ PD TY  +GG  +QI +++EV+E P+ HPE F  LGI  PKGVLL+GPPGTGKTL ARAVA+ T+  FIRV GSELVQK++GEGARMVRELF MAR     I+F DE+D+IG  R D G+GGD+EVQRTMLEL+NQLDGF+P  NIK++MATNR D LD AL+RPGR+DRK+EF  P+ E R  I KIH+R M++ R I    +A L P ++GAE++ VCTEAGM+A+R RR   T++DF  AV K+++
Sbjct:  110 AKYIINVKQFAKFVVDLGDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDIGGCKEQIDKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDLEGRAHIFKIHARSMSVERDIRYELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVNKVIK 419          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Nematostella
Match: EDO34160 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ60])

HSP 1 Score: 336.265 bits (861), Expect = 3.310e-109
Identity = 163/321 (50.78%), Postives = 226/321 (70.40%), Query Frame = 1
Query:  370 GSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKI 1332
            G  VGEV+K + + K +VK     +Y+V   + ++ +++   +RVAL   +  + + LP +VDPLV  M  E   + +Y  VGGL +QI+E++EVIELP+ +PELF+ +GIA PKG LL+GPPGTGKTLLARAVA   +  F++V  S +V K+IGE AR++RE+F  AR+H P IIFMDE+D+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR D LD ALLRPGR+DRKIE   PNE+AR+DILKIHS ++     ID   + +L  G +GA+++ VCTEAGM+A+R  R +V +EDF  AV K+
Sbjct:   56 GQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQVDKAKLKQGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNISYSDVGGLSEQIRELREVIELPLTNPELFQRVGIAPPKGCLLFGPPGTGKTLLARAVASQLDANFLKVVSSAIVDKYIGESARLIREMFGYARDHEPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDVLGQVKMIMATNRPDTLDPALLRPGRLDRKIEIALPNEQARMDILKIHSSRITKHGEIDYEAVVKLSDGFNGADLRNVCTEAGMFAIRGERDYVIEEDFMKAVRKV 376          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Nematostella
Match: EDO37502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFP4])

HSP 1 Score: 322.398 bits (825), Expect = 2.128e-103
Identity = 155/299 (51.84%), Postives = 213/299 (71.24%), Query Frame = 1
Query:  469 IEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSI 1365
            +E   +TP   V +  DSY++ + LP++ D  V  M V++ P   Y  +GGLD+QI+E+ E I LP+ H + FE LGI  PKGVLLYGPPGTGKTLLARA A  T+ TF++++G +LVQ FIG+GA++VR+ F +A+E +P+IIF+DE+D+IG+ R DS   GD EVQRTMLELLNQLDGF    +IK+I ATNR+DILD ALLR GR+DRKIEFP P++EAR  IL+IHSRKMN++  ++  +++      +GA +K VC EAGM ALR     V  ED+   +  IM+ +++K  ++
Sbjct:  129 VEPENLTPGDLVGVNKDSYLILEKLPAEYDSRVKAMEVDERPTEQYSDIGGLDQQIQELVEAIVLPMTHKDRFENLGIHPPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFSSHHDIKVIAATNRVDILDPALLRSGRLDRKIEFPNPDQEARARILQIHSRKMNVSGDVNFDELSRCTDDFNGAMLKAVCVEAGMIALRREATEVCHEDY---MDGIMEVNAKKKANL 424          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Nematostella
Match: EDO43481 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYL2])

HSP 1 Score: 313.538 bits (802), Expect = 4.522e-100
Identity = 150/326 (46.01%), Postives = 219/326 (67.18%), Query Frame = 1
Query:  379 VGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKN 1356
            +G+ ++ +++   +V       Y V +   I+   + P++ VAL   S  L  ILP + D  ++++  E+ P+ +Y  +GG+D Q +EI+E +ELP+ H EL++ +GI  P+GVLLYGPPG GKT+LA+AVAHHT   FIRV GSE VQK++GEG RMVR++F +A+E++P+IIF+DE+D+I + R D+ +G D EVQR +LELLNQ+DGF+   N+K+IMATNR D LD ALLRPGR+DRKIEFP P+   +  I    + KMNL+  +DL          SGA++  VC EAGM A+RE R  +  +DFE      ++KD +++
Sbjct:   88 IGQFLEAVDQNTGIVASTTGSNYYVRILSTIDKELLKPSASVALHKHSNALVDILPPEADSSIAMLTNEEKPNVSYAEIGGMDIQKQEIREAVELPLTHFELYKQIGIDPPRGVLLYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRQDTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITNKMNLSEEVDLEDYVARPDKISGADINAVCQEAGMQAVRENRYIILAKDFEKGYKNNVKKDEQEH 413          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Medaka
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:NCBI gene;Acc:101158979])

