Heat shock cognate 71 kDa protein

Overview
NameHeat shock cognate 71 kDa protein
Smed IDSMED30008295
Length (bp)2192
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Heat shock cognate 71 kDa protein (SMED30008295) t-SNE clustered cells

Violin plots show distribution of expression levels for Heat shock cognate 71 kDa protein (SMED30008295) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Heat shock cognate 71 kDa protein (SMED30008295) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Heat shock cognate 71 kDa protein (SMED30008295) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008295

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30008295SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 SmedASXL_013802SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30008295SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 SmedASXL_013802SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30008295SMESG000051815.1 SmedASXL_073926SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30008295SMESG000051815.1 SmedASXL_073926SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30008295SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 dd_Smed_v4_320_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30008295SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 dd_Smed_v4_320_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008295SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 dd_Smed_v4_320_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008295SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 dd_Smed_v4_320_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30008295SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 dd_Smed_v4_320_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008295SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 dd_Smed_v4_320_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30008295SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 dd_Smed_v4_320_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008295SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 Contig54756newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008295SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 Contig54756uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30008295SMESG000062699.1 SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 dd_Smed_v6_320_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
progenitor cellSMED30008295SMESG000062699.1 SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 dd_Smed_v6_320_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30008295SMESG000062699.1 SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 dd_Smed_v6_320_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008295SMESG000062699.1 SMESG000051570.1 SMESG000051567.1 SMESG000051541.1 SMESG000051540.1 dd_Smed_v6_320_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 1038.87 bits (2685), Expect = 0.000e+0
Identity = 531/609 (87.19%), Postives = 575/609 (94.42%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD++ VQSDMKHW F V+N+ GRPK++VE+KGETK+F+PEE+SSMVL KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE Q++++++KNSLESY++ MK+TVEDEKL+ KI++ D++KI++KC E I WL+KNQ A K+EF++  KELEK+CNPI+ K+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 1038.87 bits (2685), Expect = 0.000e+0
Identity = 531/609 (87.19%), Postives = 575/609 (94.42%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD++ VQSDMKHW F V+N+ GRPK++VE+KGETK+F+PEE+SSMVL KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE Q++++++KNSLESY++ MK+TVEDEKL+ KI++ D++KI++KC E I WL+KNQ A K+EF++  KELEK+CNPI+ K+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 1038.87 bits (2685), Expect = 0.000e+0
Identity = 531/609 (87.19%), Postives = 575/609 (94.42%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD++ VQSDMKHW F V+N+ GRPK++VE+KGETK+F+PEE+SSMVL KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE Q++++++KNSLESY++ MK+TVEDEKL+ KI++ D++KI++KC E I WL+KNQ A K+EF++  KELEK+CNPI+ K+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Human
Match: HSPA2 (heat shock protein family A (Hsp70) member 2 [Source:HGNC Symbol;Acc:HGNC:5235])

HSP 1 Score: 1003.43 bits (2593), Expect = 0.000e+0
Identity = 515/611 (84.29%), Postives = 561/611 (91.82%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKK--VGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NT+FDAKRLIGRKF++++VQSDMKHW F V++E G+PK++VE+KGETKTFFPEEISSMVL KMKEIAEAYLG  V  AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   G E+NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMV+H  +EFKRKHKKDI  NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEG+DFYTSITRARFEELNADLFR TLEPVEKALRDAKLDK  I +IVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQ  VL+QVYEGERAMTKDNNLLGKF+L GIPPAPRGVPQIEVTFDIDANGILNV+A +K TGKENKITITNDKGRLSKDDI+RMV EAE+YK EDE  ++R+AAKN+LESY+Y +K TVEDEKL+ KISE D+ KI++KCQE I WL++NQ A KDE+++  KELE++CNPI++K+YQ
Sbjct:    5 GPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQ 615          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Human
Match: HSPA2 (heat shock protein family A (Hsp70) member 2 [Source:HGNC Symbol;Acc:HGNC:5235])

