cdc25c-like protein

Overview
Namecdc25c-like protein (ACT98265.1)
Smed IDSMED30008297
Length (bp)1999
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cdc25c-like protein (SMED30008297) t-SNE clustered cells

Violin plots show distribution of expression levels for cdc25c-like protein (SMED30008297) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cdc25c-like protein (SMED30008297) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cdc25c-like protein (SMED30008297) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008297

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30008297h1SMcG0014814 SmedASXL_002642SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30008297h1SMcG0014814 SmedASXL_009667SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30008297h1SMcG0014814 SmedASXL_033641SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30008297h1SMcG0014814 dd_Smed_v4_9178_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
testisSMED30008297h1SMcG0014814 KU852687smed_ncbi_20240424PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
male germ cellSMED30008297h1SMcG0014814 KU852687smed_ncbi_20240424PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cdc25c-like protein vs. Ensembl Human
Match: CDC25C (cell division cycle 25C [Source:HGNC Symbol;Acc:HGNC:1727])

HSP 1 Score: 109.768 bits (273), Expect = 3.572e-26
Identity = 57/161 (35.40%), Postives = 86/161 (53.42%), Query Frame = -2
Query:  805 DFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMDIKD 1287
            + VA ++   F      +++IDCRYPYEY GGH+ GA+NLY+  +L N+         +LK+ +                   P  + K    +FHCEFSS RGP M RC+R  DR +N      L++P+++I+K GYR+F+ ++  LC P  Y  M  +D
Sbjct:  110 EMVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNF---------FLKKPI------------------VPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQY--PALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQD 241          
BLAST of cdc25c-like protein vs. Ensembl Human
Match: CDC25C (cell division cycle 25C [Source:HGNC Symbol;Acc:HGNC:1727])

HSP 1 Score: 112.464 bits (280), Expect = 8.783e-26
Identity = 58/164 (35.37%), Postives = 88/164 (53.66%), Query Frame = -2
Query:  805 VSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMDIKD 1296
            V+ + VA ++   F      +++IDCRYPYEY GGH+ GA+NLY+  +L N+         +LK+ +                   P  + K    +FHCEFSS RGP M RC+R  DR +N      L++P+++I+K GYR+F+ ++  LC P  Y  M  +D
Sbjct:  275 VNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNF---------FLKKPI------------------VPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLN--QYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQD 409          
BLAST of cdc25c-like protein vs. Ensembl Human
Match: CDC25C (cell division cycle 25C [Source:HGNC Symbol;Acc:HGNC:1727])

HSP 1 Score: 111.694 bits (278), Expect = 8.822e-26
Identity = 58/164 (35.37%), Postives = 88/164 (53.66%), Query Frame = -2
Query:  805 VSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMDIKD 1296
            V+ + VA ++   F      +++IDCRYPYEY GGH+ GA+NLY+  +L N+         +LK+ +                   P  + K    +FHCEFSS RGP M RC+R  DR +N      L++P+++I+K GYR+F+ ++  LC P  Y  M  +D
Sbjct:  232 VNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNF---------FLKKPI------------------VPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLN--QYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQD 366          
BLAST of cdc25c-like protein vs. Ensembl Human
Match: CDC25C (cell division cycle 25C [Source:HGNC Symbol;Acc:HGNC:1727])

HSP 1 Score: 111.694 bits (278), Expect = 8.822e-26
Identity = 58/164 (35.37%), Postives = 88/164 (53.66%), Query Frame = -2
Query:  805 VSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMDIKD 1296
            V+ + VA ++   F      +++IDCRYPYEY GGH+ GA+NLY+  +L N+         +LK+ +                   P  + K    +FHCEFSS RGP M RC+R  DR +N      L++P+++I+K GYR+F+ ++  LC P  Y  M  +D
Sbjct:  232 VNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNF---------FLKKPI------------------VPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLN--QYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQD 366          
BLAST of cdc25c-like protein vs. Ensembl Human
Match: CDC25C (cell division cycle 25C [Source:HGNC Symbol;Acc:HGNC:1727])

HSP 1 Score: 112.464 bits (280), Expect = 1.257e-25
Identity = 58/164 (35.37%), Postives = 88/164 (53.66%), Query Frame = -2
Query:  805 VSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMDIKD 1296
            V+ + VA ++   F      +++IDCRYPYEY GGH+ GA+NLY+  +L N+         +LK+ +                   P  + K    +FHCEFSS RGP M RC+R  DR +N      L++P+++I+K GYR+F+ ++  LC P  Y  M  +D
Sbjct:  305 VNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNF---------FLKKPI------------------VPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQ--YPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQD 439          
BLAST of cdc25c-like protein vs. Ensembl Celegans
Match: cdc-25.4 (Cell Division Cycle related [Source:UniProtKB/TrEMBL;Acc:Q21762])

HSP 1 Score: 85.8853 bits (211), Expect = 2.404e-18
Identity = 49/143 (34.27%), Postives = 75/143 (52.45%), Query Frame = -2
Query:  808 IIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYS--KHKSLCSPCGYVKMDIK 1230
            I DCRYP+EY GGH+ GAVN+Y+  +L  Y+        Y +  V++T   ++                     IF+CE+S VRGP MAR +R +D + N    + L FP+++++ KGY  F+S    + LC P  Y+ M  +
Sbjct:   81 IFDCRYPFEYFGGHIKGAVNIYSLDELGKYL--------YDEYGVKSTLGGLIP--------------------IFYCEYSQVRGPAMARRLRKIDTHRNNHRAAALDFPEIYLLDKGYVNFWSDVSLRDLCEPRYYISMHAR 195          
BLAST of cdc25c-like protein vs. Ensembl Celegans
Match: cdc-25.1 (M-phase inducer phosphatase cdc-25.1 [Source:UniProtKB/Swiss-Prot;Acc:O44552])

HSP 1 Score: 83.5741 bits (205), Expect = 1.510e-16
Identity = 43/142 (30.28%), Postives = 72/142 (50.70%), Query Frame = -2
Query:  817 YHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKH--KSLCSPCGYVKM 1236
            Y I+DCR+P+EY GGH+ GA+NL+     +  IF  +N                              SS++    IF+CE+S  RGP MA  +R++DR +N     ++ +P+++++  GY+  +S    + +C PC Y+ M
Sbjct:  309 YIIVDCRFPFEYKGGHVKGAINLFR-HDKIKPIFFPEN---------------------------GEASSFQNRVPIFYCEYSQKRGPTMAHAVRSIDRVLNELRYPHVEYPEMYLLDYGYKSLWSTAECRQICEPCSYIPM 422          
BLAST of cdc25c-like protein vs. Ensembl Celegans
Match: cdc-25.1 (M-phase inducer phosphatase cdc-25.1 [Source:UniProtKB/Swiss-Prot;Acc:O44552])

HSP 1 Score: 83.5741 bits (205), Expect = 1.510e-16
Identity = 43/142 (30.28%), Postives = 72/142 (50.70%), Query Frame = -2
Query:  817 YHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKH--KSLCSPCGYVKM 1236
            Y I+DCR+P+EY GGH+ GA+NL+     +  IF  +N                              SS++    IF+CE+S  RGP MA  +R++DR +N     ++ +P+++++  GY+  +S    + +C PC Y+ M
Sbjct:  309 YIIVDCRFPFEYKGGHVKGAINLFR-HDKIKPIFFPEN---------------------------GEASSFQNRVPIFYCEYSQKRGPTMAHAVRSIDRVLNELRYPHVEYPEMYLLDYGYKSLWSTAECRQICEPCSYIPM 422          
BLAST of cdc25c-like protein vs. Ensembl Celegans
Match: cdc-25.3 (M-phase inducer phosphatase cdc-25.3 [Source:UniProtKB/Swiss-Prot;Acc:P30634])