HSP 1 Score: 688.723 bits (1776), Expect = 0.000e+0
Identity = 341/388 (87.89%), Postives = 374/388 (96.39%), Query Frame = 1
Query:  217 GIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            G+R YY+SKI+ELQ  + +K+QNLRR +AQRNELN+KVRLLREELQLLQEQGSYVGEV++ ++K KVLVK+HPEGK++VD+DK I+++ VTPN RVALRNDSY LHKILP+KVDPLVSLMMVEKVPDSTYEM+GGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHT+CTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDE+DSIGS+RL+ GSGGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILDSALLRPGRIDRKIEFP PNEEARLDILKIHSRKMNLTRGI+LRKIAELMPGASGAE+KGVCTEAGMYALRERRVHVTQEDFE+AVAK+MQKDSEKN+SIKKLWK
Sbjct:   11 GLRQYYLSKIEELQLTVNEKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRVMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 398          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Medaka
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:NCBI gene;Acc:101158979])

HSP 1 Score: 688.723 bits (1776), Expect = 0.000e+0
Identity = 341/388 (87.89%), Postives = 374/388 (96.39%), Query Frame = 1
Query:  217 GIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            G+R YY+SKI+ELQ  + +K+QNLRR +AQRNELN+KVRLLREELQLLQEQGSYVGEV++ ++K KVLVK+HPEGK++VD+DK I+++ VTPN RVALRNDSY LHKILP+KVDPLVSLMMVEKVPDSTYEM+GGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHT+CTFIRVSGSELVQKFIGEGARMVRELFVMAREH+PSIIFMDE+DSIGS+RL+ GSGGDSEVQRTMLELLNQLDGFE T+NIK+IMATNRIDILDSALLRPGRIDRKIEFP PNEEARLDILKIHSRKMNLTRGI+LRKIAELMPGASGAE+KGVCTEAGMYALRERRVHVTQEDFE+AVAK+MQKDSEKN+SIKKLWK
Sbjct:   19 GLRQYYLSKIEELQLTVNEKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRVMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 406          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Medaka
Match: psmc2 (proteasome 26S subunit, ATPase 2 [Source:NCBI gene;Acc:101175703])

HSP 1 Score: 360.918 bits (925), Expect = 2.588e-118
Identity = 170/309 (55.02%), Postives = 225/309 (72.82%), Query Frame = 1
Query:  412 KVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQ 1338
            K ++ +    K++VDL   +  + +    RV +  + Y +H  LP K+DP V++M VE+ PD TY  VGG  +QI++++EV+E P+ HPE F +LGI  PKGVLL+GPPGTGKTL ARAVA+ T+  FIRV GSELVQK++GEGARMVRELF MAR     +IF DE+D+IG  R D G+GGD+EVQRTMLEL+NQLDGF+P  NIK++MATNR D LD AL+RPGR+DRKIEF  P+ E R  I KIH+R M++ R I    +A L P ++GAE++ VCTEAGM+A+R RR   T++DF  AV K+++
Sbjct:   70 KYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVSLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIK 378          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Medaka
Match: psmc2 (proteasome 26S subunit, ATPase 2 [Source:NCBI gene;Acc:101175703])

HSP 1 Score: 361.688 bits (927), Expect = 4.034e-118
Identity = 170/309 (55.02%), Postives = 225/309 (72.82%), Query Frame = 1
Query:  412 KVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQ 1338
            K ++ +    K++VDL   +  + +    RV +  + Y +H  LP K+DP V++M VE+ PD TY  VGG  +QI++++EV+E P+ HPE F +LGI  PKGVLL+GPPGTGKTL ARAVA+ T+  FIRV GSELVQK++GEGARMVRELF MAR     +IF DE+D+IG  R D G+GGD+EVQRTMLEL+NQLDGF+P  NIK++MATNR D LD AL+RPGR+DRKIEF  P+ E R  I KIH+R M++ R I    +A L P ++GAE++ VCTEAGM+A+R RR   T++DF  AV K+++
Sbjct:  110 KYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVSLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIK 418          
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Medaka
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:NCBI gene;Acc:101172300])