HSP 1 Score: 1003.43 bits (2593), Expect = 0.000e+0
Identity = 515/611 (84.29%), Postives = 561/611 (91.82%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKK--VGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NT+FDAKRLIGRKF++++VQSDMKHW F V++E G+PK++VE+KGETKTFFPEEISSMVL KMKEIAEAYLG  V  AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   G E+NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMV+H  +EFKRKHKKDI  NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEG+DFYTSITRARFEELNADLFR TLEPVEKALRDAKLDK  I +IVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQ  VL+QVYEGERAMTKDNNLLGKF+L GIPPAPRGVPQIEVTFDIDANGILNV+A +K TGKENKITITNDKGRLSKDDI+RMV EAE+YK EDE  ++R+AAKN+LESY+Y +K TVEDEKL+ KISE D+ KI++KCQE I WL++NQ A KDE+++  KELE++CNPI++K+YQ
Sbjct:    5 GPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQ 615          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Celegans
Match: hsp-1 (Heat shock 70 kDa protein A [Source:UniProtKB/Swiss-Prot;Acc:P09446])

HSP 1 Score: 997.268 bits (2577), Expect = 0.000e+0
Identity = 515/609 (84.56%), Postives = 563/609 (92.45%), Query Frame = 3
Query:  165 NAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETG-RPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            NA+GIDLGTTYSCVGVF HGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGRKFD+ +VQSDMKHW F VI+  G +PK++VE+KGE K F PEEISSMVL+KMKE AEA+LG TVKDAVVTVPAYFNDSQRQATKDAGAI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF  EFKRKHKKD++ N RA+RRLRTACERAKRTLSSS+QA++EIDSL+EGIDFYT+ITRARFEEL ADLFRST++PVEK+LRDAK+DK+ +HDIVLVGGSTRIPK+QKLL DLF+GKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTK  Q FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSA +K TGK+NKITITNDKGRLSKDDIERMVNEAEKYK +DE QK+RI AKN LESY++ +K T+EDEKLKDKIS  D+KKI +KC E + WL+ NQ A K+EF++  K+LE L NPI++K+YQ
Sbjct:    5 NAVGIDLGTTYSCVGVFMHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPHNTVFDAKRLIGRKFDDPAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEEISSMVLLKMKETAEAFLGTTVKDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGHGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFCAEFKRKHKKDLASNPRALRRLRTACERAKRTLSSSSQASIEIDSLFEGIDFYTNITRARFEELCADLFRSTMDPVEKSLRDAKMDKSQVHDIVLVGGSTRIPKVQKLLSDLFSGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKTAQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSATDKSTGKQNKITITNDKGRLSKDDIERMVNEAEKYKADDEAQKDRIGAKNGLESYAFNLKQTIEDEKLKDKISPEDKKKIEDKCDEILKWLDSNQTAEKEEFEHQQKDLEGLANPIISKLYQ 613          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Celegans
Match: hsp-1 (Heat shock 70 kDa protein A [Source:UniProtKB/Swiss-Prot;Acc:P09446])

HSP 1 Score: 997.268 bits (2577), Expect = 0.000e+0
Identity = 515/609 (84.56%), Postives = 563/609 (92.45%), Query Frame = 3
Query:  165 NAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETG-RPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            NA+GIDLGTTYSCVGVF HGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGRKFD+ +VQSDMKHW F VI+  G +PK++VE+KGE K F PEEISSMVL+KMKE AEA+LG TVKDAVVTVPAYFNDSQRQATKDAGAI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF  EFKRKHKKD++ N RA+RRLRTACERAKRTLSSS+QA++EIDSL+EGIDFYT+ITRARFEEL ADLFRST++PVEK+LRDAK+DK+ +HDIVLVGGSTRIPK+QKLL DLF+GKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTK  Q FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSA +K TGK+NKITITNDKGRLSKDDIERMVNEAEKYK +DE QK+RI AKN LESY++ +K T+EDEKLKDKIS  D+KKI +KC E + WL+ NQ A K+EF++  K+LE L NPI++K+YQ
Sbjct:    5 NAVGIDLGTTYSCVGVFMHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPHNTVFDAKRLIGRKFDDPAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEEISSMVLLKMKETAEAFLGTTVKDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGHGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFCAEFKRKHKKDLASNPRALRRLRTACERAKRTLSSSSQASIEIDSLFEGIDFYTNITRARFEELCADLFRSTMDPVEKSLRDAKMDKSQVHDIVLVGGSTRIPKVQKLLSDLFSGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKTAQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSATDKSTGKQNKITITNDKGRLSKDDIERMVNEAEKYKADDEAQKDRIGAKNGLESYAFNLKQTIEDEKLKDKISPEDKKKIEDKCDEILKWLDSNQTAEKEEFEHQQKDLEGLANPIISKLYQ 613          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Celegans
Match: F44E5.5 (pep chromosome:WBcel235:II:11759681:11761808:1 gene:WBGene00009692.1 transcript:F44E5.5.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.5)