HSP 1 Score: 70.8626 bits (172), Expect = 5.078e-13
Identity = 46/148 (31.08%), Postives = 70/148 (47.30%), Query Frame = -2
Query:  817 YHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYS--------KHKSLCSPCGYVKM 1236
            Y +IDCRY YEY+GGH+ GA +L+ P    ++ F              N + S    IN I               IF+CE+S  RGP MA  +R +DR +N +      + ++++++ GY+ FY+        +   LC P  YV M
Sbjct:  140 YILIDCRYDYEYNGGHIKGAQSLFNPETAADFFF--------------NKDGS--KKINRIP--------------IFYCEYSQKRGPTMANNLREVDRKLNSNIYPRCDYEEIYLLEGGYKNFYAFTRGLEKEQRVQLCEPDNYVIM 257          
BLAST of cdc25c-like protein vs. Ensembl Celegans
Match: cdc-25.2 (M-phase inducer phosphatase cdc-25.2 [Source:UniProtKB/Swiss-Prot;Acc:O44628])

HSP 1 Score: 68.1662 bits (165), Expect = 8.099e-12
Identity = 49/174 (28.16%), Postives = 78/174 (44.83%), Query Frame = -2
Query:  799 ITEVSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFY-----SKHKSLCSPCGYVKMDIKDPT 1305
              E   D   ++ E +F      Y +IDCRYPYEY+ GH+  A+N +     ++ IF  +N  +                       K P         IF+CEFS  RGP+MA  +R +DR +N +      + +++++  GYR F+     +   +LC P  Y +M  K+ T
Sbjct:  227 TAETLRDIFFRLSEKEFDD---KYILIDCRYPYEYNRGHIKNAINHFD-RVTVSKIFYDENGRKRCN--------------------KIP---------IFYCEFSQARGPKMAYALRQVDRELNVNHYPKCDYEEMYVLDLGYRNFFFAANEANITNLCQPHAYCEMHDKEHT 367          
BLAST of cdc25c-like protein vs. Ensembl Fly
Match: stg (gene:FBgn0003525 transcript:FBtr0085397)

HSP 1 Score: 122.479 bits (306), Expect = 3.065e-29
Identity = 60/163 (36.81%), Postives = 91/163 (55.83%), Query Frame = -2
Query:  817 ITEVSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKM 1305
            +  +S++ VA++++ +F+    +Y IIDCRYPYE++GGH+ GA NLYT  Q+L+     Q      +Q+ E                    S  K    IFHCEFSS RGP+M+R +RN+DR  N +    L +P+++++  GY+EF+  H  LC P  Y  M
Sbjct:  297 LKSISSETVARLLKGEFSDKVASYRIIDCRYPYEFEGGHIEGAKNLYTTEQILDEFLTVQQTELQQQQNAE--------------------SGHKRNIIIFHCEFSSERGPKMSRFLRNLDRERNTNAYPALHYPEIYLLHNGYKEFFESHVELCEPHAYRTM 439          
BLAST of cdc25c-like protein vs. Ensembl Fly
Match: stg (gene:FBgn0003525 transcript:FBtr0334867)

HSP 1 Score: 122.479 bits (306), Expect = 3.065e-29
Identity = 60/163 (36.81%), Postives = 91/163 (55.83%), Query Frame = -2
Query:  817 ITEVSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKM 1305
            +  +S++ VA++++ +F+    +Y IIDCRYPYE++GGH+ GA NLYT  Q+L+     Q      +Q+ E                    S  K    IFHCEFSS RGP+M+R +RN+DR  N +    L +P+++++  GY+EF+  H  LC P  Y  M
Sbjct:  297 LKSISSETVARLLKGEFSDKVASYRIIDCRYPYEFEGGHIEGAKNLYTTEQILDEFLTVQQTELQQQQNAE--------------------SGHKRNIIIFHCEFSSERGPKMSRFLRNLDRERNTNAYPALHYPEIYLLHNGYKEFFESHVELCEPHAYRTM 439          
BLAST of cdc25c-like protein vs. Ensembl Fly
Match: twe (gene:FBgn0002673 transcript:FBtr0331444)

HSP 1 Score: 102.064 bits (253), Expect = 8.739e-23
Identity = 56/163 (34.36%), Postives = 82/163 (50.31%), Query Frame = -2
Query:  817 VSADFVAKIIENDF---TSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKM 1296
            +S+D +A++I+ +F         Y IIDCRYPYE+ GGH+ GA NLYT  Q+       Q     L  + EN                          ++FHCEFSS RGP++ R +R+ DR  +      L +P+++I+  GY+EF+  +  LC P  YV M
Sbjct:  246 ISSDTLARLIQGEFDEQLGSQGGYEIIDCRYPYEFLGGHIRGAKNLYTRGQI-------QEAFPTLTSNQENRR-----------------------IYVFHCEFSSERGPKLLRYLRSNDRSQHTHNYPALDYPELYILHNGYKEFFGLYSQLCQPSQYVPM 378          
BLAST of cdc25c-like protein vs. Ensembl Fly
Match: twe (gene:FBgn0002673 transcript:FBtr0331445)

HSP 1 Score: 102.064 bits (253), Expect = 8.739e-23
Identity = 56/163 (34.36%), Postives = 82/163 (50.31%), Query Frame = -2
Query:  817 VSADFVAKIIENDF---TSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKM 1296
            +S+D +A++I+ +F         Y IIDCRYPYE+ GGH+ GA NLYT  Q+       Q     L  + EN                          ++FHCEFSS RGP++ R +R+ DR  +      L +P+++I+  GY+EF+  +  LC P  YV M
Sbjct:  246 ISSDTLARLIQGEFDEQLGSQGGYEIIDCRYPYEFLGGHIRGAKNLYTRGQI-------QEAFPTLTSNQENRR-----------------------IYVFHCEFSSERGPKLLRYLRSNDRSQHTHNYPALDYPELYILHNGYKEFFGLYSQLCQPSQYVPM 378          
BLAST of cdc25c-like protein vs. Ensembl Fly
Match: twe (gene:FBgn0002673 transcript:FBtr0331446)

HSP 1 Score: 102.064 bits (253), Expect = 8.739e-23
Identity = 56/163 (34.36%), Postives = 82/163 (50.31%), Query Frame = -2
Query:  817 VSADFVAKIIENDF---TSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKM 1296
            +S+D +A++I+ +F         Y IIDCRYPYE+ GGH+ GA NLYT  Q+       Q     L  + EN                          ++FHCEFSS RGP++ R +R+ DR  +      L +P+++I+  GY+EF+  +  LC P  YV M
Sbjct:  246 ISSDTLARLIQGEFDEQLGSQGGYEIIDCRYPYEFLGGHIRGAKNLYTRGQI-------QEAFPTLTSNQENRR-----------------------IYVFHCEFSSERGPKLLRYLRSNDRSQHTHNYPALDYPELYILHNGYKEFFGLYSQLCQPSQYVPM 378          
BLAST of cdc25c-like protein vs. Ensembl Zebrafish
Match: cdc25d (cell division cycle 25 homolog d [Source:ZFIN;Acc:ZDB-GENE-090313-74])

HSP 1 Score: 117.087 bits (292), Expect = 6.800e-28
Identity = 62/166 (37.35%), Postives = 89/166 (53.61%), Query Frame = -2
Query:  805 VSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKP--NSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMDIKD 1296
            +SA  VA +I   F S    + I+DCRYPYEY GGH+ GAVNLYT  Q+           + L Q+      S   L     +   P    S   +  IFHCEFSS RGP + + +R +DR VN     +L +P+++++  GY+ F++ +  LC PCGYV M  ++
Sbjct:  204 ISAQTVASLIRGQFGSAVEDFLIVDCRYPYEYQGGHIKGAVNLYTEHQV----------QQVLHQASAQVSVSTSRLCGRSASDSLPEDEESPSRKLIIFHCEFSSERGPHLCQYLRRLDRCVNV--YPSLHYPELYLLLGGYKHFHASYPDLCDPCGYVSMRQRE 357          
BLAST of cdc25c-like protein vs. Ensembl Zebrafish
Match: cdc25b (cell division cycle 25B [Source:ZFIN;Acc:ZDB-GENE-000330-5])

HSP 1 Score: 106.301 bits (264), Expect = 1.537e-23
Identity = 57/160 (35.62%), Postives = 83/160 (51.88%), Query Frame = -2
Query:  817 VSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKM 1296
            ++ + + K +   F        +IDCRYPYEY+GGH+ GA+NL+   Q+ +Y                        L + I+    P+   K    IFHCEFSS RGP M R +R  DR+VN     NL +P+++I+K GY+EF+  HK++C P  Y  M
Sbjct:  398 ITPEIMVKAMSGQFQDLVERLFVIDCRYPYEYEGGHIKGALNLHQEDQIEDYF-----------------------LRSPIL----PDCPKKRVLLIFHCEFSSERGPRMCRYVRERDRFVNE--YPNLHYPELYILKGGYKEFFQIHKAICEPQMYRPM 528          
BLAST of cdc25c-like protein vs. Ensembl Xenopus
Match: cdc25c (cell division cycle 25C [Source:NCBI gene;Acc:100124300])