HSP 1 Score: 347.821 bits (891), Expect = 3.141e-113
Identity = 171/328 (52.13%), Postives = 229/328 (69.82%), Query Frame = 1
Query:  370 GSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEK 1353
            G  VGEV+K + + K +VK     +Y+V   + ++ SQ+ P +RVAL   +  + + LP +VDPLV  M  E     +Y  +GGL +QI+E++EVIELP+ +PELF+ +GI  PKG LLYGPPGTGKTLLARAVA   +C F++V  S +V K+IGE AR++RE+F  AR+H P IIFMDE+D+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR D LD ALLRPGR+DRKI    PNE+ARLDILKIHS  +     ID   I +L  G +GA+++ VCTEAG++A+R  R +VTQEDF  AV K+   DS+K
Sbjct:   54 GQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSQLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGSVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIELPNEQARLDILKIHSSPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGLFAIRSDREYVTQEDFMKAVRKVA--DSKK 379          
BLAST of 26S proteasome regulatory subunit 8 vs. Planmine SMEST
Match: SMESG000066841.1 (SMESG000066841.1)

HSP 1 Score: 852.432 bits (2201), Expect = 0.000e+0
Identity = 431/431 (100.00%), Postives = 431/431 (100.00%), Query Frame = 1
Query:   88 MAAIEVDPMPSTVQYKTNEQSSKVLYSTNAMLLSNKESSENREGIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            MAAIEVDPMPSTVQYKTNEQSSKVLYSTNAMLLSNKESSENREGIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVRLLREELQLLQEQGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK
Sbjct:    1 MAAIEVDPMPSTVQYKTNEQSSKVLYSTNAMLLSNKESSENREGIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVRLLREELQLLQEQGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 431          
BLAST of 26S proteasome regulatory subunit 8 vs. Planmine SMEST
Match: SMESG000019320.1 (SMESG000019320.1)

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 271/388 (69.85%), Postives = 332/388 (85.57%), Query Frame = 1
Query:  217 GIRNYYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            G   +Y+ + D+L+ +  +K + +RR EA RNE+N KV+ L+ E++ L +  S VGE+IKPINK KVLVK+    + IV ++  I M ++ PN+RVALR+ S  +HKILP+ +DP V++MM+EKVPDSTYEM+GGLDKQI+EIKEVIEL +KHPELFE+LGI+ PKGVLLYGPPGTGKTL+ARAVAHHT+C+FIRVSGSELVQK+IGEGARMVR++F MA+EHSP+IIFMDE+DSIGS+R   G G DSEVQRTMLELLNQLDGF+ T NIKIIMATNRIDILDSALLRPGRIDRKIEFP PNEE+RL+I+KIHSR+MN+ RGIDLR IAE + GASGAEMKGVCTEAGM+A+RERR+HVTQEDF  AV+K+M+++SEK VS+ KLWK
Sbjct:   10 GFEKFYLDQTDKLEMIKLEKERAIRRLEANRNEMNEKVKSLQTEIERLMKPPSKVGEIIKPINKAKVLVKLSHNTQLIVGIESEINMEKLKPNTRVALRDSSNKVHKILPTDIDPFVAMMMMEKVPDSTYEMIGGLDKQIQEIKEVIELSIKHPELFESLGISHPKGVLLYGPPGTGKTLVARAVAHHTDCSFIRVSGSELVQKYIGEGARMVRDIFKMAKEHSPAIIFMDEIDSIGSSRNGGGQGSDSEVQRTMLELLNQLDGFDATNNIKIIMATNRIDILDSALLRPGRIDRKIEFPEPNEESRLEIMKIHSRRMNMKRGIDLRVIAEKLSGASGAEMKGVCTEAGMFAIRERRIHVTQEDFLAAVSKVMKENSEKRVSVLKLWK 397          
BLAST of 26S proteasome regulatory subunit 8 vs. Planmine SMEST
Match: SMESG000032352.1 (SMESG000032352.1)