HSP 1 Score: 846.269 bits (2185), Expect = 0.000e+0
Identity = 447/645 (69.30%), Postives = 528/645 (81.86%), Query Frame = 3
Query:  159 SGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDG-IFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQXXXXXXXXXXXXXXXXXXHSGDD-KQGPTVEEVD 2087
            S  AIGIDLGTTYSCVG++Q+GKVEI+AN +GN+TTPSYVAFTDTERL+GDAAK+Q A NP NTVFDAKRLIGR+FDES+VQSD KHW F V  + G+P I VE KGE + F PEEIS+MVL KMKE AE YLG TVKDAV+TVPAYFNDSQRQATKDA  I+GLN +RIINEPTAAA+AYGLDK +  E+NVLIFDLGGGTFDVSIL+I +G IFEVKSTAGDTHLGGEDFD RM+ HF+ EFKRK  KDIS N RA+RRLRTACERAKRTLSSS++A +E+DSL+EGID  T ITRARFEEL ADLFR TLEPVEKALRDAKLDK+ I ++VLVGGSTR+PKIQKLL+D FNGKELN SINPDEAVA+GAAVQAA+LSG K E ++D+LL+DVAPLSLGIETAGGVMT LI RNT IPTK  + FTTY+DNQPGV IQVYEGERAMT+DN+ LG FEL+GIPPAPRGVPQIEVTFDIDANGILNVSA +K TGK N+ITI N+KGRL++ DI+RMV+EA++++KED +Q+ER+ A+N LE+Y++Q+K  +++     K+S  D  +  E   E + WL+ N  A KDE +   KEL+ +C  I+ KM+Q    +            G + ++  QGPTVEEVD
Sbjct:    3 SCKAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDAKRLIGRRFDESTVQSDCKHWPFGVKGKQGKPVIEVEVKGEKRQFNPEEISAMVLQKMKETAETYLGHTVKDAVITVPAYFNDSQRQATKDAATIAGLNAIRIINEPTAAALAYGLDKGIQDEKNVLIFDLGGGTFDVSILSIAEGSIFEVKSTAGDTHLGGEDFDQRMLQHFMNEFKRKTGKDISPNPRAIRRLRTACERAKRTLSSSSEACVEVDSLFEGIDLCTKITRARFEELCADLFRKTLEPVEKALRDAKLDKSKIDEVVLVGGSTRVPKIQKLLKDFFNGKELNCSINPDEAVAFGAAVQAAVLSGVKDETIKDVLLVDVAPLSLGIETAGGVMTNLIDRNTRIPTKACKTFTTYADNQPGVSIQVYEGERAMTRDNHRLGTFELSGIPPAPRGVPQIEVTFDIDANGILNVSAEDKSTGKSNRITIQNEKGRLTQSDIDRMVHEAKQFEKEDGEQRERVQARNQLEAYAFQIKQALDE--YSSKLSTEDASRAKEAVDETLRWLDSNSLAEKDEIEAKDKELKSVCQSILTKMHQSGQSSASAGCAGNPGTAGFNPNNYPQGPTVEEVD 645          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Celegans
Match: F44E5.5 (pep chromosome:WBcel235:II:11759640:11761853:1 gene:WBGene00009692.1 transcript:F44E5.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.5)