HSP 1 Score: 122.479 bits (306), Expect = 9.824e-29
Identity = 75/233 (32.19%), Postives = 117/233 (50.21%), Query Frame = -2
Query:  805 AASPMCPEIEN-EPTRRRRLLKSRI----IQTDQIIDESCFKDE------------------NDIKITEVSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMDIKD 1434
             +SP+ PE EN +P RR   LK  +    +    ++DE C   +                   D++   ++A+ +A +I  DF+S      IIDCRYPYEYDGGH+ GA+NL+   ++ +Y         +LKQ +                   P+ + K    +FHCEFSS RGP+M R +R  DR  N      L++P+++++K GY++F+ ++K LC P GY  M  +D
Sbjct:  318 TSSPLQPEEENCQPRRRGTSLKKTLSLCDVDISTVLDEDCGHRQLIGDFSKVYALPTVTGRHQDLRY--ITAETLAALIHGDFSSLVENVFIIDCRYPYEYDGGHIKGALNLHRQEEVTDY---------FLKQPL------------------APSVAQKRLIIVFHCEFSSERGPKMCRFLREEDRARNE--YPGLYYPELYLLKGGYKDFFPEYKELCEPQGYCPMHHQD 519          
BLAST of cdc25c-like protein vs. Ensembl Xenopus
Match: cdc25c (cell division cycle 25C [Source:NCBI gene;Acc:100124300])

HSP 1 Score: 122.479 bits (306), Expect = 1.149e-28
Identity = 75/233 (32.19%), Postives = 117/233 (50.21%), Query Frame = -2
Query:  805 AASPMCPEIEN-EPTRRRRLLKSRI----IQTDQIIDESCFKDE------------------NDIKITEVSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMDIKD 1434
             +SP+ PE EN +P RR   LK  +    +    ++DE C   +                   D++   ++A+ +A +I  DF+S      IIDCRYPYEYDGGH+ GA+NL+   ++ +Y         +LKQ +                   P+ + K    +FHCEFSS RGP+M R +R  DR  N      L++P+++++K GY++F+ ++K LC P GY  M  +D
Sbjct:  328 TSSPLQPEEENCQPRRRGTSLKKTLSLCDVDISTVLDEDCGHRQLIGDFSKVYALPTVTGRHQDLRY--ITAETLAALIHGDFSSLVENVFIIDCRYPYEYDGGHIKGALNLHRQEEVTDY---------FLKQPL------------------APSVAQKRLIIVFHCEFSSERGPKMCRFLREEDRARNE--YPGLYYPELYLLKGGYKDFFPEYKELCEPQGYCPMHHQD 529          
BLAST of cdc25c-like protein vs. Ensembl Xenopus
Match: adcy7 (adenylate cyclase 7 [Source:Xenbase;Acc:XB-GENE-1005225])

HSP 1 Score: 108.612 bits (270), Expect = 1.250e-26
Identity = 61/160 (38.12%), Postives = 83/160 (51.88%), Query Frame = -2
Query:  805 FVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMDIKD 1284
            F+A+++   +      Y I+DCRYPYEY GGH+ GA NLY                       E+  D+ +       N   P S   T   IFHCEFSS R P++ R +RN+DR  N +   +L +P+++I+K GY+EFY K K  C P GYV M  KD
Sbjct:   10 FLARLLRGGYQDVVQQYQIVDCRYPYEYAGGHIKGAYNLYKE---------------------EHISDTFLK------NATHPKS---TTLLIFHCEFSSERAPKLCRLLRNLDR--NANRYPHLHYPELYILKGGYKEFYEKFKGFCEPRGYVNMLHKD 137          
BLAST of cdc25c-like protein vs. Ensembl Xenopus
Match: ENSXETT00000036492.1 (M-phase inducer phosphatase 3-like [Source:NCBI gene;Acc:100497395])

HSP 1 Score: 110.153 bits (274), Expect = 2.886e-25
Identity = 61/164 (37.20%), Postives = 83/164 (50.61%), Query Frame = -2
Query:  805 VSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMDIKD 1296
            +S   +A+++   +      Y I+DCRYPYEY GGH+ GA NLY                          E+ + D    + N   P S   T   IFHCEFSS R P++ R +RN+DR  N     +L +P+++I+K GY+EFY K K  C P GYV M  KD
Sbjct:  239 ISCTTLARLLRGGYQDVVQQYQIVDCRYPYEYAGGHIKGAYNLYK-------------------------EEHISDTF--LKNATHPKS---TTLLIFHCEFSSERAPKLCRLLRNLDRNANRY--PHLHYPELYILKGGYKEFYEKFKGFCEPRGYVNMLHKD 370          
BLAST of cdc25c-like protein vs. Ensembl Xenopus
Match: cdc25c (cell division cycle 25C [Source:NCBI gene;Acc:100124300])

HSP 1 Score: 110.153 bits (274), Expect = 1.196e-24
Identity = 74/234 (31.62%), Postives = 116/234 (49.57%), Query Frame = -2
Query:  805 AASPMCPEIEN-EPTRRRRLLKSRI----IQTDQIIDESCFKDE------------------NDIKITEVSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEY-LKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMDIKD 1434
             +SP+ PE EN +P RR   LK  +    +    ++DE C   +                   D++   ++A+ +A +I  DF+S      IIDCRYPYEYDGG    +V L+       ++F++Q   +Y LKQ +                   P+ + K    +FHCEFSS RGP+M R +R  DR  N      L++P+++++K GY++F+ ++K LC P GY  M  +D
Sbjct:  308 TSSPLQPEEENCQPRRRGTSLKKTLSLCDVDISTVLDEDCGHRQLIGDFSKVYALPTVTGRHQDLRY--ITAETLAALIHGDFSSLVENVFIIDCRYPYEYDGGK---SVVLFP------FLFISQEVTDYFLKQPL------------------APSVAQKRLIIVFHCEFSSERGPKMCRFLREEDRARNE--YPGLYYPELYLLKGGYKDFFPEYKELCEPQGYCPMHHQD 510          
BLAST of cdc25c-like protein vs. Ensembl Mouse
Match: Cdc25c (cell division cycle 25C [Source:MGI Symbol;Acc:MGI:88350])

HSP 1 Score: 104.375 bits (259), Expect = 2.619e-23
Identity = 58/164 (35.37%), Postives = 89/164 (54.27%), Query Frame = -2
Query:  805 VSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMDIKD 1296
            +S D VA ++   F S    ++IIDCRYPYEY GGH+LGA+NL++  +L  +         +L++ V       +D+   +I              +F CEFSS RGP M R +R  DR +N      L++P+++I+K GYR+F+ ++  LC P  Y  M  +D
Sbjct:  278 ISPDTVAALLSGKFQSVIERFYIIDCRYPYEYLGGHILGALNLHSQKELHEF---------FLRKPVVP-----LDIQKRVI-------------IVFLCEFSSERGPRMCRSLREKDRALN--QYPALYYPELYILKGGYRDFFPEYMELCDPQSYCPMLHQD 412          
BLAST of cdc25c-like protein vs. Ensembl Mouse
Match: Cdc25a (cell division cycle 25A [Source:MGI Symbol;Acc:MGI:103198])

HSP 1 Score: 99.3673 bits (246), Expect = 2.375e-21
Identity = 64/206 (31.07%), Postives = 98/206 (47.57%), Query Frame = -2
Query:  679 VSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMDIKDPTCVNDSFSDDGDESPLTKSSNPILDVENWKAQVKMYNQCKK 1296
            +S + +A ++   F      + IIDCRYPYEY+GGH+ GAVNL+   ++ +++                       L N I+      +  K    +FHCEFSS RGP M R +R  DR  N      L +P+++++K GY+EF+ K +S C P  Y  M  +D       F +D     L K           K++ +MY++ KK
Sbjct:  350 ISPEIMASVLNGKFAGLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFL-----------------------LKNPIV-----PTDGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNE--YPKLHYPELYVLKGGYKEFFLKCQSHCEPPSYRPMHHED-------FKED-----LKKFRTKSRTWAGEKSKREMYSRLKK 513          
BLAST of cdc25c-like protein vs. Ensembl Mouse
Match: Cdc25b (cell division cycle 25B [Source:MGI Symbol;Acc:MGI:99701])

