IMD domain-containing protein

Overview
NameIMD domain-containing protein
Smed IDSMED30008314
Length (bp)2693
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of IMD domain-containing protein (SMED30008314) t-SNE clustered cells

Violin plots show distribution of expression levels for IMD domain-containing protein (SMED30008314) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of IMD domain-containing protein (SMED30008314) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for IMD domain-containing protein (SMED30008314) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008314

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30008314h1SMcG0018181 Contig47964uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008314h1SMcG0018181 Contig47964newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30008314h1SMcG0018181 dd_Smed_v4_3500_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30008314h1SMcG0018181 dd_Smed_v4_3500_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30008314h1SMcG0018181 dd_Smed_v4_3500_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30008314h1SMcG0018181 dd_Smed_v4_3500_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008314h1SMcG0018181 dd_Smed_v4_3500_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of IMD domain-containing protein vs. Ensembl Human
Match: MTSS2 (MTSS I-BAR domain containing 2 [Source:HGNC Symbol;Acc:HGNC:25094])

HSP 1 Score: 94.7449 bits (234), Expect = 2.890e-19
Identity = 58/194 (29.90%), Postives = 110/194 (56.70%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNIQE 672
            V D+A+ +    ++ G +LT++ +R + IE K+    + L E+L + L + + +W+K +  L ++   ++K+A  E +K  ++  + +KK RK+  GK  L      Q+D A QD  +    +EE E+ A+RRA IEER RF  F+  L+P+++ +L+M  ++ +L+ ++  L    +E   + P   EQ I++
Sbjct:   60 VADMATNTRGATRDIGSALTRMCMRHRSIETKLRQFTNALLESLINPLQERIEDWKKAANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKARKELLGKGDLQP----QLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDLVVLTAEP-HKLPPASEQVIKD 248          
BLAST of IMD domain-containing protein vs. Ensembl Human
Match: MTSS2 (MTSS I-BAR domain containing 2 [Source:HGNC Symbol;Acc:HGNC:25094])

HSP 1 Score: 90.5077 bits (223), Expect = 6.589e-18
Identity = 57/194 (29.38%), Postives = 109/194 (56.19%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNIQE 672
            V D+A+ +    ++ G +LT++ +R + IE K+    + L E+L + L + + +W+K +  L ++   ++K+A  E +K  ++  + +K+ R K  GK  L      Q+D A QD  +    +EE E+ A+RRA IEER RF  F+  L+P+++ +L+M  ++ +L+ ++  L    +E   + P   EQ I++
Sbjct:   60 VADMATNTRGATRDIGSALTRMCMRHRSIETKLRQFTNALLESLINPLQERIEDWKKAANQLDKDHAKEYKRARHEIKKKSSDTLKLQKR-RAKVPGKGDLQP----QLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDLVVLTAEP-HKLPPASEQVIKD 247          
BLAST of IMD domain-containing protein vs. Ensembl Human
Match: MTSS1 (MTSS I-BAR domain containing 1 [Source:HGNC Symbol;Acc:HGNC:20443])

HSP 1 Score: 88.9669 bits (219), Expect = 2.169e-17
Identity = 60/194 (30.93%), Postives = 108/194 (55.67%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLD--EFPEELEQNI 666
            V D+A+ +    +  G +LT++ +R + IE K+   +S L + L + L + + EW+K +  L ++   ++KKA  E +K  ++  + +KK  KK  G +        Q+D A QD  +K   +EE E+ A+R+A IEER RF  F+ +L+P+++ ++SM  ++ +L+ +   L   KS  +D  + P   EQ I
Sbjct:   61 VADMATNTRGGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKA-KKGRGDI------QPQLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDL---KSLTMDPHKLPSSSEQVI 244          
BLAST of IMD domain-containing protein vs. Ensembl Human
Match: MTSS1 (MTSS I-BAR domain containing 1 [Source:HGNC Symbol;Acc:HGNC:20443])

HSP 1 Score: 88.1965 bits (217), Expect = 2.959e-17
Identity = 60/194 (30.93%), Postives = 108/194 (55.67%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLD--EFPEELEQNI 666
            V D+A+ +    +  G +LT++ +R + IE K+   +S L + L + L + + EW+K +  L ++   ++KKA  E +K  ++  + +KK  KK  G +        Q+D A QD  +K   +EE E+ A+R+A IEER RF  F+ +L+P+++ ++SM  ++ +L+ +   L   KS  +D  + P   EQ I
Sbjct:   61 VADMATNTRGGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKA-KKGRGDI------QPQLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDL---KSLTMDPHKLPSSSEQVI 244          
BLAST of IMD domain-containing protein vs. Ensembl Human
Match: MTSS1 (MTSS I-BAR domain containing 1 [Source:HGNC Symbol;Acc:HGNC:20443])

HSP 1 Score: 88.1965 bits (217), Expect = 3.879e-17
Identity = 59/194 (30.41%), Postives = 110/194 (56.70%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLD--EFPEELEQNI 666
            V D+A+ +    +  G +LT++ +R + IE K+   +S L + L + L + + EW+K +  L ++   ++KKA  E +K  ++  + +KK +K +   +G  +    Q+D A QD  +K   +EE E+ A+R+A IEER RF  F+ +L+P+++ ++SM  ++ +L+ +   L   KS  +D  + P   EQ I
Sbjct:   61 VADMATNTRGGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKKVDT--LGRGDIQP-QLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDL---KSLTMDPHKLPSSSEQVI 248          
BLAST of IMD domain-containing protein vs. Ensembl Fly
Match: mim (gene:FBgn0053558 transcript:FBtr0332943)

HSP 1 Score: 80.1073 bits (196), Expect = 7.565e-15
Identity = 45/175 (25.71%), Postives = 93/175 (53.14%), Query Frame = 1
Query:   85 HSVCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQL 609
              + D A+ S    K  G +LT++ LR K +E ++ T  S + + L   L + + +W++T   + ++   ++K+   E +K  ++  R +KK RK      G ++     +D   QD   +R  +EE+E+ ++R A +EER R+  F+ +L+P++  +  +  +L +L+E +  +
Sbjct:   59 QKIADAATNSRGASKEIGTALTRVCLRHKAVETRLKTFTSTIMDCLVQPLQERIEDWKRTVATIDKDHAKEYKRCRSELKKRSSDTLRLQKKARK------GQTDGLQSLMDSHMQDVTLRRAELEEVEKKSLRAAMVEERLRYCSFVHMLQPVVHEECEVMSELGHLQEAMQSI 227          
BLAST of IMD domain-containing protein vs. Ensembl Fly
Match: mim (gene:FBgn0053558 transcript:FBtr0332944)

HSP 1 Score: 80.1073 bits (196), Expect = 7.817e-15
Identity = 47/172 (27.33%), Postives = 93/172 (54.07%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQ--IDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVV 600
            + D A+ S    K  G +LT++ LR K +E ++ T  S + + L   L + + +W++T   + ++   ++K+   E +K  ++  R +KK RK         +T  LQ  +D   QD   +R  +EE+E+ ++R A +EER R+  F+ +L+P++  +  +  +L +L+E +
Sbjct:   61 IADAATNSRGASKEIGTALTRVCLRHKAVETRLKTFTSTIMDCLVQPLQERIEDWKRTVATIDKDHAKEYKRCRSELKKRSSDTLRLQKKARK--------GQTDGLQSLMDSHMQDVTLRRAELEEVEKKSLRAAMVEERLRYCSFVHMLQPVVHEECEVMSELGHLQEAM 224          
BLAST of IMD domain-containing protein vs. Ensembl Fly
Match: mim (gene:FBgn0053558 transcript:FBtr0302035)

HSP 1 Score: 79.7221 bits (195), Expect = 8.328e-15
Identity = 47/172 (27.33%), Postives = 93/172 (54.07%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQ--IDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVV 600
            + D A+ S    K  G +LT++ LR K +E ++ T  S + + L   L + + +W++T   + ++   ++K+   E +K  ++  R +KK RK         +T  LQ  +D   QD   +R  +EE+E+ ++R A +EER R+  F+ +L+P++  +  +  +L +L+E +
Sbjct:   61 IADAATNSRGASKEIGTALTRVCLRHKAVETRLKTFTSTIMDCLVQPLQERIEDWKRTVATIDKDHAKEYKRCRSELKKRSSDTLRLQKKARK--------GQTDGLQSLMDSHMQDVTLRRAELEEVEKKSLRAAMVEERLRYCSFVHMLQPVVHEECEVMSELGHLQEAM 224          
BLAST of IMD domain-containing protein vs. Ensembl Fly
Match: mim (gene:FBgn0053558 transcript:FBtr0302577)

HSP 1 Score: 79.7221 bits (195), Expect = 9.362e-15
Identity = 47/172 (27.33%), Postives = 93/172 (54.07%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQ--IDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVV 600
            + D A+ S    K  G +LT++ LR K +E ++ T  S + + L   L + + +W++T   + ++   ++K+   E +K  ++  R +KK RK         +T  LQ  +D   QD   +R  +EE+E+ ++R A +EER R+  F+ +L+P++  +  +  +L +L+E +
Sbjct:   61 IADAATNSRGASKEIGTALTRVCLRHKAVETRLKTFTSTIMDCLVQPLQERIEDWKRTVATIDKDHAKEYKRCRSELKKRSSDTLRLQKKARK--------GQTDGLQSLMDSHMQDVTLRRAELEEVEKKSLRAAMVEERLRYCSFVHMLQPVVHEECEVMSELGHLQEAM 224          
BLAST of IMD domain-containing protein vs. Ensembl Fly
Match: mim (gene:FBgn0053558 transcript:FBtr0113470)