HSP 1 Score: 846.269 bits (2185), Expect = 0.000e+0
Identity = 447/645 (69.30%), Postives = 528/645 (81.86%), Query Frame = 3
Query:  159 SGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDG-IFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQXXXXXXXXXXXXXXXXXXHSGDD-KQGPTVEEVD 2087
            S  AIGIDLGTTYSCVG++Q+GKVEI+AN +GN+TTPSYVAFTDTERL+GDAAK+Q A NP NTVFDAKRLIGR+FDES+VQSD KHW F V  + G+P I VE KGE + F PEEIS+MVL KMKE AE YLG TVKDAV+TVPAYFNDSQRQATKDA  I+GLN +RIINEPTAAA+AYGLDK +  E+NVLIFDLGGGTFDVSIL+I +G IFEVKSTAGDTHLGGEDFD RM+ HF+ EFKRK  KDIS N RA+RRLRTACERAKRTLSSS++A +E+DSL+EGID  T ITRARFEEL ADLFR TLEPVEKALRDAKLDK+ I ++VLVGGSTR+PKIQKLL+D FNGKELN SINPDEAVA+GAAVQAA+LSG K E ++D+LL+DVAPLSLGIETAGGVMT LI RNT IPTK  + FTTY+DNQPGV IQVYEGERAMT+DN+ LG FEL+GIPPAPRGVPQIEVTFDIDANGILNVSA +K TGK N+ITI N+KGRL++ DI+RMV+EA++++KED +Q+ER+ A+N LE+Y++Q+K  +++     K+S  D  +  E   E + WL+ N  A KDE +   KEL+ +C  I+ KM+Q    +            G + ++  QGPTVEEVD
Sbjct:    3 SCKAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDAKRLIGRRFDESTVQSDCKHWPFGVKGKQGKPVIEVEVKGEKRQFNPEEISAMVLQKMKETAETYLGHTVKDAVITVPAYFNDSQRQATKDAATIAGLNAIRIINEPTAAALAYGLDKGIQDEKNVLIFDLGGGTFDVSILSIAEGSIFEVKSTAGDTHLGGEDFDQRMLQHFMNEFKRKTGKDISPNPRAIRRLRTACERAKRTLSSSSEACVEVDSLFEGIDLCTKITRARFEELCADLFRKTLEPVEKALRDAKLDKSKIDEVVLVGGSTRVPKIQKLLKDFFNGKELNCSINPDEAVAFGAAVQAAVLSGVKDETIKDVLLVDVAPLSLGIETAGGVMTNLIDRNTRIPTKACKTFTTYADNQPGVSIQVYEGERAMTRDNHRLGTFELSGIPPAPRGVPQIEVTFDIDANGILNVSAEDKSTGKSNRITIQNEKGRLTQSDIDRMVHEAKQFEKEDGEQRERVQARNQLEAYAFQIKQALDE--YSSKLSTEDASRAKEAVDETLRWLDSNSLAEKDEIEAKDKELKSVCQSILTKMHQSGQSSASAGCAGNPGTAGFNPNNYPQGPTVEEVD 645          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Celegans
Match: F44E5.4 (pep chromosome:WBcel235:II:11757106:11759323:-1 gene:WBGene00009691.1 transcript:F44E5.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.4)