HSP 1 Score: 97.4413 bits (241), Expect = 1.086e-20
Identity = 55/161 (34.16%), Postives = 81/161 (50.31%), Query Frame = -2
Query:  814 VSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMD 1296
            +S + +  ++   F++    + I+DCRYPYEY+GGH+  AVNL  P +     FL Q  +                          P S  K    IFHCEFSS RGP M R +R  DR  N     +L++P+++I+K GY+EF+ +H + C P  Y  M+
Sbjct:  385 ISPETMVALLTGKFSNIVEKFVIVDCRYPYEYEGGHIKNAVNL--PLERDAETFLLQRPI-------------------------MPCSLDKRIILIFHCEFSSERGPRMCRFIRERDRAAN--DYPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMN 516          
BLAST of cdc25c-like protein vs. Ensembl Mouse
Match: Cdc25b (cell division cycle 25B [Source:MGI Symbol;Acc:MGI:99701])

HSP 1 Score: 97.4413 bits (241), Expect = 1.129e-20
Identity = 55/161 (34.16%), Postives = 81/161 (50.31%), Query Frame = -2
Query:  814 VSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMD 1296
            +S + +  ++   F++    + I+DCRYPYEY+GGH+  AVNL  P +     FL Q  +                          P S  K    IFHCEFSS RGP M R +R  DR  N     +L++P+++I+K GY+EF+ +H + C P  Y  M+
Sbjct:  411 ISPETMVALLTGKFSNIVEKFVIVDCRYPYEYEGGHIKNAVNL--PLERDAETFLLQRPI-------------------------MPCSLDKRIILIFHCEFSSERGPRMCRFIRERDRAAN--DYPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMN 542          
BLAST of cdc25c-like protein vs. Ensembl Mouse
Match: Cdc25a (cell division cycle 25A [Source:MGI Symbol;Acc:MGI:103198])

HSP 1 Score: 91.2781 bits (225), Expect = 4.711e-19
Identity = 50/152 (32.89%), Postives = 77/152 (50.66%), Query Frame = -2
Query:  841 VSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLC 1296
            +S + +A ++   F      + IIDCRYPYEY+GGH+ GAVNL+   ++ +++                       L N I+      +  K    +FHCEFSS RGP M R +R  DR  N      L +P+++++K GY+EF+ K +  C
Sbjct:  289 ISPEIMASVLNGKFAGLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFL-----------------------LKNPIV-----PTDGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNE--YPKLHYPELYVLKGGYKEFFLKCQVRC 410          
BLAST of cdc25c-like protein vs. UniProt/SwissProt
Match: sp|P20483|MPIP_DROME (M-phase inducer phosphatase OS=Drosophila melanogaster OX=7227 GN=stg PE=1 SV=2)

HSP 1 Score: 122.479 bits (306), Expect = 3.072e-28
Identity = 60/163 (36.81%), Postives = 91/163 (55.83%), Query Frame = -2
Query:  817 ITEVSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKM 1305
            +  +S++ VA++++ +F+    +Y IIDCRYPYE++GGH+ GA NLYT  Q+L+     Q      +Q+ E                    S  K    IFHCEFSS RGP+M+R +RN+DR  N +    L +P+++++  GY+EF+  H  LC P  Y  M
Sbjct:  297 LKSISSETVARLLKGEFSDKVASYRIIDCRYPYEFEGGHIEGAKNLYTTEQILDEFLTVQQTELQQQQNAE--------------------SGHKRNIIIFHCEFSSERGPKMSRFLRNLDRERNTNAYPALHYPEIYLLHNGYKEFFESHVELCEPHAYRTM 439          
BLAST of cdc25c-like protein vs. UniProt/SwissProt
Match: sp|P30309|MPI1B_XENLA (M-phase inducer phosphatase 1-B OS=Xenopus laevis OX=8355 GN=cdc25-1-b PE=1 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 1.677e-25
Identity = 75/248 (30.24%), Postives = 119/248 (47.98%), Query Frame = -2
Query:  805 MRQMISQKSGKFVSASIAASPMCPEIEN-EPTRRRRLLKSRI----IQTDQIIDESCFKDENDIKITEV----------------SADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMDIKD 1485
            +R + S+   +       +S + P+ EN +P RR   LK  +    +    ++DE C   +     T+V                + + +A +I  DF+S      IIDCRYPYEYDGGH+ GA+NL+   ++ +Y         +LKQ +                   P  + K    IFHCEFSS RGP+M R +R  DR  N     +L++P+++++K GY++F+ ++K LC P  Y  M  +D
Sbjct:  301 VRPLDSETPVRVKRRRSTSSSLQPQEENFQPQRRGTSLKKTLSLCDVDISTVLDEDCGHRQLIGDFTKVYALPTVTGRHQDLRYITGETLAALIHGDFSSLVEKIFIIDCRYPYEYDGGHIKGALNLHRQEEVTDY---------FLKQPL------------------TPTMAQKRLIIIFHCEFSSERGPKMCRFLREEDRARNE--YPSLYYPELYLLKGGYKDFFPEYKELCEPQSYCPMHHQD 519          
BLAST of cdc25c-like protein vs. UniProt/SwissProt
Match: sp|P30307|MPIP3_HUMAN (M-phase inducer phosphatase 3 OS=Homo sapiens OX=9606 GN=CDC25C PE=1 SV=2)

HSP 1 Score: 112.464 bits (280), Expect = 6.035e-25
Identity = 58/164 (35.37%), Postives = 88/164 (53.66%), Query Frame = -2
Query:  805 VSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMDIKD 1296
            V+ + VA ++   F      +++IDCRYPYEY GGH+ GA+NLY+  +L N+         +LK+ +                   P  + K    +FHCEFSS RGP M RC+R  DR +N      L++P+++I+K GYR+F+ ++  LC P  Y  M  +D
Sbjct:  305 VNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNF---------FLKKPI------------------VPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQ--YPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQD 439          
BLAST of cdc25c-like protein vs. UniProt/SwissProt
Match: sp|P30311|MPIP3_XENLA (M-phase inducer phosphatase 3 OS=Xenopus laevis OX=8355 GN=cdc25-3 PE=1 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 1.445e-24
Identity = 73/250 (29.20%), Postives = 119/250 (47.60%), Query Frame = -2
Query:  805 MRQMISQKSGKFVSASIAASPMCPEIEN-EPTRRRRLLKSRI----IQTDQIIDESCFKDE------------------NDIKITEVSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMDIKD 1485
            +R + S+   +       +SP+ PE EN +P RR   LK  +    +    ++DE C   +                   D++   ++ + +A ++  DF S    + IIDCRYPYEYDGGH+  A NL+   ++ +Y         +L+Q +                   P  + K    IFHCEFSS RGP+M R +R  DR  N     +L++P+++++K GY++F+ ++K LC P  Y  M  +D
Sbjct:  320 VRPLNSETPVRVKRRRSTSSPLQPEEENCQPQRRGTSLKKTLSLCDVDISSVLDEDCGHRQLIGDFSKVYALPTVTGRHQDLRY--ITGETLAALMHGDFNSLVEKFFIIDCRYPYEYDGGHIKSAFNLHRQDEVTDY---------FLQQPL------------------TPLMAQKRLIIIFHCEFSSERGPKMCRSLREEDRASND--YPSLYYPELYLLKGGYKDFFPEYKELCEPQSYCPMHHQD 538          
BLAST of cdc25c-like protein vs. UniProt/SwissProt
Match: sp|P30308|MPI1A_XENLA (M-phase inducer phosphatase 1-A OS=Xenopus laevis OX=8355 GN=cdc25-1-a PE=2 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 2.732e-24
Identity = 73/250 (29.20%), Postives = 118/250 (47.20%), Query Frame = -2
Query:  805 MRQMISQKSGKFVSASIAASPMCPEIEN-EPTRRRRLLKSRI----IQTDQIIDESCFKDE------------------NDIKITEVSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMDIKD 1485
            +R + S+   +       +SP+ PE EN +P RR   LK  +    +    ++DE C   +                   D++   ++ + +A ++  DF S    + IIDCRYPYEYDGGH+  A NL+   ++ +Y         +L+Q +                   P    K    IFHCEFSS RGP+M R +R  DR  N     +L++P+++++K GY++F+ ++K LC P  Y  M  +D
Sbjct:  301 VRPLDSETPVRVKRRRSTSSPLQPEEENCQPQRRGTSLKKTLSLCDVDISTVLDEDCGHRQLIGDFSKVYALPTVTGRHQDLRY--ITGETLAALMHGDFNSLVEKFFIIDCRYPYEYDGGHIKSAFNLHRQEEVTDY---------FLQQPL------------------TPLMVQKRLIIIFHCEFSSERGPKMCRFLREEDRASND--YPSLYYPELYLLKGGYKDFFPEYKELCEPQSYCPMHHQD 519          
BLAST of cdc25c-like protein vs. TrEMBL
Match: A0A172RVS3 (CDC25-1 protein OS=Schmidtea mediterranea OX=79327 GN=CDC25-1 PE=2 SV=1)