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 273/384 (71.09%), Postives = 330/384 (85.94%), Query Frame = 1
Query:  229 YYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            +Y  K DEL+ +  +K + +RR EA RNE+N KV+ L+ E++ L +  S VGE+IKPINKTKVLVK+    + IV ++  I M ++ PN+RVALR+ S  +HKILP+ +DP V++MM+EKVPDSTYEM+GGLDKQI+EIKEVIEL +KHPELFE+LGI+ PKGVLLYGPPGTGKTL+ARAVAHHT+C+FIRVSGSELVQK+IGEGARMVR++F MA+EHSP+IIFMDE+DSIGS+R   G G DSEVQRTMLELLNQLDGF+ T NIKIIMATNRIDILDSALLRPGRIDRKIEFP PNEE+RL+ILKIHSR+MN+ RGIDLR IAE + GASGAEMKGVCTEAGM+A+RERR+HVTQEDF  AV+K+M+++ EK VS+ KLWK
Sbjct:   10 FYNDKTDELEMIKLEKERAIRRLEANRNEMNEKVKSLQTEIERLMKPPSKVGEIIKPINKTKVLVKLSHNTQLIVGIESEINMEKLKPNTRVALRDSSNKVHKILPTDIDPFVAMMMMEKVPDSTYEMIGGLDKQIQEIKEVIELSIKHPELFESLGISHPKGVLLYGPPGTGKTLVARAVAHHTDCSFIRVSGSELVQKYIGEGARMVRDIFKMAKEHSPAIIFMDEIDSIGSSRNGGGQGSDSEVQRTMLELLNQLDGFDATNNIKIIMATNRIDILDSALLRPGRIDRKIEFPEPNEESRLEILKIHSRRMNMKRGIDLRLIAEKLSGASGAEMKGVCTEAGMFAIRERRIHVTQEDFLAAVSKVMKENCEKRVSVLKLWK 393          
BLAST of 26S proteasome regulatory subunit 8 vs. Planmine SMEST
Match: SMESG000078696.1 (SMESG000078696.1)

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 270/384 (70.31%), Postives = 327/384 (85.16%), Query Frame = 1
Query:  229 YYISKIDELQQMITQKTQNLRRHEAQRNELNSKVXXXXXXXXXXXXXGSYVGEVIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQKDSEKNVSIKKLWK 1380
            +Y  K  EL+    +K + +RR EA RNE+N KV+ L+ E++ L +  S VGE+IKPINKTKVLVK+    + IV ++  I M ++ PN+RVALR+ S  +HKILP+ +DP V++MM+EKVPDSTYEM+GGL+KQI+EIKEVIEL +KHPELFE+LGI+ PKGVLLYGPPGTGKTL+ARAVAHHT+C+FIRVS SELVQK+IGEGARMVR++F MA+EHSP+IIFMDE+DSIGS+R   G G DSEVQRTMLELLNQLDGF+ T NIKIIMATNRIDILDSALLRPGRIDRKIEFP PNEE+RL+ILKIHSR+MN+ RGIDLR IAE + GASGAEMKGVCTEAGM+A+RERR+HVTQEDF  AV+K+M+++ EK VS+ KLWK
Sbjct:   10 FYNDKTGELELTKLEKERAIRRLEANRNEMNEKVKSLQTEIERLMKPPSKVGEIIKPINKTKVLVKLSHNTQLIVSIESEINMEKLKPNTRVALRDSSNKVHKILPTDIDPFVAMMMMEKVPDSTYEMIGGLEKQIQEIKEVIELSIKHPELFESLGISHPKGVLLYGPPGTGKTLVARAVAHHTDCSFIRVSWSELVQKYIGEGARMVRDIFKMAKEHSPAIIFMDEIDSIGSSRNGGGQGSDSEVQRTMLELLNQLDGFDATNNIKIIMATNRIDILDSALLRPGRIDRKIEFPEPNEESRLEILKIHSRRMNMKRGIDLRLIAEKLSGASGAEMKGVCTEAGMFAIRERRIHVTQEDFLAAVSKVMKENCEKRVSVLKLWK 393          
BLAST of 26S proteasome regulatory subunit 8 vs. Planmine SMEST
Match: SMESG000044108.1 (SMESG000044108.1)