HSP 1 Score: 846.269 bits (2185), Expect = 0.000e+0
Identity = 447/645 (69.30%), Postives = 528/645 (81.86%), Query Frame = 3
Query:  159 SGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDG-IFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQXXXXXXXXXXXXXXXXXXHSGDD-KQGPTVEEVD 2087
            S  AIGIDLGTTYSCVG++Q+GKVEI+AN +GN+TTPSYVAFTDTERL+GDAAK+Q A NP NTVFDAKRLIGR+FDES+VQSD KHW F V  + G+P I VE KGE + F PEEIS+MVL KMKE AE YLG TVKDAV+TVPAYFNDSQRQATKDA  I+GLN +RIINEPTAAA+AYGLDK +  E+NVLIFDLGGGTFDVSIL+I +G IFEVKSTAGDTHLGGEDFD RM+ HF+ EFKRK  KDIS N RA+RRLRTACERAKRTLSSS++A +E+DSL+EGID  T ITRARFEEL ADLFR TLEPVEKALRDAKLDK+ I ++VLVGGSTR+PKIQKLL+D FNGKELN SINPDEAVA+GAAVQAA+LSG K E ++D+LL+DVAPLSLGIETAGGVMT LI RNT IPTK  + FTTY+DNQPGV IQVYEGERAMT+DN+ LG FEL+GIPPAPRGVPQIEVTFDIDANGILNVSA +K TGK N+ITI N+KGRL++ DI+RMV+EA++++KED +Q+ER+ A+N LE+Y++Q+K  +++     K+S  D  +  E   E + WL+ N  A KDE +   KEL+ +C  I+ KM+Q    +            G + ++  QGPTVEEVD
Sbjct:    3 SCKAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDAKRLIGRRFDESTVQSDCKHWPFGVKGKQGKPVIEVEVKGEKRQFNPEEISAMVLQKMKETAETYLGHTVKDAVITVPAYFNDSQRQATKDAATIAGLNAIRIINEPTAAALAYGLDKGIQDEKNVLIFDLGGGTFDVSILSIAEGSIFEVKSTAGDTHLGGEDFDQRMLQHFMNEFKRKTGKDISPNPRAIRRLRTACERAKRTLSSSSEACVEVDSLFEGIDLCTKITRARFEELCADLFRKTLEPVEKALRDAKLDKSKIDEVVLVGGSTRVPKIQKLLKDFFNGKELNCSINPDEAVAFGAAVQAAVLSGVKDETIKDVLLVDVAPLSLGIETAGGVMTNLIDRNTRIPTKACKTFTTYADNQPGVSIQVYEGERAMTRDNHRLGTFELSGIPPAPRGVPQIEVTFDIDANGILNVSAEDKSTGKSNRITIQNEKGRLTQSDIDRMVHEAKQFEKEDGEQRERVQARNQLEAYAFQIKQALDE--YSSKLSTEDASRAKEAVDETLRWLDSNSLAEKDEIEAKDKELKSVCQSILTKMHQSGQSSASAGCAGNPGTAGFNPNNYPQGPTVEEVD 645          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083059)

HSP 1 Score: 992.26 bits (2564), Expect = 0.000e+0
Identity = 506/607 (83.36%), Postives = 559/607 (92.09%), Query Frame = 3
Query:  168 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP  T+FDAKRLIGRKFD+++VQSDMKHW F+V++  G+PKI V +K E KTFFPEEISSMVL KMKE AEAYLGKTV +AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNR+V HF+QEFKRKHKKD++ NKRA+RRLRTACERAKRTLSSS QA++EIDSL+EG DFYTSITRARFEELNADLFRST++PVEKALRDAKLDK+ IHDIVLVGGSTRIPK+Q+LLQDLFNGKELNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDV PLSLGIETAGGVM+ LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNV+A+E+ T KENKITITNDKGRLSK+DIERMVNEAEKY+ EDE QKE IAAKN LESY + MK+T++++ LK KIS+SDR  I++KC E I WL+ NQ A K+E+++  KELE +CNPI+ K+YQ
Sbjct:    6 AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0337053)

HSP 1 Score: 992.26 bits (2564), Expect = 0.000e+0
Identity = 506/607 (83.36%), Postives = 559/607 (92.09%), Query Frame = 3
Query:  168 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP  T+FDAKRLIGRKFD+++VQSDMKHW F+V++  G+PKI V +K E KTFFPEEISSMVL KMKE AEAYLGKTV +AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNR+V HF+QEFKRKHKKD++ NKRA+RRLRTACERAKRTLSSS QA++EIDSL+EG DFYTSITRARFEELNADLFRST++PVEKALRDAKLDK+ IHDIVLVGGSTRIPK+Q+LLQDLFNGKELNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDV PLSLGIETAGGVM+ LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNV+A+E+ T KENKITITNDKGRLSK+DIERMVNEAEKY+ EDE QKE IAAKN LESY + MK+T++++ LK KIS+SDR  I++KC E I WL+ NQ A K+E+++  KELE +CNPI+ K+YQ
Sbjct:    6 AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083058)