HSP 1 Score: 678.322 bits (1749), Expect = 0.000e+0
Identity = 342/344 (99.42%), Postives = 342/344 (99.42%), Query Frame = -2
Query:  967 NHNISISLDSVSKDQNHNXXXXXXXXXXIAEDYIPLSSCLTGNFKVACEIQYSESLDISPCIGTPKAQIIPLKDFKNLPKPQIENYVISGKKIVSYTDNKFMLNKSFSDTNALNSSLNDSFGVLKHDLSKNNSYTPINLLNNLFNHNTPETPCDLYTMDIDSQKSIDCLPKMRQMISQKSGKFVSASIAASPMCPEIENEPTRRRRLLKSRIIQTDQIIDESCFKDENDIKITEVSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEM 1998
            NHNISISLDSVSKDQNHN SILDISDSSIAEDYIPLSSCLTGNFKVACEIQYSESLDISPCIGTPKAQIIPLKDFKNLPKPQIENYVISGKKIVSYTDNKFMLNKSFSDTNALNSSLNDSFGVLKHDLSKNNSYTPINLLNNLFNHNTPETPCDLYTMDIDSQKSIDCLPKMRQMISQKSGKFVSASIAASPMCPEIENEPTRRRRLLKSRIIQTDQIIDESCFKDENDIKITEVSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQ VENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEM
Sbjct:   40 NHNISISLDSVSKDQNHNSSILDISDSSIAEDYIPLSSCLTGNFKVACEIQYSESLDISPCIGTPKAQIIPLKDFKNLPKPQIENYVISGKKIVSYTDNKFMLNKSFSDTNALNSSLNDSFGVLKHDLSKNNSYTPINLLNNLFNHNTPETPCDLYTMDIDSQKSIDCLPKMRQMISQKSGKFVSASIAASPMCPEIENEPTRRRRLLKSRIIQTDQIIDESCFKDENDIKITEVSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQPVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEM 383          
BLAST of cdc25c-like protein vs. TrEMBL
Match: D2DJS8 (Cdc25c-like protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 359.762 bits (922), Expect = 3.001e-118
Identity = 172/173 (99.42%), Postives = 172/173 (99.42%), Query Frame = -2
Query:  967 MRQMISQKSGKFVSASIAASPMCPEIENEPTRRRRLLKSRIIQTDQIIDESCFKDENDIKITEVSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEM 1485
            MRQMISQKSGKFVSASIAASPMCPEIENEPTRRRRLLKSRIIQTDQIIDESCFKDENDIKITEVSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQ VENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEM
Sbjct:    1 MRQMISQKSGKFVSASIAASPMCPEIENEPTRRRRLLKSRIIQTDQIIDESCFKDENDIKITEVSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQPVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEM 173          
BLAST of cdc25c-like protein vs. TrEMBL
Match: A0A172RVS8 (CDC25-2 protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=CDC25-2 PE=2 SV=2)

HSP 1 Score: 125.176 bits (313), Expect = 3.240e-28
Identity = 64/170 (37.65%), Postives = 100/170 (58.82%), Query Frame = -2
Query:  817 NDIKITEVSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSS---WKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKM 1317
            N + I E+S   ++ ++   ++     Y IIDCR+PYEYDGGH+  ++N+YT  Q++          +Y  QS +   D   DL + +   + PNSS   + T+AFIF+CEFSS RGP++A C+R +D+  N      + FP V+++  GY EF+ K+  LC+P GY+ M
Sbjct:   28 NHLLIPEISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMM----------QYFCQSTQ--PDMEQDLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISM 185          
BLAST of cdc25c-like protein vs. TrEMBL
Match: W5M7W2 (Cell division cycle 25 homolog d OS=Lepisosteus oculatus OX=7918 PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 3.510e-28
Identity = 65/175 (37.14%), Postives = 96/175 (54.86%), Query Frame = -2
Query:  772 VSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMDIKDPTCVNDSFSDD 1296
            VS   VA ++  ++++   ++ I+DCRYPYEY GGH+ GAVNL++          AQ +   L + V +     V   ++ +    P  S      IFHCEFSS RGP + R +R MDR +N      LF+P+++++  GY+EFYS  +SLC PC YV M       + + FSD 
Sbjct:  208 VSGQTVASLLLGEYSTAVRSFLIVDCRYPYEYQGGHIKGAVNLHSE---------AQVEAALLHEEVLSRLSPTVPSPSSCVGTWAPTGSSPRRLLIFHCEFSSERGPWLCRYLRKMDRRLN--AYPRLFYPELYVLAGGYKEFYSHFESLCEPCSYVPM-------LQEEFSDQ 364          
BLAST of cdc25c-like protein vs. TrEMBL
Match: A0A267ESL8 (Rhodanese domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022781g1 PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 8.959e-28
Identity = 62/166 (37.35%), Postives = 87/166 (52.41%), Query Frame = -2
Query:  817 DIKITEVSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKM 1314
            D  I  V+AD +A ++   F +   +Y I+DCRYP+E+ GGH+ GAVNLY P  LL+ +  A         S+    D +V                     IFHCEFSS R P MAR +R  DR +N      L +P++++++ GY+ FY  H+  C PCGY KM
Sbjct:  263 DYGIRSVTADTLAGLLNGQFANSVASYIIVDCRYPFEFRGGHVRGAVNLYRPEVLLDRLLPAAGG------SLPAAGDRVV--------------------IIFHCEFSSQRAPRMARLLRQRDRELNAQNYPQLHYPELYLLQGGYKAFYESHQGHCEPCGYTKM 402          
BLAST of cdc25c-like protein vs. Ensembl Cavefish
Match: cdc25d (cell division cycle 25 homolog d [Source:ZFIN;Acc:ZDB-GENE-090313-74])

HSP 1 Score: 93.2041 bits (230), Expect = 1.748e-20
Identity = 66/177 (37.29%), Postives = 89/177 (50.28%), Query Frame = -2
Query:  823 VSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGH--LLGAVNLYTPWQLLNYIFL-----------AQNDLEYLKQSV----ENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARC--MRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYV 1296
            VSA  VA +I   F++    + IIDCRYPYE+ GGH  L GAVNLYT  Q ++  FL           AQ D    +       +               IK   SS   +  +FHCEFSS RGP   RC  +R +DR VN      L +P++++++ GY+ FY+ +  LC PC YV
Sbjct:   87 VSAQTVAGLITAQFSAVVEDFLIIDCRYPYEFKGGHIKLQGAVNLYTEHQ-IHQAFLQSFSNFQTSPGAQQDPRSPEAGAVGGVQGPGSGGSRSSAVSGEIKDGGSSCPRKLIVFHCEFSSERGP---RCQYLRELDRAVNTQNYPLLLYPELYLLQGGYKHFYTHYPDLCDPCNYV 259          
BLAST of cdc25c-like protein vs. Ensembl Cavefish
Match: CDC25B (cell division cycle 25B [Source:HGNC Symbol;Acc:HGNC:1726])