HSP 1 Score: 79.7221 bits (195), Expect = 9.544e-15
Identity = 47/172 (27.33%), Postives = 93/172 (54.07%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQ--IDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVV 600
            + D A+ S    K  G +LT++ LR K +E ++ T  S + + L   L + + +W++T   + ++   ++K+   E +K  ++  R +KK RK         +T  LQ  +D   QD   +R  +EE+E+ ++R A +EER R+  F+ +L+P++  +  +  +L +L+E +
Sbjct:   61 IADAATNSRGASKEIGTALTRVCLRHKAVETRLKTFTSTIMDCLVQPLQERIEDWKRTVATIDKDHAKEYKRCRSELKKRSSDTLRLQKKARK--------GQTDGLQSLMDSHMQDVTLRRAELEEVEKKSLRAAMVEERLRYCSFVHMLQPVVHEECEVMSELGHLQEAM 224          
BLAST of IMD domain-containing protein vs. Ensembl Zebrafish
Match: mtss1 (MTSS I-BAR domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-081105-141])

HSP 1 Score: 93.5893 bits (231), Expect = 4.603e-19
Identity = 59/192 (30.73%), Postives = 103/192 (53.65%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNI 666
            V DIA+ +    K  G +LT++ +R + IE K+    + L +NL + L+  + EW+K +  L  ++DH       EY+K+ +E+++      K         +   +Q+D A QD   +   +EE E+ A+ RA IEER RF  F+ +LKP+LD ++SM  ++ +L+ ++  L G  + + +  P   EQ I
Sbjct:   61 VADIATGTRGATKEIGSALTRMCMRHRSIENKLKLFTTALMDNLITPLELKIEEWKKVASQL--DKDHAK-----EYKKARSEIKKKSSDTIKLQKKVKKGKDEVRMQLDSALQDVNTRYAVLEETEKRAVCRALIEERGRFCSFVTMLKPVLDEEISMLGEVTHLQTILEDL-GNLTADPNTLPPASEQVI 244          
BLAST of IMD domain-containing protein vs. Ensembl Zebrafish
Match: mtss1la (MTSS I-BAR domain containing 2a [Source:ZFIN;Acc:ZDB-GENE-030219-89])

HSP 1 Score: 92.0485 bits (227), Expect = 1.269e-18
Identity = 54/192 (28.12%), Postives = 106/192 (55.21%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNI 666
            V D+A+ +    ++ G +LT++ +R + IE K+    + L E +   L   + EW+KT+  L ++   ++K++  E +K  ++  + +KK RK+  G+ GL      Q++ A QD  +    +EE E+ A+RRA +EER R+  F+  L+P++  +++M  +  +L+ ++  L    + +  + PE  EQ I
Sbjct:   60 VADMATNTRGATRDIGSALTRMCMRHRSIEAKLRHFTNALMEKMIGPLQDKIEEWKKTAALLDKDHAKEYKRSRQEIKKKSSDTIKLQKKARKELPGRGGLQP----QLNSAMQDVNDMYLLMEETEKQAVRRALLEERGRYCTFISFLQPVVVGEIAMLGEATHLQAIIEDLT-VLTTDPHKLPEASEQVI 246          
BLAST of IMD domain-containing protein vs. Ensembl Zebrafish
Match: mtss1lb (MTSS I-BAR domain containing 2b [Source:ZFIN;Acc:ZDB-GENE-140718-4])

HSP 1 Score: 90.8929 bits (224), Expect = 3.184e-18
Identity = 50/173 (28.90%), Postives = 100/173 (57.80%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQL 609
            V D+A+ +    ++ G +LT++ +R + IE K+    + L E+L + L   + +W+KT+  L ++   ++K++  E +K  ++  + +KK RK   G+  L      Q+D A QD  +    +EE E+ A+RRA +EER RF  F+  L+P+++ +++M  ++ +L+ ++  L
Sbjct:   65 VADMATNTRGATRDIGSALTRMCMRHRSIEAKLRHFTNALMESLITPLQDRIEDWKKTANQLDKDHAKEYKRSRHEIKKKSSDTMKLQKKARK---GRGDLQP----QLDSAMQDVNDMYLLMEETEKQAVRRALVEERGRFCTFISFLQPVVNGEIAMLGEITHLQAIIDDL 230          
BLAST of IMD domain-containing protein vs. Ensembl Zebrafish
Match: mtss1la (MTSS I-BAR domain containing 2a [Source:ZFIN;Acc:ZDB-GENE-030219-89])

HSP 1 Score: 88.9669 bits (219), Expect = 1.440e-17
Identity = 54/192 (28.12%), Postives = 105/192 (54.69%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNI 666
            V D+A+ +    ++ G +LT++ +R + IE K+    + L E +   L   + EW+KT+  L ++   ++K++  E +K  ++  + +KK RK   G+ GL      Q++ A QD  +    +EE E+ A+RRA +EER R+  F+  L+P++  +++M  +  +L+ ++  L    + +  + PE  EQ I
Sbjct:  108 VADMATNTRGATRDIGSALTRMCMRHRSIEAKLRHFTNALMEKMIGPLQDKIEEWKKTAALLDKDHAKEYKRSRQEIKKKSSDTIKLQKKARK---GRGGLQP----QLNSAMQDVNDMYLLMEETEKQAVRRALLEERGRYCTFISFLQPVVVGEIAMLGEATHLQAIIEDLT-VLTTDPHKLPEASEQVI 291          
BLAST of IMD domain-containing protein vs. Ensembl Xenopus
Match: acss2.2 (acyl-CoA synthetase short-chain family member 2, gene 2 [Source:Xenbase;Acc:XB-GENE-5916994])

HSP 1 Score: 100.138 bits (248), Expect = 4.993e-21
Identity = 55/173 (31.79%), Postives = 103/173 (59.54%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQL 609
            V D+A+ +    ++ G +LT++ +R + IE K+    + L E+L + L + + +W+KT+  L +E   ++K+A  E +K  ++  + +KK RK+  GK  L      Q+D+A QD  +    +EE E+ A+RRA IEER RF  F+ LL+P+++ ++ M  ++ +L+ ++  L
Sbjct:   60 VADMATNTRGATRDIGSALTRMCMRHRSIESKLRHFTNALMESLINPLQERIEDWKKTANTLDKEHAREYKRARHEIKKKSSDTLKLQKKARKEVLGKGDLQP----QLDHALQDVNDMYLLLEETEKQAVRRALIEERGRFCSFITLLQPVVNGEIHMLAEVTHLQAIIEDL 228          
BLAST of IMD domain-containing protein vs. Ensembl Xenopus
Match: acss2.2 (acyl-CoA synthetase short-chain family member 2, gene 2 [Source:Xenbase;Acc:XB-GENE-5916994])

HSP 1 Score: 99.7525 bits (247), Expect = 6.812e-21
Identity = 55/173 (31.79%), Postives = 103/173 (59.54%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQL 609
            V D+A+ +    ++ G +LT++ +R + IE K+    + L E+L + L + + +W+KT+  L +E   ++K+A  E +K  ++  + +KK RK+  GK  L      Q+D+A QD  +    +EE E+ A+RRA IEER RF  F+ LL+P+++ ++ M  ++ +L+ ++  L
Sbjct:   60 VADMATNTRGATRDIGSALTRMCMRHRSIESKLRHFTNALMESLINPLQERIEDWKKTANTLDKEHAREYKRARHEIKKKSSDTLKLQKKARKEVLGKGDLQP----QLDHALQDVNDMYLLLEETEKQAVRRALIEERGRFCSFITLLQPVVNGEIHMLAEVTHLQAIIEDL 228          
BLAST of IMD domain-containing protein vs. Ensembl Xenopus
Match: acss2.2 (acyl-CoA synthetase short-chain family member 2, gene 2 [Source:Xenbase;Acc:XB-GENE-5916994])

HSP 1 Score: 96.6709 bits (239), Expect = 7.413e-20
Identity = 55/173 (31.79%), Postives = 102/173 (58.96%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQL 609
            V D+A+ +    ++ G +LT++ +R + IE K+    + L E+L + L + + +W+KT+  L +E   ++K+A  E +K  ++  + +KK RK   GK  L      Q+D+A QD  +    +EE E+ A+RRA IEER RF  F+ LL+P+++ ++ M  ++ +L+ ++  L
Sbjct:   60 VADMATNTRGATRDIGSALTRMCMRHRSIESKLRHFTNALMESLINPLQERIEDWKKTANTLDKEHAREYKRARHEIKKKSSDTLKLQKKARK---GKGDLQP----QLDHALQDVNDMYLLLEETEKQAVRRALIEERGRFCSFITLLQPVVNGEIHMLAEVTHLQAIIEDL 225          
BLAST of IMD domain-containing protein vs. Ensembl Xenopus
Match: acss2.2 (acyl-CoA synthetase short-chain family member 2, gene 2 [Source:Xenbase;Acc:XB-GENE-5916994])