HSP 1 Score: 355.525 bits (911), Expect = 7.966e-116
Identity = 166/309 (53.72%), Postives = 225/309 (72.82%), Query Frame = 1
Query:  412 KVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHKILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLELLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEARLDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERRVHVTQEDFELAVAKIMQ 1338
            K ++ +    K++VDL + +  + +    RV +    Y +H  LP K+DP V++M VE+ PD TY  VGG  +QI++++EV+E+P+ HPE F  LGI  PKGVLL+GPPGTGKTL ARAVA+ T+  FIRV GSELVQK++GEGARMVRELF +AR     IIF DE+D+IG  R D G+GGD+EVQRTMLEL+NQLDGF+P  NIK++MATNR D LD AL+RPGR+DRK+EF  P+ + R  I KIH+R M++ + I    ++ L P ++GAE++ VCTEAGM+A+R RR   T++DF  AV K+++
Sbjct:  103 KYIINVKQFAKFVVDLAETVAPTDIEEGMRVGVDRTKYQIHIPLPPKIDPSVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVEMPMLHPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFELARSKKACIIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALVRPGRLDRKVEFGLPDLDGRTQIFKIHARSMSVEKDIRYELLSRLCPNSTGAEIRSVCTEAGMFAIRSRRKMATEKDFLDAVTKVIK 411          
The following BLAST results are available for this feature:
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PSMC50.000e+087.89proteasome 26S subunit, ATPase 5 [Source:HGNC Symb... [more]
PSMC50.000e+087.89proteasome 26S subunit, ATPase 5 [Source:HGNC Symb... [more]
PSMC50.000e+087.89proteasome 26S subunit, ATPase 5 [Source:HGNC Symb... [more]
PSMC50.000e+087.89proteasome 26S subunit, ATPase 5 [Source:HGNC Symb... [more]
PSMC55.319e-14182.68proteasome 26S subunit, ATPase 5 [Source:HGNC Symb... [more]
back to top
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpt-60.000e+075.29Proteasome Regulatory Particle, ATPase-like [Sour... [more]
F56F11.40.000e+076.46pep chromosome:WBcel235:III:2858558:2865497:1 gene... [more]
F56F11.40.000e+076.46pep chromosome:WBcel235:III:2858709:2865386:1 gene... [more]
F56F11.40.000e+076.46pep chromosome:WBcel235:III:2855554:2865386:1 gene... [more]
rpt-16.892e-11653.7226S proteasome regulatory subunit 7 [Source:UniPr... [more]
back to top
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rpt60.000e+087.92gene:FBgn0020369 transcript:FBtr0077189[more]
Rpt6R0.000e+083.16gene:FBgn0039788 transcript:FBtr0085680[more]
Rpt12.488e-11754.37gene:FBgn0028687 transcript:FBtr0088947[more]
Rpt21.296e-11049.69gene:FBgn0015282 transcript:FBtr0084520[more]
Rpt21.296e-11049.69gene:FBgn0015282 transcript:FBtr0346154[more]
back to top
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmc50.000e+086.84proteasome 26S subunit, ATPase 5 [Source:ZFIN;Acc:... [more]
psmc22.294e-11755.02proteasome 26S subunit, ATPase 2 [Source:ZFIN;Acc:... [more]
psmc61.200e-11248.44proteasome 26S subunit, ATPase 6 [Source:ZFIN;Acc:... [more]
psmc61.200e-11248.44proteasome 26S subunit, ATPase 6 [Source:ZFIN;Acc:... [more]
psmc61.200e-11248.44proteasome 26S subunit, ATPase 6 [Source:ZFIN;Acc:... [more]
back to top
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map70.000e+086.65microtubule associated protein 7 [Source:Xenbase;A... [more]
map70.000e+086.65microtubule associated protein 7 [Source:Xenbase;A... [more]
map70.000e+086.65microtubule associated protein 7 [Source:Xenbase;A... [more]
map70.000e+086.65microtubule associated protein 7 [Source:Xenbase;A... [more]
map70.000e+086.65microtubule associated protein 7 [Source:Xenbase;A... [more]