HSP 1 Score: 95.9005 bits (237), Expect = 2.528e-20
Identity = 55/175 (31.43%), Postives = 85/175 (48.57%), Query Frame = -2
Query:  772 VSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMDIKDPTCVNDSFSDD 1296
            ++ + +   +   F+       +IDCRYPYE++GGH+ GA+NL+   Q+ +  F +Q  L                          P S  K    +FHCEFSS RGP M R +R  DR +N     NL +P+++++K GY++F+  HK  C P  Y  M       V++ + DD
Sbjct:  391 ITPEVMVAAMSGQFSDVVERLFVIDCRYPYEFEGGHIKGALNLHLEEQIEDR-FFSQPFL--------------------------PQSPDKRVLLVFHCEFSSERGPRMCRFVRERDRDLN--EYPNLHYPELYVLKGGYKDFFPLHKRECEPQDYRPM-------VHEDYKDD 529          
BLAST of cdc25c-like protein vs. Ensembl Yeast
Match: MIH1 (Protein tyrosine phosphatase involved in cell cycle control; regulates the phosphorylation state of Cdc28p; homolog of S. pombe cdc25 [Source:SGD;Acc:S000004639])

HSP 1 Score: 90.5077 bits (223), Expect = 1.918e-19
Identity = 52/175 (29.71%), Postives = 89/175 (50.86%), Query Frame = -2
Query:  805 KDENDIKITEVSADFVAKIIENDFTSDSY-AYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMDIKD 1326
            ++ ND     +S + +  I++N+     Y +  IIDCR+ YEY GGH++ +VN++           ++++LEY             + I+ +++    N++      I HCEFSS RGP +A  +RN DR +N      LF+P + I+  GY+  +     LC P  YV M+ ++
Sbjct:  235 RNSNDF-FPRISPETLKNILQNNMCESFYNSCRIIDCRFEYEYTGGHIINSVNIH-----------SRDELEY-------------EFIHKVLHSDTSNNNTLPTLLIIHCEFSSHRGPSLASHLRNCDRIINQDHYPKLFYPDILILDGGYKAVFDNFPELCYPRQYVGMNSQE 384          
BLAST of cdc25c-like protein vs. Ensembl Nematostella
Match: EDO39841 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8Z1])

HSP 1 Score: 104.76 bits (260), Expect = 6.792e-26
Identity = 56/160 (35.00%), Postives = 86/160 (53.75%), Query Frame = -2
Query:  817 VSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKM 1296
            +S + V K+I  D+  +   Y+IIDCRYP+E+DGGH+ GA+N+YT  ++L             KQ ++  +                    K    IFHCEFSS RGP+M R +RN DR ++     +LF+P+++++  GY+ F++  K  C P  YV M
Sbjct:   36 ISPETVTKLINGDYKDEIDEYYIIDCRYPFEFDGGHVKGAINIYTKDEML-------------KQFIDTPK----------------CKEGKRVVVIFHCEFSSKRGPDMCRFLRNRDRDIHRPSYPSLFYPELYLLDGGYKNFFNTCKEHCEPQNYVLM 166          
BLAST of cdc25c-like protein vs. Ensembl Medaka
Match: ENSORLT00000022793.2 (cell division cycle 25B [Source:NCBI gene;Acc:101168663])

HSP 1 Score: 94.7449 bits (234), Expect = 6.165e-20
Identity = 74/262 (28.24%), Postives = 111/262 (42.37%), Query Frame = -2
Query:  805 VSASIAASPMCPEIENEPTR--RRRLLKSRII--------------------------QTDQIIDESCFKDENDIKITEVSADFVAKIIEND------FTSD------SYAYH-------IIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMDIKD 1449
             S   A  P CP  EN P R  RRR L    +                          + +Q++D+   +  ND+ I + +  FV   +E         TSD      S  +H       +IDCRYPYE++GGH+ GA+N +   Q+  ++                       L   I+    P+S  K    +FHCEFSS RGP M R +R  DR +N      L +P+++I+K GY++F+   ++ C P  Y  M  +D
Sbjct:  312 ASRPAAKRPDCPVDENTPVRVKRRRSLAGTQVTLLEQDPESPRSAGTFLQRSKSFCHAEIEQLLDK--VESPNDL-IGDFTKPFVLPTVEGKHQDLKYITSDMMVAALSGHFHEVVDQVIVIDCRYPYEFEGGHIKGALNFHLESQVEEFL-----------------------LRTPIV----PSSPEKRVVVVFHCEFSSERGPRMCRFIRERDRALN--DYPKLHYPELYILKGGYKDFFPHFQAQCEPQAYRPMHHED 541          
BLAST of cdc25c-like protein vs. Planmine SMEST
Match: SMESG000075488.1 (SMESG000075488.1)

HSP 1 Score: 910.983 bits (2353), Expect = 0.000e+0
Identity = 452/455 (99.34%), Postives = 452/455 (99.34%), Query Frame = -2
Query:  634 NHNISISLDSVSKDQNHNXXXXXXXXXXIAEDYIPLSSCLTGNFKVACEIQYSESLDISPCIGTPKAQIIPLKDFKNLPKPQIENYVISGKKIVSYTDNKFMLNKSFSDTNALNSSLNDSFGVLKHDLSKNNSYTPINLLNNLFNHNTPETPCDLYTMDIDSQKSIDCLPKMRQMISQKSGKFVSASIAASPMCPEIENEPTRRRRLLKSRIIQTDQIIDESCFKDENDIKITEVSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMDIKDPTCVNDSFSDDGDESPLTKSSNPILDVENWKAQVKMYNQCKKESQDQMKLFSQLLQG 1998
            NHNISISLDSVSKDQNHN SILDISDSSIAEDYIPLSSCLTGNFKVACEIQYSESLDISPCIGTPKAQIIPLKDFKNLPKPQIENYVISGKKIVSYTDNKFMLNKSFSDTNALNSSLNDSFGVLKHDLSKNNSYTPINLLNNLFNHNTPETPCDLYTMDIDSQKSIDCLPKMRQMISQKSGKFVSASIAASPMCPEIENEPTRRRRLLKSRIIQTDQIIDESCFKDENDIKITEVSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQ VENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMDIKDPTCVNDSFSDDGDESPLTKSSNPILDVE WKAQVKMYNQCKKESQDQMKLFSQLLQG
Sbjct:   40 NHNISISLDSVSKDQNHNSSILDISDSSIAEDYIPLSSCLTGNFKVACEIQYSESLDISPCIGTPKAQIIPLKDFKNLPKPQIENYVISGKKIVSYTDNKFMLNKSFSDTNALNSSLNDSFGVLKHDLSKNNSYTPINLLNNLFNHNTPETPCDLYTMDIDSQKSIDCLPKMRQMISQKSGKFVSASIAASPMCPEIENEPTRRRRLLKSRIIQTDQIIDESCFKDENDIKITEVSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQPVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMDIKDPTCVNDSFSDDGDESPLTKSSNPILDVETWKAQVKMYNQCKKESQDQMKLFSQLLQG 494          
BLAST of cdc25c-like protein vs. Planmine SMEST
Match: SMESG000025390.1 (SMESG000025390.1)

HSP 1 Score: 156.377 bits (394), Expect = 3.009e-42
Identity = 75/172 (43.60%), Postives = 109/172 (63.37%), Query Frame = -2
Query:  805 ENDIKITEVSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMDIKD 1320
            +N I I ++  D V KI+EN++T D   Y IID R+P+E++GGH++GAVNLYTP  +  Y F         +   ++ +D++  ++  IIN++K +S+      IFHCEFSS R P+MA  +R +DR+ N  C  +LF+PK+ I+K GYR FY  +K LC P  Y KMDI D
Sbjct:   97 DNIITIEDIDVDRVKKIVENNYTIDGLNYCIIDSRFPFEFNGGHIIGAVNLYTPLDVFQYFFGPD------QLKTQSDKDNLELVVRNIINLQKFSSNLN---LIFHCEFSSARAPKMAEELRCIDRFANLDCYPHLFYPKIFILKGGYRAFYMNNKELCEPSSYRKMDIDD 259          
BLAST of cdc25c-like protein vs. Planmine SMEST
Match: SMESG000025390.1 (SMESG000025390.1)