HSP 1 Score: 96.6709 bits (239), Expect = 8.394e-20
Identity = 55/173 (31.79%), Postives = 102/173 (58.96%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQL 609
            V D+A+ +    ++ G +LT++ +R + IE K+    + L E+L + L + + +W+KT+  L +E   ++K+A  E +K  ++  + +KK RK   GK  L      Q+D+A QD  +    +EE E+ A+RRA IEER RF  F+ LL+P+++ ++ M  ++ +L+ ++  L
Sbjct:   79 VADMATNTRGATRDIGSALTRMCMRHRSIESKLRHFTNALMESLINPLQERIEDWKKTANTLDKEHAREYKRARHEIKKKSSDTLKLQKKARK---GKGDLQP----QLDHALQDVNDMYLLLEETEKQAVRRALIEERGRFCSFITLLQPVVNGEIHMLAEVTHLQAIIEDL 244          
BLAST of IMD domain-containing protein vs. Ensembl Xenopus
Match: gphn (gephyrin [Source:Xenbase;Acc:XB-GENE-989642])

HSP 1 Score: 89.3521 bits (220), Expect = 9.027e-18
Identity = 50/160 (31.25%), Postives = 93/160 (58.13%), Query Frame = 1
Query:  118 CCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEV 597
            C  +  G +LT++ +R + IE K+   +S L + L + L + + EW+K +  L ++   ++KKA  E +K  ++  + +KK  KK  G +        Q+D A QD  +K   +EE E+ A+R+A IEER RF  F+ +L+P+++ ++SM  ++ +L+ +
Sbjct:   12 CATREVGSALTRMCMRHRSIESKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKA-KKGRGDI------QPQLDSAMQDVNDKYLLLEETEKQAVRKALIEERSRFCSFISMLRPVIEEEISMLGEITHLQTI 164          
BLAST of IMD domain-containing protein vs. Ensembl Mouse
Match: Mtss2 (MTSS I-BAR domain containing 2 [Source:MGI Symbol;Acc:MGI:3039591])

HSP 1 Score: 91.2781 bits (225), Expect = 2.665e-18
Identity = 53/173 (30.64%), Postives = 101/173 (58.38%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQL 609
            V D+A+ +    ++ G +LT++ +R + IE K+    + L E+L + L + + +W+K++  L ++   ++K+A  E +K  ++  + +KK RK   GK  L      Q+D A QD  +    +EE E+ A+RRA IEER RF  F+  L+P+++ +L+M  ++ +L+ ++  L
Sbjct:   60 VADMATNTRGATRDIGSALTRMCMRHRSIETKLRQFTNALLESLINPLQERIEDWKKSANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKARK---GKGDLQP----QLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDL 225          
BLAST of IMD domain-containing protein vs. Ensembl Mouse
Match: Mtss1 (MTSS I-BAR domain containing 1 [Source:MGI Symbol;Acc:MGI:2384818])

HSP 1 Score: 90.1225 bits (222), Expect = 6.064e-18
Identity = 60/194 (30.93%), Postives = 110/194 (56.70%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLD--EFPEELEQNI 666
            V D+A+ +    +  G +LT++ +R + IE K+   +S L + L + L + + EW+K +  L ++   ++KKA  E +K  ++  + +KK +K +A   G  +    Q+D A QD  +K   +EE E+ A+R+A IEER RF  F+ +L+P+++ ++SM  ++ +L+ +   L   KS  +D  + P   EQ I
Sbjct:   61 VADMATNTRGGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKKVDAQGRGDIQP---QLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDL---KSLTMDPHKLPSSSEQVI 248          
BLAST of IMD domain-containing protein vs. Ensembl Mouse
Match: Mtss2 (MTSS I-BAR domain containing 2 [Source:MGI Symbol;Acc:MGI:3039591])

HSP 1 Score: 87.0409 bits (214), Expect = 5.265e-17
Identity = 51/170 (30.00%), Postives = 99/170 (58.24%), Query Frame = 1
Query:  100 IASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQL 609
            +A+ +    ++ G +LT++ +R + IE K+    + L E+L + L + + +W+K++  L ++   ++K+A  E +K  ++  + +KK RK   GK  L      Q+D A QD  +    +EE E+ A+RRA IEER RF  F+  L+P+++ +L+M  ++ +L+ ++  L
Sbjct:    1 MATNTRGATRDIGSALTRMCMRHRSIETKLRQFTNALLESLINPLQERIEDWKKSANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKARK---GKGDLQP----QLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDL 163          
BLAST of IMD domain-containing protein vs. Ensembl Mouse
Match: Mtss2 (MTSS I-BAR domain containing 2 [Source:MGI Symbol;Acc:MGI:3039591])

HSP 1 Score: 67.781 bits (164), Expect = 1.032e-11
Identity = 39/120 (32.50%), Postives = 71/120 (59.17%), Query Frame = 1
Query:  250 EWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQL 609
            +W+K++  L ++   ++K+A  E +K  ++  + +KK RK   GK  L      Q+D A QD  +    +EE E+ A+RRA IEER RF  F+  L+P+++ +L+M  ++ +L+ ++  L
Sbjct:    3 DWKKSANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKARK---GKGDLQP----QLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDL 115          
BLAST of IMD domain-containing protein vs. Ensembl Mouse
Match: Mtss2 (MTSS I-BAR domain containing 2 [Source:MGI Symbol;Acc:MGI:3039591])

HSP 1 Score: 63.1586 bits (152), Expect = 6.783e-10
Identity = 38/111 (34.23%), Postives = 66/111 (59.46%), Query Frame = 1
Query:  283 ERDH--DWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQL 609
            ++DH  ++K+A  E +K  ++  + +KK RK   GK  L      Q+D A QD  +    +EE E+ A+RRA IEER RF  F+  L+P+++ +L+M  ++ +L+ ++  L
Sbjct:    8 DKDHAKEYKRARHEIKKKSSDTLKLQKKARK---GKGDLQP----QLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDL 111          
BLAST of IMD domain-containing protein vs. UniProt/SwissProt
Match: sp|Q765P7|MTSS2_HUMAN (Protein MTSS 2 OS=Homo sapiens OX=9606 GN=MTSS2 PE=1 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.388e-18
Identity = 58/194 (29.90%), Postives = 110/194 (56.70%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNIQE 672
            V D+A+ +    ++ G +LT++ +R + IE K+    + L E+L + L + + +W+K +  L ++   ++K+A  E +K  ++  + +KK RK+  GK  L      Q+D A QD  +    +EE E+ A+RRA IEER RF  F+  L+P+++ +L+M  ++ +L+ ++  L    +E   + P   EQ I++
Sbjct:   60 VADMATNTRGATRDIGSALTRMCMRHRSIETKLRQFTNALLESLINPLQERIEDWKKAANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKARKELLGKGDLQP----QLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDLVVLTAEP-HKLPPASEQVIKD 248          
BLAST of IMD domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6P9S0|MTSS2_MOUSE (Protein MTSS 2 OS=Mus musculus OX=10090 GN=Mtss2 PE=1 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 1.864e-17
Identity = 53/173 (30.64%), Postives = 101/173 (58.38%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQL 609
            V D+A+ +    ++ G +LT++ +R + IE K+    + L E+L + L + + +W+K++  L ++   ++K+A  E +K  ++  + +KK RK   GK  L      Q+D A QD  +    +EE E+ A+RRA IEER RF  F+  L+P+++ +L+M  ++ +L+ ++  L
Sbjct:   60 VADMATNTRGATRDIGSALTRMCMRHRSIETKLRQFTNALLESLINPLQERIEDWKKSANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKARK---GKGDLQP----QLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDL 225          
BLAST of IMD domain-containing protein vs. UniProt/SwissProt
Match: sp|O43312|MTSS1_HUMAN (Protein MTSS 1 OS=Homo sapiens OX=9606 GN=MTSS1 PE=1 SV=2)