back to top
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Psmc50.000e+087.89protease (prosome, macropain) 26S subunit, ATPase ... [more]
Psmc50.000e+084.62protease (prosome, macropain) 26S subunit, ATPase ... [more]
Psmc24.982e-11755.02proteasome (prosome, macropain) 26S subunit, ATPas... [more]
Psmc63.672e-11051.22proteasome (prosome, macropain) 26S subunit, ATPas... [more]
Psmc11.095e-10950.62protease (prosome, macropain) 26S subunit, ATPase ... [more]
back to top
BLAST of 26S proteasome regulatory subunit 8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O18413|PRS8_DROME0.000e+087.9226S proteasome regulatory subunit 8 OS=Drosophila ... [more]
sp|P54814|PRS8_MANSE0.000e+087.4026S proteasome regulatory subunit 8 OS=Manduca sex... [more]
sp|P62198|PRS8_RAT0.000e+087.8926S proteasome regulatory subunit 8 OS=Rattus norv... [more]
sp|P62197|PRS8_PIG0.000e+087.8926S proteasome regulatory subunit 8 OS=Sus scrofa ... [more]
sp|P62196|PRS8_MOUSE0.000e+087.8926S proteasome regulatory subunit 8 OS=Mus musculu... [more]
back to top
BLAST of 26S proteasome regulatory subunit 8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3NPY00.000e+084.7226S protease regulatory subunit 8 OS=Schistocephal... [more]
A0A183TJS90.000e+090.8226S protease regulatory subunit 8 OS=Schistocephal... [more]
R7URK70.000e+090.03AAA domain-containing protein OS=Capitella teleta ... [more]
A0A2C9JJZ00.000e+089.51AAA domain-containing protein OS=Biomphalaria glab... [more]
A0A0R3W1M90.000e+084.03AAA domain-containing protein OS=Taenia asiatica O... [more]
back to top
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmc50.000e+086.84proteasome 26S subunit, ATPase 5 [Source:NCBI gene... [more]
psmc50.000e+084.30proteasome 26S subunit, ATPase 5 [Source:NCBI gene... [more]
psmc50.000e+084.30proteasome 26S subunit, ATPase 5 [Source:NCBI gene... [more]
psmc25.644e-11855.02proteasome 26S subunit, ATPase 2 [Source:NCBI gene... [more]
psmc21.066e-11755.02proteasome 26S subunit, ATPase 2 [Source:NCBI gene... [more]
back to top
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmc50.000e+084.52proteasome 26S subunit, ATPase 5 [Source:ZFIN;Acc:... [more]
ENSPMAT00000001244.11.285e-11654.84pep scaffold:Pmarinus_7.0:GL482260:6416:9764:-1 ge... [more]
ENSPMAT00000010299.12.356e-10753.26pep scaffold:Pmarinus_7.0:GL479893:343:6144:1 gene... [more]
ENSPMAT00000006168.17.810e-9047.79pep scaffold:Pmarinus_7.0:GL486395:211235:217029:-... [more]
vcp7.763e-5937.77valosin containing protein [Source:NCBI gene;Acc:3... [more]
back to top
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RPT60.000e+073.51ATPase of the 19S regulatory particle of the 26S p... [more]
RPT14.880e-11453.90ATPase of the 19S regulatory particle of the 26S p... [more]
RPT22.926e-10550.16ATPase of the 19S regulatory particle of the 26S p... [more]
RPT44.326e-10147.02ATPase of the 19S regulatory particle of the 26S p... [more]
RPT51.062e-10050.50ATPase of the 19S regulatory particle of the 26S p... [more]
back to top
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO495240.000e+087.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374739.511e-11754.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341603.310e-10950.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375022.128e-10351.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434814.522e-10046.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 26S proteasome regulatory subunit 8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmc50.000e+087.89proteasome 26S subunit, ATPase 5 [Source:NCBI gene... [more]