HSP 1 Score: 992.26 bits (2564), Expect = 0.000e+0
Identity = 506/607 (83.36%), Postives = 559/607 (92.09%), Query Frame = 3
Query:  168 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP  T+FDAKRLIGRKFD+++VQSDMKHW F+V++  G+PKI V +K E KTFFPEEISSMVL KMKE AEAYLGKTV +AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNR+V HF+QEFKRKHKKD++ NKRA+RRLRTACERAKRTLSSS QA++EIDSL+EG DFYTSITRARFEELNADLFRST++PVEKALRDAKLDK+ IHDIVLVGGSTRIPK+Q+LLQDLFNGKELNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDV PLSLGIETAGGVM+ LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNV+A+E+ T KENKITITNDKGRLSK+DIERMVNEAEKY+ EDE QKE IAAKN LESY + MK+T++++ LK KIS+SDR  I++KC E I WL+ NQ A K+E+++  KELE +CNPI+ K+YQ
Sbjct:    6 AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083060)

HSP 1 Score: 992.26 bits (2564), Expect = 0.000e+0
Identity = 506/607 (83.36%), Postives = 559/607 (92.09%), Query Frame = 3
Query:  168 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP  T+FDAKRLIGRKFD+++VQSDMKHW F+V++  G+PKI V +K E KTFFPEEISSMVL KMKE AEAYLGKTV +AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNR+V HF+QEFKRKHKKD++ NKRA+RRLRTACERAKRTLSSS QA++EIDSL+EG DFYTSITRARFEELNADLFRST++PVEKALRDAKLDK+ IHDIVLVGGSTRIPK+Q+LLQDLFNGKELNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDV PLSLGIETAGGVM+ LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNV+A+E+ T KENKITITNDKGRLSK+DIERMVNEAEKY+ EDE QKE IAAKN LESY + MK+T++++ LK KIS+SDR  I++KC E I WL+ NQ A K+E+++  KELE +CNPI+ K+YQ
Sbjct:    6 AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083057)