HSP 1 Score: 88.9669 bits (219), Expect = 1.041e-16
Identity = 60/194 (30.93%), Postives = 108/194 (55.67%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLD--EFPEELEQNI 666
            V D+A+ +    +  G +LT++ +R + IE K+   +S L + L + L + + EW+K +  L ++   ++KKA  E +K  ++  + +KK  KK  G +        Q+D A QD  +K   +EE E+ A+R+A IEER RF  F+ +L+P+++ ++SM  ++ +L+ +   L   KS  +D  + P   EQ I
Sbjct:   61 VADMATNTRGGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKA-KKGRGDI------QPQLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDL---KSLTMDPHKLPSSSEQVI 244          
BLAST of IMD domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8R1S4|MTSS1_MOUSE (Protein MTSS 1 OS=Mus musculus OX=10090 GN=Mtss1 PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 2.065e-16
Identity = 59/194 (30.41%), Postives = 109/194 (56.19%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLD--EFPEELEQNI 666
            V D+A+ +    +  G +LT++ +R + IE K+   +S L + L + L + + EW+K +  L ++   ++KKA  E +   ++  + +KK +K +A   G  +    Q+D A QD  +K   +EE E+ A+R+A IEER RF  F+ +L+P+++ ++SM  ++ +L+ +   L   KS  +D  + P   EQ I
Sbjct:   61 VADMATNTRGGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKNKSSDTLKLQKKAKKVDAQGRGDIQP---QLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDL---KSLTMDPHKLPSSSEQVI 248          
BLAST of IMD domain-containing protein vs. TrEMBL
Match: A0A1Y1KH05 (IMD domain-containing protein OS=Photinus pyralis OX=7054 PE=4 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 9.950e-22
Identity = 63/173 (36.42%), Postives = 101/173 (58.38%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQL 609
            + D A+ +    K  G +LT++ LR K +E ++ T  S + + L   L + L +W+KT LNL +E   D+K+A  E +K   +  R +KK+RK   G +        +I+   QD   KR+ +EE E+ A+R A +EER RF  F+  LKP++D +++M  +L +L+EVVSQL
Sbjct:   61 IADSATNARGATKEIGTALTRICLRHKAVETRLKTFTSAVMDCLVVPLQEKLEDWKKTVLNLDKEHAKDYKRARSELKKRSTDTLRLQKKVRKGAGGDL------HKRIECGLQDVSEKRQLLEETEKRAVRAALVEERSRFCTFVGFLKPVVDEEVAMLTELSHLQEVVSQL 227          
BLAST of IMD domain-containing protein vs. TrEMBL
Match: A0A1Y1KHF1 (IMD domain-containing protein OS=Photinus pyralis OX=7054 PE=4 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.083e-21
Identity = 68/192 (35.42%), Postives = 107/192 (55.73%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNI 666
            + D A+ +    K  G +LT++ LR K +E ++ T  S + + L   L + L +W+KT LNL +E   D+K+A  E +K   +  R +KK+RK   G +        +I+   QD   KR+ +EE E+ A+R A +EER RF  F+  LKP++D +++M  +L +L+EVVSQL    S+     P   EQ I
Sbjct:   61 IADSATNARGATKEIGTALTRICLRHKAVETRLKTFTSAVMDCLVVPLQEKLEDWKKTVLNLDKEHAKDYKRARSELKKRSTDTLRLQKKVRKGAGGDL------HKRIECGLQDVSEKRQLLEETEKRAVRAALVEERSRFCTFVGFLKPVVDEEVAMLTELSHLQEVVSQLEKNTSDP-QSLPPASEQVI 245          
BLAST of IMD domain-containing protein vs. TrEMBL
Match: A0A5N4B4P3 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_01532 PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.133e-21
Identity = 68/192 (35.42%), Postives = 107/192 (55.73%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNI 666
            + D A+ +    K  G +LT++ LR K +E ++ T  S + + L   L + L +W+KT LNL +E   D+K+A  E +K   +  R +KK+RK   G +        +I+   QD   KR+ +EE E+ A+R A +EER RF  F+  LKP++D +++M  +L +L+EVVSQL    S+     P   EQ I
Sbjct:   18 IADSATNARGATKEIGTALTRICLRHKAVETRLKTFTSAVMDCLVVPLQEKLEDWKKTVLNLDKEHAKDYKRARSELKKRSTDTLRLQKKVRKGAGGDL------HKRIECGLQDVSEKRQLLEETEKRAVRAALVEERSRFCTFVGFLKPVVDEEVAMLTELSHLQEVVSQLEKNTSDP-QSLPPASEQVI 202          
BLAST of IMD domain-containing protein vs. TrEMBL
Match: U4U350 (IMD domain-containing protein OS=Dendroctonus ponderosae OX=77166 GN=D910_02449 PE=4 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.130e-20
Identity = 65/186 (34.95%), Postives = 101/186 (54.30%), Query Frame = 1
Query:  109 KSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNI 666
            ++P   +  G +LT++ LR K +E ++      + E L   L   L EWRKT LNL +E   D+K+A  E +K   +  R +KK+RK   G V        + +   QD   +R+ +EE E+ A+R A IEER RF  F+ LLKP++D +++M  ++ +L+E V QL    S+  +  P   EQ I
Sbjct:   38 QAPRATREIGTALTRICLRHKAVENRMKHFTGVIMECLIIPLQDRLEEWRKTVLNLDKEHARDYKRARTELKKRSTDTLRLQKKMRKGAGGDV------QKRFECGLQDVTERRQLLEETEKHAVRAALIEERGRFCTFVGLLKPVVDEEVAMLTEMGHLQEAVQQLEKHTSDP-NTLPPASEQVI 216          
BLAST of IMD domain-containing protein vs. TrEMBL
Match: A0A2R2MT41 (MTSS1-like protein OS=Lingula unguis OX=7574 GN=LOC106152420 PE=4 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 2.863e-20
Identity = 63/182 (34.62%), Postives = 109/182 (59.89%), Query Frame = 1
Query:  121 CIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNI 666
              ++ G +LT+L LR K IE K+ +  S L + + + L + + +W+KT  +L +E   ++K+A  E +K+ ++  R +KK RK   GK  +      ++D A QD  +K   +EE E+ A+R A IEER RF QFL  LKP++D ++SM  ++ +L+E++  LY ++ ++ ++ P   EQ I
Sbjct:    7 ATRDIGSALTRLCLRHKSIENKLKSFTSCLMDGMVTPLQEKMEDWKKTVAHLDKEHAKEYKRARQEIKKASSDTIRLQKKARK---GKCDIQ----TRLDNAMQDVNDKYLLLEETEKQAVRNALIEERSRFCQFLGCLKPVVDEEISMLTEVTHLQEILDILY-QQCQDPNQLPASSEQVI 180          
BLAST of IMD domain-containing protein vs. Ensembl Cavefish
Match: mtss1 (MTSS I-BAR domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-081105-141])

HSP 1 Score: 98.9821 bits (245), Expect = 6.803e-21
Identity = 61/192 (31.77%), Postives = 106/192 (55.21%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNI 666
            V DIA+ +    K  G +LT++ +R + IE K+    + L +NL   L+  + EW+K S  L ++   ++KKA  + +K  ++  R +KK++K   GK    +   +Q+D A QD   +   +EE E+ A+ RA +EER RF  F+ +LKP+LD ++ M  ++ +L+ ++  L    +E  +  P   EQ I
Sbjct:   61 VADIATGTRGATKEIGSALTRMCMRHRSIESKLKLFTAALMDNLIGPLELKIEEWKKVSGQLDKDHAKEYKKARADIKKKSSDTIRLQKKVKK---GK----DEVRMQLDSALQDVNIRYAELEETEKRAVCRALVEERGRFCSFVTMLKPVLDEEIGMLGEVTHLQSILEDLCSLTAEP-NTLPPASEQVI 244          
BLAST of IMD domain-containing protein vs. Ensembl Cavefish
Match: mtss1 (MTSS I-BAR domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-081105-141])

HSP 1 Score: 98.2117 bits (243), Expect = 1.594e-20
Identity = 61/192 (31.77%), Postives = 106/192 (55.21%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNI 666
            V DIA+ +    K  G +LT++ +R + IE K+    + L +NL   L+  + EW+K S  L ++   ++KKA  + +K  ++  R +KK++K   GK    +   +Q+D A QD   +   +EE E+ A+ RA +EER RF  F+ +LKP+LD ++ M  ++ +L+ ++  L    +E  +  P   EQ I
Sbjct:   61 VADIATGTRGATKEIGSALTRMCMRHRSIESKLKLFTAALMDNLIGPLELKIEEWKKVSGQLDKDHAKEYKKARADIKKKSSDTIRLQKKVKK---GK----DEVRMQLDSALQDVNIRYAELEETEKRAVCRALVEERGRFCSFVTMLKPVLDEEIGMLGEVTHLQSILEDLCSLTAEP-NTLPPASEQVI 244          
BLAST of IMD domain-containing protein vs. Ensembl Cavefish
Match: mtss1 (MTSS I-BAR domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-081105-141])

HSP 1 Score: 98.2117 bits (243), Expect = 1.863e-20
Identity = 61/192 (31.77%), Postives = 106/192 (55.21%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNI 666
            V DIA+ +    K  G +LT++ +R + IE K+    + L +NL   L+  + EW+K S  L ++   ++KKA  + +K  ++  R +KK++K   GK    +   +Q+D A QD   +   +EE E+ A+ RA +EER RF  F+ +LKP+LD ++ M  ++ +L+ ++  L    +E  +  P   EQ I
Sbjct:   61 VADIATGTRGATKEIGSALTRMCMRHRSIESKLKLFTAALMDNLIGPLELKIEEWKKVSGQLDKDHAKEYKKARADIKKKSSDTIRLQKKVKK---GK----DEVRMQLDSALQDVNIRYAELEETEKRAVCRALVEERGRFCSFVTMLKPVLDEEIGMLGEVTHLQSILEDLCSLTAEP-NTLPPASEQVI 244          
BLAST of IMD domain-containing protein vs. Ensembl Cavefish
Match: mtss1la (MTSS1-like protein [Source:NCBI gene;Acc:103039604])

HSP 1 Score: 93.5893 bits (231), Expect = 3.796e-19
Identity = 56/192 (29.17%), Postives = 108/192 (56.25%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNI 666
            V D+A+ +    ++ G +LT++ +R + IE K+    + L E L + L   + EW+KT+  L ++   ++K++  E +K  ++  + +KK RK   G+ GL      Q+D A QD  +    +EE E+ A+RRA +EER R+  F+  L+P+++ +++M  ++ +L+ ++  L    + +  + PE  EQ I
Sbjct:   60 VADMATNTRGATRDIGSALTRMCMRHRSIEAKLRHFTNALMERLITPLQDKIEEWKKTAGLLDKDHAKEYKRSRQEIKKKSSDTLKLQKKARK---GRGGLQP----QLDSAMQDVSDMYLLMEETEKQAVRRALLEERGRYCTFISFLQPVVNGEIAMLGEVTHLQAIIDDLT-VLTTDPHKLPEASEQVI 243          
BLAST of IMD domain-containing protein vs. Ensembl Cavefish
Match: mtss1la (MTSS1-like protein [Source:NCBI gene;Acc:103039604])