psmc50.000e+087.89proteasome 26S subunit, ATPase 5 [Source:NCBI gene... [more]
psmc22.588e-11855.02proteasome 26S subunit, ATPase 2 [Source:NCBI gene... [more]
psmc24.034e-11855.02proteasome 26S subunit, ATPase 2 [Source:NCBI gene... [more]
psmc63.141e-11352.13proteasome 26S subunit, ATPase 6 [Source:NCBI gene... [more]
back to top
BLAST of 26S proteasome regulatory subunit 8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066841.10.000e+0100.00SMESG000066841.1[more]
SMESG000019320.10.000e+069.85SMESG000019320.1[more]
SMESG000032352.10.000e+071.09SMESG000032352.1[more]
SMESG000078696.10.000e+070.31SMESG000078696.1[more]
SMESG000044108.17.966e-11653.72SMESG000044108.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008320 ID=SMED30008320|Name=26S proteasome regulatory subunit 8|organism=Schmidtea mediterranea sexual|type=transcript|length=2129bp
ATAATTTCCGTATAATTTTATAAGTTTAAAATTTGTTTTAATGTATATAA
TCGTTATAGTTTCTTTGAATTATTTAAATTAATTTTAATGGCTGCAATTG
AAGTAGATCCTATGCCCAGTACTGTACAGTACAAAACTAATGAGCAATCA
TCTAAAGTGTTGTACTCTACTAATGCGATGTTATTATCAAATAAGGAATC
TAGTGAAAATCGAGAAGGAATTCGAAATTATTACATTAGTAAAATTGATG
AATTGCAACAAATGATTACGCAAAAAACTCAAAACTTAAGACGACATGAA
GCTCAGCGAAATGAATTAAACTCTAAGGTGCGTTTATTACGGGAAGAGTT
GCAACTTTTACAAGAACAAGGATCTTATGTTGGTGAAGTTATTAAACCTA
TCAATAAAACAAAAGTTCTGGTTAAAATTCATCCAGAAGGCAAATACATT
GTCGATCTTGATAAAGGTATTGAAATGTCACAAGTCACACCTAATTCAAG
AGTTGCTCTGAGAAATGACAGTTACATGCTTCATAAAATTTTACCAAGCA
AAGTTGACCCACTTGTTTCTCTTATGATGGTTGAGAAAGTCCCAGATTCC
ACCTATGAAATGGTTGGGGGCCTTGACAAACAAATCAAAGAAATAAAAGA
GGTAATTGAATTGCCTGTTAAACATCCGGAATTGTTTGAAGCGCTGGGAA
TAGCCCAACCGAAAGGTGTTTTACTCTATGGACCACCAGGAACAGGTAAA
ACATTGCTAGCGAGAGCTGTTGCTCATCACACTGAATGCACATTTATCCG
AGTTAGTGGCTCTGAGTTGGTCCAAAAATTTATCGGCGAGGGAGCGAGAA
TGGTGCGTGAATTATTTGTTATGGCCCGTGAACATTCACCTTCAATAATT
TTCATGGATGAAGTCGATTCTATCGGCTCAACACGATTAGACAGTGGTTC
TGGTGGAGATAGTGAAGTACAGAGAACAATGTTGGAGTTGCTAAATCAAT
TGGACGGATTTGAGCCAACTCAGAATATCAAAATTATAATGGCTACTAAT
CGTATCGATATTCTTGACAGTGCGTTGTTACGGCCAGGTCGTATCGATCG
TAAAATTGAATTCCCAGCTCCAAATGAAGAAGCTCGTCTTGATATATTGA
AAATCCATTCAAGAAAAATGAATCTGACTCGTGGTATCGATTTGAGGAAA
ATCGCTGAATTGATGCCTGGAGCAAGCGGTGCCGAAATGAAGGGAGTGTG
TACCGAGGCTGGAATGTACGCATTGCGAGAACGCCGTGTCCATGTCACAC
AGGAAGATTTTGAATTAGCCGTGGCCAAAATCATGCAGAAGGACTCAGAG
AAAAATGTGTCTATAAAGAAGCTGTGGAAATAAATAGACTGATAATATAT
TTCTTATTTATATTCTTGTACATTTTCGATGATTTCGTTGCGCCGTTCCG
GTCTACATTATTTATGAATAGTCGATATCATCAGTATTATAATTATTGTT
ATTAATATTATTTTGTTTTGCATGTTCCTTTACACTAAGGCTAAGTGGTA
ACGGCGCTGTCAAGTTGAACTAGTACAACTATTATCAATCAATATTAAAT
TTAAAATCATCATTTTATGCTGGTGTTTTTGCTTGCTAAAATGCTTACAT
GCGTGTTTTTATATTTGCAAGCATTTTGCATTTGTTTGTAAATATTTTAC
TTTTATGTAACTTAGAATTAATTCGATTAGGTAAATGGTAAGTGACTTGT
TACTGTTGAGTTGGCTTTTATTGATCCTATATAAGTTTTGGCTATTGAGG
TTCAGTTATTGGAGGTTGACCGGACTATTTATGCAATTTGTAGATTTGTA
TGGAATTAAAGATGCTACCAATCTCACAATTTGTCTAATCTTAAATAGAG
GTCCAGTTATTCTATTAGTTTTAAACTGGCAAGATTTCAACATTTTTAAG
GTCAGATGCGATGTATATTGCTGCCTCTCCGTATAGGAAGCTTCTTGTGT
GATAAAAATAGTTTTAATTTCTAGGCTATGCTTGGTGAATTCTTATTTTA
TGTTACCGATGTTAATTCATAGTGCGAGGTTAATTTTGATTTTAGCATAA
TCATTGTTTAGTTTAATTGTAAAGTCACA
back to top