HSP 1 Score: 992.26 bits (2564), Expect = 0.000e+0
Identity = 506/607 (83.36%), Postives = 559/607 (92.09%), Query Frame = 3
Query:  168 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP  T+FDAKRLIGRKFD+++VQSDMKHW F+V++  G+PKI V +K E KTFFPEEISSMVL KMKE AEAYLGKTV +AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNR+V HF+QEFKRKHKKD++ NKRA+RRLRTACERAKRTLSSS QA++EIDSL+EG DFYTSITRARFEELNADLFRST++PVEKALRDAKLDK+ IHDIVLVGGSTRIPK+Q+LLQDLFNGKELNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDV PLSLGIETAGGVM+ LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNV+A+E+ T KENKITITNDKGRLSK+DIERMVNEAEKY+ EDE QKE IAAKN LESY + MK+T++++ LK KIS+SDR  I++KC E I WL+ NQ A K+E+++  KELE +CNPI+ K+YQ
Sbjct:    6 AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 1040.41 bits (2689), Expect = 0.000e+0
Identity = 531/609 (87.19%), Postives = 572/609 (93.92%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD+  VQSDMKHW F+VIN+  RPK++VE+KGE+K+F+PEEISSMVL KMKEIAEAYLGKTV +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDISDNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAK+DK  IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK ED+ Q+++++AKN LESY++ MKSTVEDEKLK KIS+ D++KI++KC E I WL+KNQ A ++EF++  KELEK+CNPI+ K+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 1039.25 bits (2686), Expect = 0.000e+0
Identity = 531/609 (87.19%), Postives = 572/609 (93.92%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD+  VQSDMKHW F+VIN+  RPK++VE+KGE+K+F+PEEISSMVL KMKEIAEAYLGKTV +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDISDNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAK+DK  IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK ED+ Q+++++AKN LESY++ MKSTVEDEKLK KIS+ D++KI++KC E I WL+KNQ A ++EF++  KELEK+CNPI+ K+YQ
Sbjct:    9 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQ 617          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 1038.48 bits (2684), Expect = 0.000e+0
Identity = 531/609 (87.19%), Postives = 572/609 (93.92%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD+  VQSDMKHW F+VIN+  RPK++VE+KGE+K+F+PEEISSMVL KMKEIAEAYLGKTV +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDISDNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAK+DK  IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK ED+ Q+++++AKN LESY++ MKSTVEDEKLK KIS+ D++KI++KC E I WL+KNQ A ++EF++  KELEK+CNPI+ K+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 1038.48 bits (2684), Expect = 0.000e+0
Identity = 531/609 (87.19%), Postives = 572/609 (93.92%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD+  VQSDMKHW F+VIN+  RPK++VE+KGE+K+F+PEEISSMVL KMKEIAEAYLGKTV +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDISDNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAK+DK  IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK ED+ Q+++++AKN LESY++ MKSTVEDEKLK KIS+ D++KI++KC E I WL+KNQ A ++EF++  KELEK+CNPI+ K+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 1038.48 bits (2684), Expect = 0.000e+0
Identity = 531/609 (87.19%), Postives = 572/609 (93.92%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD+  VQSDMKHW F+VIN+  RPK++VE+KGE+K+F+PEEISSMVL KMKEIAEAYLGKTV +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDISDNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAK+DK  IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK ED+ Q+++++AKN LESY++ MKSTVEDEKLK KIS+ D++KI++KC E I WL+KNQ A ++EF++  KELEK+CNPI+ K+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 1048.5 bits (2710), Expect = 0.000e+0
Identity = 544/642 (84.74%), Postives = 591/642 (92.06%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQXXXXXXXXXXXXXXXXXXHSGDDKQGPTVEEVD 2087
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+F+++ VQSDMKHW F+VI+++GRPK++VE+K ETK+F+PEEISSMVL+KMKEIAEAYLGKTV +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRKHKKDI DNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE Q++++++KNSLESY++ MK+TVEDEKLK KIS+ D++KI++KC E I+WL+KNQ A K+EF++  KELEK+CNPI+ K+YQ AGGA              SG    GPT+EEVD
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKHWPFNVISDSGRPKVQVEYKAETKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVAEFKRKHKKDIIDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGAP-------------SGGASSGPTIEEVD 632          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 1045.42 bits (2702), Expect = 0.000e+0
Identity = 533/613 (86.95%), Postives = 579/613 (94.45%), Query Frame = 3
Query:  150 FQMSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
             Q SG A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+F+++ VQSDMKHW F+VI+++GRPK++VE+K ETK+F+PEEISSMVL+KMKEIAEAYLGKTV +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRKHKKDI DNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE Q++++++KNSLESY++ MK+TVEDEKLK KIS+ D++KI++KC E I+WL+KNQ A K+EF++  KELEK+CNPI+ K+YQ
Sbjct:    1 MQPSGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKHWPFNVISDSGRPKVQVEYKAETKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVAEFKRKHKKDIIDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 613          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 1042.72 bits (2695), Expect = 0.000e+0
Identity = 531/609 (87.19%), Postives = 577/609 (94.75%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+F+++ VQSDMKHW F+VI+++GRPK++VE+K ETK+F+PEEISSMVL+KMKEIAEAYLGKTV +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRKHKKDI DNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE Q++++++KNSLESY++ MK+TVEDEKLK KIS+ D++KI++KC E I+WL+KNQ A K+EF++  KELEK+CNPI+ K+YQ
Sbjct:    9 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKHWPFNVISDSGRPKVQVEYKAETKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVAEFKRKHKKDIIDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 617          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 1042.34 bits (2694), Expect = 0.000e+0
Identity = 531/609 (87.19%), Postives = 577/609 (94.75%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+F+++ VQSDMKHW F+VI+++GRPK++VE+K ETK+F+PEEISSMVL+KMKEIAEAYLGKTV +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRKHKKDI DNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE Q++++++KNSLESY++ MK+TVEDEKLK KIS+ D++KI++KC E I+WL+KNQ A K+EF++  KELEK+CNPI+ K+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKHWPFNVISDSGRPKVQVEYKAETKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVAEFKRKHKKDIIDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 1041.95 bits (2693), Expect = 0.000e+0
Identity = 531/609 (87.19%), Postives = 577/609 (94.75%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+F+++ VQSDMKHW F+VI+++GRPK++VE+K ETK+F+PEEISSMVL+KMKEIAEAYLGKTV +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRKHKKDI DNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE Q++++++KNSLESY++ MK+TVEDEKLK KIS+ D++KI++KC E I+WL+KNQ A K+EF++  KELEK+CNPI+ K+YQ
Sbjct:   12 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKHWPFNVISDSGRPKVQVEYKAETKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVAEFKRKHKKDIIDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 620          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Mouse
Match: Hspa8 (heat shock protein 8 [Source:MGI Symbol;Acc:MGI:105384])