HSP 1 Score: 93.5893 bits (231), Expect = 4.176e-19
Identity = 56/192 (29.17%), Postives = 108/192 (56.25%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNI 666
            V D+A+ +    ++ G +LT++ +R + IE K+    + L E L + L   + EW+KT+  L ++   ++K++  E +K  ++  + +KK RK   G+ GL      Q+D A QD  +    +EE E+ A+RRA +EER R+  F+  L+P+++ +++M  ++ +L+ ++  L    + +  + PE  EQ I
Sbjct:   60 VADMATNTRGATRDIGSALTRMCMRHRSIEAKLRHFTNALMERLITPLQDKIEEWKKTAGLLDKDHAKEYKRSRQEIKKKSSDTLKLQKKARK---GRGGLQP----QLDSAMQDVSDMYLLMEETEKQAVRRALLEERGRYCTFISFLQPVVNGEIAMLGEVTHLQAIIDDLT-VLTTDPHKLPEASEQVI 243          
BLAST of IMD domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001774.1 (pep scaffold:Pmarinus_7.0:GL476804:163249:239367:-1 gene:ENSPMAG00000001586.1 transcript:ENSPMAT00000001774.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.1301 bits (235), Expect = 2.845e-20
Identity = 65/220 (29.55%), Postives = 119/220 (54.09%), Query Frame = 1
Query:    7 FHNSINLINFE*RLMTXXXXXXXXXXHSVCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNI 666
            F N    +N + R  T++    LD+   V D+A+ +    +  G +LT++ +R + IE K+  +++ L E+L S L + + +W++++  L ++   ++K+   E +K  ++  + +KK+RK     V        Q++ A QD  +    +EE E+ A+RRA IEER RF  F+  L+P+LD ++SM E++ +L+ +V  L    S+     P   EQ I
Sbjct:   33 FVNKATKLNSQLRTTTVAVVAFLDAFQKVADMATNTRGSTREIGSALTRVCIRHRSIESKLRQVSTALMESLVSPLQEKIEDWKRSANQLDKDHAKEYKRVRQEIKKKSSDTLKLQKKVRKGKGVDV------QPQLELALQDVNDSYLLLEETEKGAVRRALIEERGRFCTFVYHLRPVLDQEISMLEEVTHLQTIVQDLTNMTSDP-HRLPPASEQVI 245          
BLAST of IMD domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002039.1 (pep scaffold:Pmarinus_7.0:GL477038:84867:99356:-1 gene:ENSPMAG00000001830.1 transcript:ENSPMAT00000002039.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.0846 bits (157), Expect = 4.331e-11
Identity = 40/134 (29.85%), Postives = 71/134 (52.99%), Query Frame = 1
Query:  208 LNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQL 609
            L  NL   L + L EW+KT+  L ++   ++KKA  E +K   +  R +KK +K N             +D A Q+  +    ++E E+ A+RRA +EER R+  F  +L+ +L  +++M  D+ +L+ ++  L
Sbjct:    2 LASNLLGPLQEKLEEWKKTAAQLDKDHAKEYKKARQEIKKKSTDTIRLQKKAKKGN-------REVQPALDSALQEVTDTYLLLQEEEKQAVRRALLEERSRYCTFTYMLRDVLTHEVAMLGDVTHLQAILDDL 128          
BLAST of IMD domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002029.1 (pep scaffold:Pmarinus_7.0:GL477038:82432:99356:-1 gene:ENSPMAG00000001830.1 transcript:ENSPMAT00000002029.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 6.566e-11
Identity = 40/134 (29.85%), Postives = 73/134 (54.48%), Query Frame = 1
Query:  208 LNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQL 609
            L  NL   L + L EW+KT+  L ++   ++KKA  E +K   +  R +KK +K+  G   +       +D A Q+  +    ++E E+ A+RRA +EER R+  F  +L+ +L  +++M  D+ +L+ ++  L
Sbjct:    2 LASNLLGPLQEKLEEWKKTAAQLDKDHAKEYKKARQEIKKKSTDTIRLQKKAKKEIIGNREVQPA----LDSALQEVTDTYLLLQEEEKQAVRRALLEERSRYCTFTYMLRDVLTHEVAMLGDVTHLQAILDDL 131          
BLAST of IMD domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002035.1 (pep scaffold:Pmarinus_7.0:GL477038:82432:99356:-1 gene:ENSPMAG00000001830.1 transcript:ENSPMAT00000002035.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 6.964e-11
Identity = 40/134 (29.85%), Postives = 71/134 (52.99%), Query Frame = 1
Query:  208 LNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQL 609
            L  NL   L + L EW+KT+  L ++   ++KKA  E +K   +  R +KK +K N             +D A Q+  +    ++E E+ A+RRA +EER R+  F  +L+ +L  +++M  D+ +L+ ++  L
Sbjct:    2 LASNLLGPLQEKLEEWKKTAAQLDKDHAKEYKKARQEIKKKSTDTIRLQKKAKKGN-------REVQPALDSALQEVTDTYLLLQEEEKQAVRRALLEERSRYCTFTYMLRDVLTHEVAMLGDVTHLQAILDDL 128          
BLAST of IMD domain-containing protein vs. Ensembl Medaka
Match: mtss1la (MTSS1-like protein [Source:NCBI gene;Acc:101164641])

HSP 1 Score: 93.2041 bits (230), Expect = 5.321e-19
Identity = 57/194 (29.38%), Postives = 110/194 (56.70%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNIQE 672
            V D+A+ S    ++ G +LT++ +R + IE K+   ++ L E L + L   + EW+KT+  L ++   ++K++  E ++   +  + +KK RK   G+  L      Q+D A QD  +    +EE E+ A+RRA +EER R+  F+ LL+P+++ +++M  ++ +L+ +V  L    +E+  + P   EQ I++
Sbjct:   60 VADMATNSRGATRDIGSALTRMCMRHRSIEAKLRHFSNVLMEGLVTPLQDRIEEWKKTANQLDKDHTKEYKRSRQEIKRKSLDTIKLQKKARK---GRGNLRP----QLDSAMQDVNDLYLLMEETEKQAVRRALLEERGRYCSFISLLQPVVNVEIAMLGEITHLQAIVEDLT-VLTEDPHKLPPASEQVIRD 245          
BLAST of IMD domain-containing protein vs. Ensembl Medaka
Match: mtss1la (MTSS1-like protein [Source:NCBI gene;Acc:101164641])

HSP 1 Score: 92.8189 bits (229), Expect = 6.523e-19
Identity = 57/194 (29.38%), Postives = 110/194 (56.70%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNIQE 672
            V D+A+ S    ++ G +LT++ +R + IE K+   ++ L E L + L   + EW+KT+  L ++   ++K++  E ++   +  + +KK RK   G+  L      Q+D A QD  +    +EE E+ A+RRA +EER R+  F+ LL+P+++ +++M  ++ +L+ +V  L    +E+  + P   EQ I++
Sbjct:   60 VADMATNSRGATRDIGSALTRMCMRHRSIEAKLRHFSNVLMEGLVTPLQDRIEEWKKTANQLDKDHTKEYKRSRQEIKRKSLDTIKLQKKARK---GRGNLRP----QLDSAMQDVNDLYLLMEETEKQAVRRALLEERGRYCSFISLLQPVVNVEIAMLGEITHLQAIVEDLT-VLTEDPHKLPPASEQVIRD 245          
BLAST of IMD domain-containing protein vs. Ensembl Medaka
Match: mtss1la (MTSS1-like protein [Source:NCBI gene;Acc:101164641])

HSP 1 Score: 92.8189 bits (229), Expect = 7.581e-19
Identity = 57/194 (29.38%), Postives = 110/194 (56.70%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNIQE 672
            V D+A+ S    ++ G +LT++ +R + IE K+   ++ L E L + L   + EW+KT+  L ++   ++K++  E ++   +  + +KK RK   G+  L      Q+D A QD  +    +EE E+ A+RRA +EER R+  F+ LL+P+++ +++M  ++ +L+ +V  L    +E+  + P   EQ I++
Sbjct:   70 VADMATNSRGATRDIGSALTRMCMRHRSIEAKLRHFSNVLMEGLVTPLQDRIEEWKKTANQLDKDHTKEYKRSRQEIKRKSLDTIKLQKKARK---GRGNLRP----QLDSAMQDVNDLYLLMEETEKQAVRRALLEERGRYCSFISLLQPVVNVEIAMLGEITHLQAIVEDLT-VLTEDPHKLPPASEQVIRD 255          
BLAST of IMD domain-containing protein vs. Ensembl Medaka
Match: MTSS1 (metastasis suppressor protein 1 [Source:NCBI gene;Acc:101157392])

HSP 1 Score: 92.4337 bits (228), Expect = 1.088e-18
Identity = 65/218 (29.82%), Postives = 113/218 (51.83%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNIQEHTIDNRSTTC--IPRSYSTLSKQK 738
            V D+A+ S    ++ G +LT++ +R + IE K+   +    E L + L + + EW++    L ++   ++KKA  E +K  ++  + +KK  KK  G +        Q++ A QD  +K   +EE E+ A+R+A IEERQRF  F+ +L+P++D + SM  +L +L+ +   L    S+   + P   EQ I +    +    C   P S ST   +K
Sbjct:   61 VADLATNSRGGTRDIGSALTRMCMRHRSIEAKLKQFSMCFLEGLINPLQEQMEEWKRGVNTLDKDHAKEYKKARQEIKKKSSDTLKLQKKA-KKGRGDI------QPQLNSAMQDVSDKYILLEETEKQALRKALIEERQRFCCFVAMLRPVVDEETSMLGELTHLQTISEDLKALTSDP-HKLPPACEQVITDLKASDYGWLCHTPPSSPSTTMSRK 270          
BLAST of IMD domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000000819.2 (MTSS I-BAR domain containing 1 [Source:NCBI gene;Acc:101170030])