HSP 1 Score: 136.732 bits (343), Expect = 7.419e-36
Identity = 66/157 (42.04%), Postives = 100/157 (63.69%), Query Frame = -2
Query:  850 ENDIKITEVSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHK 1320
            +N I I ++  D V KI+EN++T D   Y IID R+P+E++GGH++GAVNLYTP  +  Y F         +   ++ +D++  ++  IIN++K +S+      IFHCEFSS R P+MA  +R +DR+ N  C  +LF+PK+ I+K GYR FY  +K
Sbjct:   97 DNIITIEDIDVDRVKKIVENNYTIDGLNYCIIDSRFPFEFNGGHIIGAVNLYTPLDVFQYFFGPD------QLKTQSDKDNLELVVRNIINLQKFSSNLN---LIFHCEFSSARAPKMAEELRCIDRFANLDCYPHLFYPKIFILKGGYRAFYMNNK 244          
BLAST of cdc25c-like protein vs. Planmine SMEST
Match: SMESG000054042.1 (SMESG000054042.1)

HSP 1 Score: 126.331 bits (316), Expect = 1.403e-30
Identity = 71/206 (34.47%), Postives = 114/206 (55.34%), Query Frame = -2
Query:  817 MCPEIENEPTRRRRLLKSRIIQTDQIIDESCFKDENDIKITEVSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLA-QNDLEYLKQSVENTEDSMVDLINTIINIKKPNSS---WKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKM 1422
             C E+     RR + + +++     I+ ES     N + I E+S   ++ ++   ++     Y IIDCR+PYEYDGGH+  ++N+YT  Q++ Y   + Q D+E              DL + +   + PNSS   + T+AFIF+CEFSS RGP++A C+R +D+  N      + FP V+++  GY EF+ K+  LC+P GY+ M
Sbjct:  203 FCYELRQRHQRRYQKISNQLSPL-PIMRESSL---NHLLIPEISNQTLSDLLVGRYSCYLSDYIIIDCRFPYEYDGGHISNSINVYTCRQMMQYFCQSTQPDMEQ-------------DLQHVLKLFESPNSSEDDFDTKAFIFYCEFSSFRGPKLAECLRGLDKLSNLESLPRVKFPHVYVLHGGYNEFFIKYPELCTPQGYISM 391          
BLAST of cdc25c-like protein vs. Planmine SMEST
Match: SMESG000065054.1 (SMESG000065054.1)

HSP 1 Score: 114.005 bits (284), Expect = 6.902e-27
Identity = 68/222 (30.63%), Postives = 122/222 (54.95%), Query Frame = -2
Query:  655 NDIKITEVSADFVAKIIENDFTSDSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQSVENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRNMDRYVNFSCQS-NLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMDIKDPTCVNDSFSDDGDESPLTKSSNPILDVENWKAQVKMYNQCKKESQDQMKL 1317
            +++ I E+S+  +A I+  + T D+    I DCR+PYEY GGH+  A+N+YT  QLL  +F        +KQS  + +    D+ N    +K+ N+      ++F+CEFSS R P+MA+C+R +DR  +  C S +LF P ++++  GYR+FY+++   C P  YV M        N  +  + DE       + ++    ++ + K Y +  ++S+ ++++
Sbjct:  181 HNVLIPEISSLTLANILSGNHTLDN-NITIFDCRFPYEYSGGHIANAINVYTSQQLLQILFP-------IKQSCTDRKLEE-DISNLNKKLKRDNT-----IYVFYCEFSSYRAPKMAQCLRGLDRLAH--CGSRDLFIPNIYVLNAGYRDFYNEYPKFCFPRNYVSMKQTRYPLRNSEYISENDE------FSSVMCKNQYRKEEKQYMRETQDSEKKLRM 380          
The following BLAST results are available for this feature:
BLAST of cdc25c-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CDC25C3.572e-2635.40cell division cycle 25C [Source:HGNC Symbol;Acc:HG... [more]
CDC25C8.783e-2635.37cell division cycle 25C [Source:HGNC Symbol;Acc:HG... [more]
CDC25C8.822e-2635.37cell division cycle 25C [Source:HGNC Symbol;Acc:HG... [more]
CDC25C8.822e-2635.37cell division cycle 25C [Source:HGNC Symbol;Acc:HG... [more]
CDC25C1.257e-2535.37cell division cycle 25C [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of cdc25c-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdc-25.42.404e-1834.27Cell Division Cycle related [Source:UniProtKB/TrE... [more]
cdc-25.11.510e-1630.28M-phase inducer phosphatase cdc-25.1 [Source:UniP... [more]
cdc-25.11.510e-1630.28M-phase inducer phosphatase cdc-25.1 [Source:UniP... [more]
cdc-25.35.078e-1331.08M-phase inducer phosphatase cdc-25.3 [Source:UniP... [more]
cdc-25.28.099e-1228.16M-phase inducer phosphatase cdc-25.2 [Source:UniP... [more]
back to top
BLAST of cdc25c-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stg3.065e-2936.81gene:FBgn0003525 transcript:FBtr0085397[more]
stg3.065e-2936.81gene:FBgn0003525 transcript:FBtr0334867[more]
twe8.739e-2334.36gene:FBgn0002673 transcript:FBtr0331444[more]
twe8.739e-2334.36gene:FBgn0002673 transcript:FBtr0331445[more]
twe8.739e-2334.36gene:FBgn0002673 transcript:FBtr0331446[more]
back to top
BLAST of cdc25c-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cdc25d6.800e-2837.35cell division cycle 25 homolog d [Source:ZFIN;Acc:... [more]
cdc25b1.537e-2335.63cell division cycle 25B [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of cdc25c-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdc25c9.824e-2932.19cell division cycle 25C [Source:NCBI gene;Acc:1001... [more]
cdc25c1.149e-2832.19cell division cycle 25C [Source:NCBI gene;Acc:1001... [more]
adcy71.250e-2638.13adenylate cyclase 7 [Source:Xenbase;Acc:XB-GENE-10... [more]
ENSXETT00000036492.12.886e-2537.20M-phase inducer phosphatase 3-like [Source:NCBI ge... [more]
cdc25c1.196e-2431.62cell division cycle 25C [Source:NCBI gene;Acc:1001... [more]
back to top
BLAST of cdc25c-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cdc25c2.619e-2335.37cell division cycle 25C [Source:MGI Symbol;Acc:MGI... [more]
Cdc25a2.375e-2131.07cell division cycle 25A [Source:MGI Symbol;Acc:MGI... [more]
Cdc25b1.086e-2034.16cell division cycle 25B [Source:MGI Symbol;Acc:MGI... [more]
Cdc25b1.129e-2034.16cell division cycle 25B [Source:MGI Symbol;Acc:MGI... [more]
Cdc25a4.711e-1932.89cell division cycle 25A [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of cdc25c-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P20483|MPIP_DROME3.072e-2836.81M-phase inducer phosphatase OS=Drosophila melanoga... [more]
sp|P30309|MPI1B_XENLA1.677e-2530.24M-phase inducer phosphatase 1-B OS=Xenopus laevis ... [more]
sp|P30307|MPIP3_HUMAN6.035e-2535.37M-phase inducer phosphatase 3 OS=Homo sapiens OX=9... [more]
sp|P30311|MPIP3_XENLA1.445e-2429.20M-phase inducer phosphatase 3 OS=Xenopus laevis OX... [more]
sp|P30308|MPI1A_XENLA2.732e-2429.20M-phase inducer phosphatase 1-A OS=Xenopus laevis ... [more]
back to top
BLAST of cdc25c-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A172RVS30.000e+099.42CDC25-1 protein OS=Schmidtea mediterranea OX=79327... [more]
D2DJS83.001e-11899.42Cdc25c-like protein (Fragment) OS=Schmidtea medite... [more]
A0A172RVS83.240e-2837.65CDC25-2 protein (Fragment) OS=Schmidtea mediterran... [more]
W5M7W23.510e-2837.14Cell division cycle 25 homolog d OS=Lepisosteus oc... [more]
A0A267ESL88.959e-2837.35Rhodanese domain-containing protein OS=Macrostomum... [more]
back to top
BLAST of cdc25c-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cdc25d1.748e-2037.29cell division cycle 25 homolog d [Source:ZFIN;Acc:... [more]
CDC25B2.528e-2031.43cell division cycle 25B [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of cdc25c-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cdc25c-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
MIH11.918e-1929.71Protein tyrosine phosphatase involved in cell cycl... [more]
back to top
BLAST of cdc25c-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO398416.792e-2635.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cdc25c-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000022793.26.165e-2028.24cell division cycle 25B [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of cdc25c-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075488.10.000e+099.34SMESG000075488.1[more]
SMESG000025390.13.009e-4243.60SMESG000025390.1[more]
SMESG000025390.17.419e-3642.04SMESG000025390.1[more]
SMESG000054042.11.403e-3034.47SMESG000054042.1[more]
SMESG000065054.16.902e-2730.63SMESG000065054.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30008297
GenBankACT98265.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008297 ID=SMED30008297|Name=cdc25c-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1999bp
TCAACGCAGAGTTGACAAATCTAATAATTTTTATTTTAATAGCACGACTG
CGCCCACTGTTCCCCATCGAACGGCAAGACGATTGGATGATGGAGCCCTG
AGGATGAAGACCCATGGAAATGATGGTGCTCTGGTGCCACATTTCCCTGC
CCGGACTTTCGGATTTGAATCCAGCAAGGAGTCGGCTAGGAATACGGATG
GAGCTGCTGGAACAGGATGGAGACAGCAGATGGGTCCAAAATGAATGCAG
CGAGCAGATCTGGAAATTCAGGTATTAATGATCGATTATCGTTTGCGGCC
ATAATTGGTAATAATAATAAGCCAAAGTATTCATCTCCAAATGGAGGAAT
ATATAAATCTTCATCCCGTTTCAACGCCAGAAATTACGACCTACTAAATA
AAAAAGAGATTAATAAATCAACTAATAATAATACTCAATATAGGGATTCT
GCTTACCTTGAAAATAGAAACTCTCAAGATAAGCAGACTCCAAACCATTA
TACTTATAAAAATAATAATAATAATTATAATAATGCAACAATAAATAGAG
GATGATAAAGTCTATTAAAACACAGCTGACTCATATAGATCTGTAATAAT
CTGATGTTTCTTTCGTCAAGGTTGCCACAATCATCCTTGTAATAATTGTG
AAAATAATTTCATTTGGTCCTGGGATTCCTTTTTGCACTGATTGTACATT
TTCACTTGAGCTTTCCAATTTTCAACGTCTAAAATCGGATTGCTTGATTT
GGTTAGTGGGGATTCATCTCCATCGTCAGAAAATGAATCATTTACACACG
TGGGATCTTTAATGTCCATTTTTACGTAACCGCACGGTGAACACAAACTC
TTATGTTTGCTATAAAACTCTCGGTAACCTTTTTTCATGATGTGGACTTT
TGGAAAGAACAGATTTGATTGACAGCTGAAATTGACATATCTGTCCATGT
TTCTCATACAGCGCGCCATTTCTGGTCCACGAACCGATGAGAATTCACAA
TGGAAAATAAAAGCCTCTGTTTTCCAACTGGAATTCGGTTTCTTAATGTT
GATAATTGTATTGATAAGATCAACCATGGAATCTTCGGTATTTTCAACCG
ACTGTTTGAGATATTCCAAATCATTCTGAGCAAGAAAGATATAATTCAAT
AGCTGCCAAGGCGTATAAAGATTGACTGCCCCCAAAAGATGTCCACCATC
ATACTCATACGGATATCTACAATCAATTATGTGATAAGCATATGAATCGG
ATGTGAAATCGTTTTCTATAATTTTCGCTACAAAATCAGCTGATACTTCT
GTGATTTTGATGTCGTTTTCGTCTTTGAAGCATGACTCATCTATTATTTG
ATCGGTTTGAATAATACGGCTTTTCAGTAATCGCCTTCTTCGTGTAGGCT
CATTTTCAATTTCAGGACACATTGGCGAAGCTGCTATTGAAGCACTTACG
AATTTACCACTTTTTTGGGATATCATTTGACGCATTTTAGGAAGACAATC
AATAGATTTTTGACTGTCTATATCCATCGTGTACAAATCACATGGTGTTT
CAGGAGTGTTGTGATTAAACAAATTATTAAGTAAATTAATAGGAGTGTAA
CTGTTATTTTTCGACAAGTCATGTTTAAGTACTCCAAATGAATCATTTAG
AGAGGAATTGAGTGCATTAGTATCACTAAAAGATTTGTTAAGCATGAATT
TGTTATCCGTGTAGGAAACAATTTTTTTCCCACTAATTACATAATTTTCA
ATTTGTGGTTTTGGCAAATTTTTAAAATCTTTTAGTGGGATTATTTGTGC
TTTTGGCGTTCCAATACATGGAGATATATCGAGTGATTCAGAATATTGTA
TTTCACAAGCAACCTTAAAATTACCAGTTAAACAACTGGATAATGGGATA
TAATCTTCAGCAATAGAAGAGTCAGATATATCCAAAATAGAAATATTATG
ATTTTGATCTTTAGACACAGAATCCAAAGAGATTGAAATATTATGATTT
back to top