protein sequence of SMED30008320-orf-1

>SMED30008320-orf-1 ID=SMED30008320-orf-1|Name=SMED30008320-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=432bp
MAAIEVDPMPSTVQYKTNEQSSKVLYSTNAMLLSNKESSENREGIRNYYI
SKIDELQQMITQKTQNLRRHEAQRNELNSKVRLLREELQLLQEQGSYVGE
VIKPINKTKVLVKIHPEGKYIVDLDKGIEMSQVTPNSRVALRNDSYMLHK
ILPSKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELF
EALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIG
EGARMVRELFVMAREHSPSIIFMDEVDSIGSTRLDSGSGGDSEVQRTMLE
LLNQLDGFEPTQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEEAR
LDILKIHSRKMNLTRGIDLRKIAELMPGASGAEMKGVCTEAGMYALRERR
VHVTQEDFELAVAKIMQKDSEKNVSIKKLWK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000208testis
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR032501Prot_ATP_ID_OB
IPR00593726S_Psome_P45-like
IPR041569AAA_lid_3
IPR027417P-loop_NTPase
IPR003959ATPase_AAA_core
IPR003960ATPase_AAA_CS
IPR003593AAA+_ATPase
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0016787hydrolase activity
GO:0016887ATPase activity
GO:0017025TBP-class protein binding
GO:0036402proteasome-activating ATPase activity
GO:0000166nucleotide binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005838proteasome regulatory particle
GO:0005875microtubule associated complex
GO:0008540proteasome regulatory particle, base subcomplex
GO:0031595nuclear proteasome complex
GO:0031597cytosolic proteasome complex
GO:0000502proteasome complex
Vocabulary: biological process
TermDefinition
GO:0006974cellular response to DNA damage stimulus
GO:0030163protein catabolic process
GO:0030433ubiquitin-dependent ERAD pathway
GO:0043161proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0045899positive regulation of RNA polymerase II transcriptional preinitiation complex assembly
GO:1901800positive regulation of proteasomal protein catabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 53..94
NoneNo IPR availableGENE3DG3DSA:2.40.50.140coord: 59..163
e-value: 8.0E-34
score: 117.8
NoneNo IPR availableGENE3DG3DSA:1.10.8.60coord: 345..417
e-value: 2.2E-25
score: 90.2
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 164..344
e-value: 6.7E-68
score: 230.1
NoneNo IPR availablePANTHERPTHR2307326S PROTEASE REGULATORY SUBUNITcoord: 39..428
NoneNo IPR availablePANTHERPTHR23073:SF30coord: 39..428
NoneNo IPR availableCDDcd00009AAAcoord: 177..343
e-value: 3.3281E-28
score: 106.847
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 207..346
e-value: 1.2E-23
score: 94.5
IPR032501Proteasomal ATPase OB C-terminal domainPFAMPF16450Prot_ATP_ID_OBcoord: 98..153
e-value: 7.1E-5
score: 22.7
IPR00593726S proteasome regulatory subunit P45-likeTIGRFAMTIGR01242TIGR01242coord: 55..416
e-value: 4.2E-139
score: 461.7
IPR003959ATPase, AAA-type, corePFAMPF00004AAAcoord: 211..343
e-value: 8.2E-42
score: 142.8
IPR041569AAA ATPase, AAA+ lid domainPFAMPF17862AAA_lid_3coord: 367..409
e-value: 9.6E-13
score: 47.7
IPR003960ATPase, AAA-type, conserved sitePROSITEPS00674AAAcoord: 314..332
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 164..414