HSP 1 Score: 91.2781 bits (225), Expect = 2.059e-18
Identity = 57/204 (27.94%), Postives = 114/204 (55.88%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNIQEHTIDNRSTTC 702
            V D+A+ S    ++ G +LT++ +R + IE K+   +    + L + L + + EWR+ +  L ++   ++KKA  E +K  ++  + +KK +K   G+  L      Q+D A QD  ++   +EE E+ A+R+A +EER RF  F+ +L+P++D ++SM  ++ +L+ +   L   K+  +D  P +L  + ++  +D + + C
Sbjct:   61 VADLATNSRGGTRDIGSALTRMCMRHRSIEAKLRQFSMVFLDCLINPLQEQMEEWRRAANALDKDHAKEYKKARQEIKKRSSDTLKLQKKAKK---GRGDLQP----QLDSAMQDVSDRYLLLEETEKQAVRKALVEERSRFCCFVSMLRPVVDEEMSMLGEITHLQTLTDDL---KALTMD--PHKLPPSSEQVIVDMKGSEC 252          
BLAST of IMD domain-containing protein vs. Planmine SMEST
Match: SMESG000038660.1 (SMESG000038660.1)

HSP 1 Score: 1497.64 bits (3876), Expect = 0.000e+0
Identity = 828/836 (99.04%), Postives = 829/836 (99.16%), Query Frame = 1
Query:    1 LKFHNSINLINFE*RLMTXXXXXXXXXXHSVCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNIQEHTIDNRSTTCIPRSYSTLSKQKXXXXXXXXXXXXXXXXXXXXXXXXXXXLITACMEMSSRLNENMSNLSHDSGIKSDKSLSTICDNNSNHDENVNYNWDRTLSNILIESANNESQQQNXXXXXXXXXXXXXXASTDHNSQDGVIDNANDVFPLPEQQTQDNEVHFELPLDYQDNXXXXXXXXXXXXXXXXMQATASHYQQPITIPNDNLYPNQSIPPPVYSNLQELKLNAAKKFGANTLSRISIKDRGNLIQAFNEYPESNIEESSTSFLGNSDKDKPTIPKIPTSQTKATAGKIQEAFHRSQSSVPVSVNDENPPSFNYYNDPESSVNATKIPLKGDSTIKPSMIRRGSFTTEMQVPQTPKNFNTVRKSSTQERTPLNMYSNKNRGRSMSVTREIENDHESPEKSSEDFNAIREILKRQRIVNRINGEATKPVTLPKPELPKKQSPSSNYMAYEYSNTLSSPVALRSNRFFNDRMLRQTNPNAPSGQNIQQMKYQQSRIPSDRDHDIDSAAGEEPACNDFNMSTGPEPIPSMHIERKDDKFKHQLIQMLHSSKSQEAARVAQIPASQHASNISSFYHGXXXXXXXXXXXXXXXXXQKSRTKSTIPNSKYCY 2508
            LKFHNSI       +LMTLSSSDLLDSLHSVCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNIQEHTIDNRSTTCIPRSYSTLSKQKSTASTGSHSSLNSNSMSTTSSEWNNNNLITACMEMSSRLNENMSNLSHDSGIKSDKSLSTICDNNSNHDENVNYNWDRTLSNILIESANNESQQQNDSDTECSSSEDENDASTDHNSQDGVIDNANDVFPLPEQQTQDNEVHFELPLDYQDNLPPPPTATQALPTIPTMQATASHYQQPITIPNDNLYPNQSIPPPVYSNLQELKLNAAKKFGANTLSRISIKDRGNLIQAFNEYPESNIEESSTSFLGNSDKDKPTIPKIPTSQTKATAGKIQEAFHRSQSSVPVSVNDENPPSFNYYNDPESSVNATKIPLKGDSTIKPSMIRRGSFTTEMQVPQTPKNFNTVRKSSTQERTPLNMYSNKNRGRSMSVTREIENDHESPEKSSEDFNAIREILKRQRIVNRINGEATKPVTLPKPELPKKQSPSSNYMAYEYSNTLSSPVALRSNRFFNDRMLRQTNPNAPSGQNIQQMKYQQSRIPSDRDHDIDSAAGEEPACNDFNMSTGPEPIPSMHIERKDDKFKHQLIQMLHSSKSQEAARVAQIPASQHASNISSFYHGNPNHPNHPSHPNNNSSHQKSRTKSTIPNSKYCY
Sbjct:   31 LKFHNSI-------KLMTLSSSDLLDSLHSVCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNIQEHTIDNRSTTCIPRSYSTLSKQKSTASTGSHSSLNSNSMSTTSSEWNNNNLITACMEMSSRLNENMSNLSHDSGIKSDKSLSTICDNNSNHDENVNYNWDRTLSNILIESANNESQQQNDSDTECSSSEDENDASTDHNSQDGVIDNANDVFPLPEQQTQDNEVHFELPLDYQDNLPPPPTATQALPTIPTMQATASHYQQPITIPNDNLYPNQSIPPPVYSNLQELKLNAAKKFGANTLSRISIKDRGNLIQAFNEYPESNIEESSTSFLGNSDKDKPTIPKIPTSQTKATAGKIQEAFHRSQSSVPVSVNDENPPSFNYYNDPESSVNATKIPLKGDSTIKPSMIRRGSFTTEMQVPQTPKNFNTVRKSSTQERTPLNMYSNKNRGRSMSVTREIENDHESPEKSSEDFNAIREILKRQRIVNRINGEATKPVTLPKPELPKKQSPSSNYMAYEYSNTLSSPVALRSNRFFNDRMLRQTNPNAPSGQNIQQMKYQQSRIPSDRDHDIDSAAGEEPACNDFNMSTGPEPIPSMHIERKDDKFKHQLIQMLHSSKSQEAARVAQIPASQHASNISSFYHGNPNHPNHPSHPNNNSSHQKSRTKSTIPNSKYCY 859          
BLAST of IMD domain-containing protein vs. Planmine SMEST
Match: SMESG000038660.1 (SMESG000038660.1)

HSP 1 Score: 1483 bits (3838), Expect = 0.000e+0
Identity = 823/836 (98.44%), Postives = 824/836 (98.56%), Query Frame = 1
Query:    1 LKFHNSINLINFE*RLMTXXXXXXXXXXHSVCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNIQEHTIDNRSTTCIPRSYSTLSKQKXXXXXXXXXXXXXXXXXXXXXXXXXXXLITACMEMSSRLNENMSNLSHDSGIKSDKSLSTICDNNSNHDENVNYNWDRTLSNILIESANNESQQQNXXXXXXXXXXXXXXASTDHNSQDGVIDNANDVFPLPEQQTQDNEVHFELPLDYQDNXXXXXXXXXXXXXXXXMQATASHYQQPITIPNDNLYPNQSIPPPVYSNLQELKLNAAKKFGANTLSRISIKDRGNLIQAFNEYPESNIEESSTSFLGNSDKDKPTIPKIPTSQTKATAGKIQEAFHRSQSSVPVSVNDENPPSFNYYNDPESSVNATKIPLKGDSTIKPSMIRRGSFTTEMQVPQTPKNFNTVRKSSTQERTPLNMYSNKNRGRSMSVTREIENDHESPEKSSEDFNAIREILKRQRIVNRINGEATKPVTLPKPELPKKQSPSSNYMAYEYSNTLSSPVALRSNRFFNDRMLRQTNPNAPSGQNIQQMKYQQSRIPSDRDHDIDSAAGEEPACNDFNMSTGPEPIPSMHIERKDDKFKHQLIQMLHSSKSQEAARVAQIPASQHASNISSFYHGXXXXXXXXXXXXXXXXXQKSRTKSTIPNSKYCY 2508
            LKFHNSI       +LMTLSSSDLLDSLHSVCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNIQEHTIDNRSTTCIPRSYSTLSKQKSTASTGSHSSLNSNSMSTTSSEWNNNNLITACMEMSSRLNENMSNLSHDSGIKSDKSLSTICDNNSNHDENVNYNWDRTLSNILIESANNESQQQNDSDTECSSSEDENDASTDHNSQDGVIDNANDVFPLPEQQTQDNEVHFELPLDYQDNLPPPPTATQALPTIPTMQATASHYQQPITIPNDNLYPNQSIPPPVYSNLQELKLNAAKKFGANTLSRISIKDRGNLIQAFNEYPESNIEESSTSFLGNSDKDKPTIPKIPTSQTKATAGKIQEAFHRSQSSVPVSVNDENPPSFNYYNDPESSVNATKIPLKGDSTIKPSMIRRGSFTTEMQVPQTPKNFNTVRKSSTQERTPLNMYSNKNRGRSMSVTREIENDHESPEKSSEDFNAI     RQRIVNRINGEATKPVTLPKPELPKKQSPSSNYMAYEYSNTLSSPVALRSNRFFNDRMLRQTNPNAPSGQNIQQMKYQQSRIPSDRDHDIDSAAGEEPACNDFNMSTGPEPIPSMHIERKDDKFKHQLIQMLHSSKSQEAARVAQIPASQHASNISSFYHGNPNHPNHPSHPNNNSSHQKSRTKSTIPNSKYCY
Sbjct:   31 LKFHNSI-------KLMTLSSSDLLDSLHSVCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNIQEHTIDNRSTTCIPRSYSTLSKQKSTASTGSHSSLNSNSMSTTSSEWNNNNLITACMEMSSRLNENMSNLSHDSGIKSDKSLSTICDNNSNHDENVNYNWDRTLSNILIESANNESQQQNDSDTECSSSEDENDASTDHNSQDGVIDNANDVFPLPEQQTQDNEVHFELPLDYQDNLPPPPTATQALPTIPTMQATASHYQQPITIPNDNLYPNQSIPPPVYSNLQELKLNAAKKFGANTLSRISIKDRGNLIQAFNEYPESNIEESSTSFLGNSDKDKPTIPKIPTSQTKATAGKIQEAFHRSQSSVPVSVNDENPPSFNYYNDPESSVNATKIPLKGDSTIKPSMIRRGSFTTEMQVPQTPKNFNTVRKSSTQERTPLNMYSNKNRGRSMSVTREIENDHESPEKSSEDFNAI-----RQRIVNRINGEATKPVTLPKPELPKKQSPSSNYMAYEYSNTLSSPVALRSNRFFNDRMLRQTNPNAPSGQNIQQMKYQQSRIPSDRDHDIDSAAGEEPACNDFNMSTGPEPIPSMHIERKDDKFKHQLIQMLHSSKSQEAARVAQIPASQHASNISSFYHGNPNHPNHPSHPNNNSSHQKSRTKSTIPNSKYCY 854          
BLAST of IMD domain-containing protein vs. Planmine SMEST
Match: SMESG000031527.1 (SMESG000031527.1)