protein sequence of SMED30008297-orf-1

>SMED30008297-orf-1 ID=SMED30008297-orf-1|Name=SMED30008297-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=456bp
NHNISISLDSVSKDQNHNISILDISDSSIAEDYIPLSSCLTGNFKVACEI
QYSESLDISPCIGTPKAQIIPLKDFKNLPKPQIENYVISGKKIVSYTDNK
FMLNKSFSDTNALNSSLNDSFGVLKHDLSKNNSYTPINLLNNLFNHNTPE
TPCDLYTMDIDSQKSIDCLPKMRQMISQKSGKFVSASIAASPMCPEIENE
PTRRRRLLKSRIIQTDQIIDESCFKDENDIKITEVSADFVAKIIENDFTS
DSYAYHIIDCRYPYEYDGGHLLGAVNLYTPWQLLNYIFLAQNDLEYLKQS
VENTEDSMVDLINTIINIKKPNSSWKTEAFIFHCEFSSVRGPEMARCMRN
MDRYVNFSCQSNLFFPKVHIMKKGYREFYSKHKSLCSPCGYVKMDIKDPT
CVNDSFSDDGDESPLTKSSNPILDVENWKAQVKMYNQCKKESQDQMKLFS
QLLQG*
back to top

protein sequence of SMED30008297-orf-2

>SMED30008297-orf-2 ID=SMED30008297-orf-2|Name=SMED30008297-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=113bp
METADGSKMNAASRSGNSGINDRLSFAAIIGNNNKPKYSSPNGGIYKSSS
RFNARNYDLLNKKEINKSTNNNTQYRDSAYLENRNSQDKQTPNHYTYKNN
NNNYNNATINRG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0000228male germ cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036873Rhodanese-like_dom_sf
IPR000751MPI_Phosphatase
IPR001763Rhodanese-like_dom
Vocabulary: biological process
TermDefinition
GO:1902751positive regulation of cell cycle G2/M phase transition
GO:0000087mitotic M phase
GO:0006470protein dephosphorylation
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
Vocabulary: molecular function
TermDefinition
GO:0004725protein tyrosine phosphatase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000751M-phase inducer phosphatasePRINTSPR00716MPIPHPHTASEcoord: 235..255
score: 16.81
coord: 257..277
score: 80.67
IPR001763Rhodanese-like domainSMARTSM00450rhod_4coord: 235..384
e-value: 2.7E-8
score: 43.5
IPR001763Rhodanese-like domainPFAMPF00581Rhodanesecoord: 252..380
e-value: 1.9E-7
score: 31.6
IPR001763Rhodanese-like domainPROSITEPS50206RHODANESE_3coord: 251..387
score: 12.282
IPR036873Rhodanese-like domain superfamilyGENE3DG3DSA:3.40.250.10coord: 220..407
e-value: 7.2E-44
score: 151.3
IPR036873Rhodanese-like domain superfamilySUPERFAMILYSSF52821Rhodanese/Cell cycle control phosphatasecoord: 231..396
NoneNo IPR availablePANTHERPTHR10828:SF17CDC25-LIKE PROTEIN PHOSPHATASE TWINE-RELATEDcoord: 106..406
NoneNo IPR availablePANTHERPTHR10828M-PHASE INDUCER PHOSPHATASE DUAL SPECIFICITY PHOSPHATASE CDC25coord: 106..406