HSP 1 Score: 135.961 bits (341), Expect = 6.383e-33
Identity = 68/182 (37.36%), Postives = 119/182 (65.38%), Query Frame = 1
Query:  133 TGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKK-NAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNIQEH 675
             G  L+ + +++K I  K+S LNS +  NL+S+L   +  W++T  N+K++   D K+A ++ +K+ +E  + E K  K+    K  LS+T SLQIDYA Q+ QNK+R++EELER ++R+   EER R+KQF+  L+P+LD QLSM+ +L+ L+ +  +LY   +++L   P +++  ++++
Sbjct:   72 AGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPPDIDAYVRQY 253          
BLAST of IMD domain-containing protein vs. Planmine SMEST
Match: SMESG000038576.1 (SMESG000038576.1)

HSP 1 Score: 95.5153 bits (236), Expect = 6.477e-20
Identity = 55/170 (32.35%), Postives = 101/170 (59.41%), Query Frame = 1
Query:   91 VCDIASKSPCCI-KNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEV 597
            + D+A+ S     K+ G SLT+L LRQ+ +  K+ T+N  +   +   + + L EW++ +L + ++R  + ++A  E +K+  E  R +KK  K+ + K GL  +  +Q++ A ++A +K + +E +E   +RR  IEER RF  F+  L P+L+CQ++M  ++  LEE+
Sbjct:   60 IADLATNSSALASKDIGTSLTRLSLRQRSLHLKMKTMNESMACRIIDPMQQRLDEWKRCNLQIDKDRIKETRRAKSELKKASEEKNRLQKKAMKRGSMK-GLG-SLQMQVEVALKEAADKYQALENIEYDCVRRVVIEERSRFCYFVNCLMPVLECQINMFSEMQTLEEI 227          
BLAST of IMD domain-containing protein vs. Planmine SMEST
Match: SMESG000028682.1 (SMESG000028682.1)

HSP 1 Score: 90.8929 bits (224), Expect = 2.046e-18
Identity = 59/194 (30.41%), Postives = 110/194 (56.70%), Query Frame = 1
Query:   91 VCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNIQE 672
            + D+A+ +    K  G S T+L +RQ+ +E K+ TL+++L  +LS+ +   L +W++ S  L ++R  + KKA   ++K+  E  R +KK  K+ + + GL    + Q++ A ++A  K   ++ +E   +RRA   ER+RF      +KP+L+ Q+S+  D+ +L+E++  L    +   D  P E E+ IQ+
Sbjct:   60 IADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIKETKKAKTHWKKASGESVRLQKKAVKRGSMR-GLGSLQN-QVEGALKNAAEKYTSLQTVESIYLRRAMTHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLT-LNTVFPDRLPVESEEIIQQ 250          
The following BLAST results are available for this feature:
BLAST of IMD domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MTSS22.890e-1929.90MTSS I-BAR domain containing 2 [Source:HGNC Symbol... [more]
MTSS26.589e-1829.38MTSS I-BAR domain containing 2 [Source:HGNC Symbol... [more]
MTSS12.169e-1730.93MTSS I-BAR domain containing 1 [Source:HGNC Symbol... [more]
MTSS12.959e-1730.93MTSS I-BAR domain containing 1 [Source:HGNC Symbol... [more]
MTSS13.879e-1730.41MTSS I-BAR domain containing 1 [Source:HGNC Symbol... [more]
back to top
BLAST of IMD domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IMD domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mim7.565e-1525.71gene:FBgn0053558 transcript:FBtr0332943[more]
mim7.817e-1527.33gene:FBgn0053558 transcript:FBtr0332944[more]
mim8.328e-1527.33gene:FBgn0053558 transcript:FBtr0302035[more]
mim9.362e-1527.33gene:FBgn0053558 transcript:FBtr0302577[more]
mim9.544e-1527.33gene:FBgn0053558 transcript:FBtr0113470[more]
back to top
BLAST of IMD domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mtss14.603e-1930.73MTSS I-BAR domain containing 1 [Source:ZFIN;Acc:ZD... [more]
mtss1la1.269e-1828.13MTSS I-BAR domain containing 2a [Source:ZFIN;Acc:Z... [more]
mtss1lb3.184e-1828.90MTSS I-BAR domain containing 2b [Source:ZFIN;Acc:Z... [more]
mtss1la1.440e-1728.13MTSS I-BAR domain containing 2a [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of IMD domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acss2.24.993e-2131.79acyl-CoA synthetase short-chain family member 2, g... [more]
acss2.26.812e-2131.79acyl-CoA synthetase short-chain family member 2, g... [more]
acss2.27.413e-2031.79acyl-CoA synthetase short-chain family member 2, g... [more]
acss2.28.394e-2031.79acyl-CoA synthetase short-chain family member 2, g... [more]
gphn9.027e-1831.25gephyrin [Source:Xenbase;Acc:XB-GENE-989642][more]
back to top
BLAST of IMD domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mtss22.665e-1830.64MTSS I-BAR domain containing 2 [Source:MGI Symbol;... [more]
Mtss16.064e-1830.93MTSS I-BAR domain containing 1 [Source:MGI Symbol;... [more]
Mtss25.265e-1730.00MTSS I-BAR domain containing 2 [Source:MGI Symbol;... [more]
Mtss21.032e-1132.50MTSS I-BAR domain containing 2 [Source:MGI Symbol;... [more]
Mtss26.783e-1034.23MTSS I-BAR domain containing 2 [Source:MGI Symbol;... [more]
back to top
BLAST of IMD domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q765P7|MTSS2_HUMAN1.388e-1829.90Protein MTSS 2 OS=Homo sapiens OX=9606 GN=MTSS2 PE... [more]
sp|Q6P9S0|MTSS2_MOUSE1.864e-1730.64Protein MTSS 2 OS=Mus musculus OX=10090 GN=Mtss2 P... [more]
sp|O43312|MTSS1_HUMAN1.041e-1630.93Protein MTSS 1 OS=Homo sapiens OX=9606 GN=MTSS1 PE... [more]
sp|Q8R1S4|MTSS1_MOUSE2.065e-1630.41Protein MTSS 1 OS=Mus musculus OX=10090 GN=Mtss1 P... [more]
back to top
BLAST of IMD domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1Y1KH059.950e-2236.42IMD domain-containing protein OS=Photinus pyralis ... [more]
A0A1Y1KHF11.083e-2135.42IMD domain-containing protein OS=Photinus pyralis ... [more]
A0A5N4B4P31.133e-2135.42Uncharacterized protein OS=Photinus pyralis OX=705... [more]
U4U3501.130e-2034.95IMD domain-containing protein OS=Dendroctonus pond... [more]
A0A2R2MT412.863e-2034.62MTSS1-like protein OS=Lingula unguis OX=7574 GN=LO... [more]
back to top
BLAST of IMD domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtss16.803e-2131.77MTSS I-BAR domain containing 1 [Source:ZFIN;Acc:ZD... [more]
mtss11.594e-2031.77MTSS I-BAR domain containing 1 [Source:ZFIN;Acc:ZD... [more]
mtss11.863e-2031.77MTSS I-BAR domain containing 1 [Source:ZFIN;Acc:ZD... [more]
mtss1la3.796e-1929.17MTSS1-like protein [Source:NCBI gene;Acc:103039604... [more]
mtss1la4.176e-1929.17MTSS1-like protein [Source:NCBI gene;Acc:103039604... [more]
back to top
BLAST of IMD domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000001774.12.845e-2029.55pep scaffold:Pmarinus_7.0:GL476804:163249:239367:-... [more]
ENSPMAT00000002039.14.331e-1129.85pep scaffold:Pmarinus_7.0:GL477038:84867:99356:-1 ... [more]
ENSPMAT00000002029.16.566e-1129.85pep scaffold:Pmarinus_7.0:GL477038:82432:99356:-1 ... [more]
ENSPMAT00000002035.16.964e-1129.85pep scaffold:Pmarinus_7.0:GL477038:82432:99356:-1 ... [more]
back to top
BLAST of IMD domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IMD domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IMD domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtss1la5.321e-1929.38MTSS1-like protein [Source:NCBI gene;Acc:101164641... [more]
mtss1la6.523e-1929.38MTSS1-like protein [Source:NCBI gene;Acc:101164641... [more]
mtss1la7.581e-1929.38MTSS1-like protein [Source:NCBI gene;Acc:101164641... [more]
MTSS11.088e-1829.82metastasis suppressor protein 1 [Source:NCBI gene;... [more]
ENSORLT00000000819.22.059e-1827.94MTSS I-BAR domain containing 1 [Source:NCBI gene;A... [more]
back to top
BLAST of IMD domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038660.10.000e+099.04SMESG000038660.1[more]
SMESG000038660.10.000e+098.44SMESG000038660.1[more]
SMESG000031527.16.383e-3337.36SMESG000031527.1[more]
SMESG000038576.16.477e-2032.35SMESG000038576.1[more]
SMESG000028682.12.046e-1830.41SMESG000028682.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008314 ID=SMED30008314|Name=IMD domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2693bp
CTCAAATTTCACAATTCCATCAATTTAATTAATTTTGAATGAAGGTTAAT
GACTCTGTCTTCAAGTGATCTCCTTGATAGCTTACATTCTGTTTGTGATA
TAGCTAGTAAAAGCCCATGTTGTATCAAAAATACGGGCATCAGTTTAACG
AAGCTTGTATTAAGACAAAAGAAAATTGAGCAAAAAGTCTCAACTCTAAA
CAGCTATTTAAATGAAAATCTATCATCGGAACTTGATAAATTTCTAGTTG
AATGGCGCAAAACTAGTTTGAACCTGAAACGTGAACGCGACCATGATTGG
AAAAAGGCAAATCTTGAATATCAAAAATCATTGGCGGAAGTCGAAAGAAC
AGAAAAAAAATTACGCAAGAAAAATGCCGGAAAAGTTGGATTATCAGAAA
CAGCTAGCTTGCAAATTGACTATGCTAACCAGGATGCACAAAACAAACGC
CGATATGTTGAAGAATTGGAACGGTCGGCGATGCGGAGAGCAGCCATTGA
AGAGCGACAACGTTTTAAACAATTTCTCGTACTTTTAAAGCCAATTCTTG
ATTGTCAATTATCAATGCGAGAAGACCTAGACAATTTGGAAGAAGTGGTT
AGTCAACTGTATGGAGAAAAATCGGAAAATTTGGATGAATTTCCAGAAGA
ATTGGAACAAAATATACAAGAACACACAATAGATAACCGATCAACGACTT
GTATTCCAAGGAGCTATTCCACGCTTTCTAAACAGAAAAGTACGGCATCA
ACTGGAAGCCACAGTAGTCTGAATAGCAACAGTATGAGTACAACATCATC
AGAATGGAATAATAATAATCTTATTACCGCATGCATGGAGATGTCATCTC
GTCTGAATGAAAACATGAGCAATTTATCACACGATTCTGGAATTAAAAGT
GACAAAAGTTTATCCACAATATGCGATAACAATTCAAACCATGACGAAAA
TGTCAATTACAATTGGGACAGAACTTTGTCCAATATTCTAATTGAGTCTG
CAAATAATGAATCACAGCAGCAAAATGATTCTGATACAGAATGCTCATCA
AGTGAAGATGAAAATGATGCATCAACTGATCATAATAGCCAAGATGGAGT
AATTGACAATGCAAATGATGTTTTTCCATTGCCCGAGCAACAAACCCAAG
ACAATGAAGTCCATTTCGAATTGCCACTAGACTATCAAGATAACTTACCT
CCTCCACCGACTGCCACTCAGGCGTTACCTACAATCCCCACTATGCAAGC
CACCGCCTCACATTATCAGCAACCCATTACTATACCAAATGATAATTTAT
ACCCTAACCAATCTATTCCACCACCAGTCTATTCAAATCTGCAGGAATTG
AAATTAAATGCCGCTAAAAAGTTTGGAGCTAATACACTGTCAAGGATTTC
TATTAAAGATCGCGGTAATTTAATACAAGCTTTTAATGAATATCCAGAAT
CAAATATCGAAGAATCATCAACTTCATTTCTTGGAAATTCAGATAAAGAT
AAGCCAACTATTCCGAAAATACCAACGAGTCAAACAAAAGCCACCGCAGG
GAAAATCCAAGAAGCATTTCATAGATCTCAGTCATCGGTTCCAGTCAGTG
TAAATGATGAGAATCCACCAAGTTTCAATTATTACAATGATCCAGAAAGC
TCTGTGAATGCCACAAAAATCCCCTTGAAAGGCGATTCGACAATTAAACC
ATCGATGATTCGCCGAGGCTCATTCACCACTGAAATGCAAGTGCCACAAA
CACCTAAAAACTTCAATACAGTCCGCAAGAGTTCAACACAAGAAAGAACA
CCATTAAATATGTACTCTAACAAAAATCGTGGCCGCAGTATGAGCGTTAC
AAGAGAAATTGAAAACGATCACGAAAGTCCAGAAAAGTCATCTGAAGATT
TCAACGCGATTCGAGAGATTTTAAAGCGACAACGAATTGTGAATCGCATC
AATGGTGAAGCCACCAAACCTGTAACTCTTCCTAAGCCGGAATTGCCTAA
AAAACAATCACCAAGTTCTAATTATATGGCATATGAATATTCCAACACGC
TTTCCAGTCCAGTTGCGTTGCGATCGAATCGGTTTTTCAATGATCGGATG
CTGAGACAAACTAATCCAAACGCACCCAGTGGACAGAATATCCAGCAAAT
GAAATATCAGCAATCACGGATACCATCTGATCGCGATCATGACATTGATT
CAGCAGCTGGTGAGGAGCCTGCTTGTAATGATTTCAATATGTCAACTGGT
CCTGAACCGATACCATCGATGCATATTGAGAGGAAGGACGATAAATTTAA
GCATCAATTAATTCAAATGTTACACTCATCGAAATCCCAAGAAGCTGCAA
GGGTAGCTCAAATTCCTGCTAGTCAACATGCTTCGAATATATCATCATTT
TATCACGGCAATCCCAACCATCCCAACCATCCGAGCCACCCCAATAACAA
CAGCAGTCACCAGAAATCACGCACGAAATCCACGATTCCCAATTCCAAAT
ATTGCTACTAAATTATCAACCGATACCCATTCAATATTTGTACAAATGTG
CTCTAGTGCAATCCGTTTTTATTATTCACTACTATTAATGAGTTTTAATT
AATTTATTTTTCATTATGTTCTTTATTTAAAAAGTTACTTAATATTTATT
ATTTATATTTTATATAAAAGTGAACATCAAAGTTAGAATACTG
back to top

protein sequence of SMED30008314-orf-1

>SMED30008314-orf-1 ID=SMED30008314-orf-1|Name=SMED30008314-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=821bp
MTLSSSDLLDSLHSVCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTL
NSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVER
TEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAI
EERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPE
ELEQNIQEHTIDNRSTTCIPRSYSTLSKQKSTASTGSHSSLNSNSMSTTS
SEWNNNNLITACMEMSSRLNENMSNLSHDSGIKSDKSLSTICDNNSNHDE
NVNYNWDRTLSNILIESANNESQQQNDSDTECSSSEDENDASTDHNSQDG
VIDNANDVFPLPEQQTQDNEVHFELPLDYQDNLPPPPTATQALPTIPTMQ
ATASHYQQPITIPNDNLYPNQSIPPPVYSNLQELKLNAAKKFGANTLSRI
SIKDRGNLIQAFNEYPESNIEESSTSFLGNSDKDKPTIPKIPTSQTKATA
GKIQEAFHRSQSSVPVSVNDENPPSFNYYNDPESSVNATKIPLKGDSTIK
PSMIRRGSFTTEMQVPQTPKNFNTVRKSSTQERTPLNMYSNKNRGRSMSV
TREIENDHESPEKSSEDFNAIREILKRQRIVNRINGEATKPVTLPKPELP
KKQSPSSNYMAYEYSNTLSSPVALRSNRFFNDRMLRQTNPNAPSGQNIQQ
MKYQQSRIPSDRDHDIDSAAGEEPACNDFNMSTGPEPIPSMHIERKDDKF
KHQLIQMLHSSKSQEAARVAQIPASQHASNISSFYHGNPNHPNHPSHPNN
NSSHQKSRTKSTIPNSKYCY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027267AH/BAR_dom_sf
IPR030127MTSS1/MTSS2
IPR013606I-BAR_dom
Vocabulary: biological process
TermDefinition
GO:0007009plasma membrane organization
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 88..108
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 318..349
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 229..250
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 782..820
NoneNo IPR availablePANTHERPTHR15708:SF14METASTASIS SUPPRESSOR 1coord: 3..303
IPR027267AH/BAR domain superfamilyGENE3DG3DSA:1.20.1270.60coord: 1..208
e-value: 3.7E-37
score: 129.6
IPR027267AH/BAR domain superfamilySUPERFAMILYSSF103657BAR/IMD domain-likecoord: 5..208
IPR013606IMD/I-BAR domainPFAMPF08397IMDcoord: 4..185
e-value: 2.5E-18
score: 66.3
IPR030127I-BAR domain containing protein MTSS1/MTSS2PANTHERPTHR15708ACTIN BUNDLING/MISSING IN METASTASIS-RELATEDcoord: 3..303