HSP 1 Score: 1040.41 bits (2689), Expect = 0.000e+0
Identity = 531/609 (87.19%), Postives = 576/609 (94.58%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD++ VQSDMKHW F V+N+ GRPK++VE+KGETK+F+PEE+SSMVL KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE Q++++++KNSLESY++ MK+TVEDEKL+ KI++ D++KI++KC E I+WL+KNQ A K+EF++  KELEK+CNPI+ K+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Mouse
Match: Hspa2 (heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96243])

HSP 1 Score: 1001.5 bits (2588), Expect = 0.000e+0
Identity = 513/611 (83.96%), Postives = 561/611 (91.82%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKK--VGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NT+FDAKRLIGRKF++++VQSDMKHW F V++E G+PK++VE+KGE KTFFPEEISSMVL KMKEIAEAYLG  V+ AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   G E+NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMV+H  +EFKRKHKKDI  NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEG+DFYTSITRARFEELNADLFR TLEPVEKALRDAKLDK  I +IVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQ  VL+QVYEGERAMTKDNNLLGKF+L GIPPAPRGVPQIEVTFDIDANGILNV+A +K TGKENKITITNDKGRLSKDDI+RMV EAE+YK EDE  ++R+AAKN++ESY+Y +K TVEDEKL+ KISE D+ KI++KCQE I WL++NQ A KDE+++  KELE++CNPI++K+YQ
Sbjct:    5 GPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGEMKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNAVESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQ 615          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Mouse
Match: Hspa2 (heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96243])

HSP 1 Score: 1001.5 bits (2588), Expect = 0.000e+0
Identity = 513/611 (83.96%), Postives = 561/611 (91.82%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKK--VGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NT+FDAKRLIGRKF++++VQSDMKHW F V++E G+PK++VE+KGE KTFFPEEISSMVL KMKEIAEAYLG  V+ AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   G E+NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMV+H  +EFKRKHKKDI  NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEG+DFYTSITRARFEELNADLFR TLEPVEKALRDAKLDK  I +IVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQ  VL+QVYEGERAMTKDNNLLGKF+L GIPPAPRGVPQIEVTFDIDANGILNV+A +K TGKENKITITNDKGRLSKDDI+RMV EAE+YK EDE  ++R+AAKN++ESY+Y +K TVEDEKL+ KISE D+ KI++KCQE I WL++NQ A KDE+++  KELE++CNPI++K+YQ
Sbjct:    5 GPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGEMKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNAVESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQ 615          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Mouse
Match: Hspa1l (heat shock protein 1-like [Source:MGI Symbol;Acc:MGI:96231])

HSP 1 Score: 996.112 bits (2574), Expect = 0.000e+0
Identity = 520/642 (81.00%), Postives = 569/642 (88.63%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQXXXXXXXXXXXXXXXXXXHSGDDKQGPTVEEVD 2087
            G AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRKF++  VQSDMK W F VINE G+PK+ V +KGE K F+PEEISSMVL KMKE AEA+LG  V +AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK    ER+VLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+V+HF++EFKRKHKKDIS NKRAVRRLRTACERAKRTLSSS QANLEIDSLYEGIDFYTSITRARFEEL ADLFR TLEPVEK+LRDAK+DK  IHDIVLVGGSTRIPK+QKLLQD FNG++LNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVAPLSLG+ETAGGVMT LIKRN+TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMT+DNNLLG+F+L GIPPAPRGVPQIEVTFDIDANGILNV+A++K TGK NKITITNDKGRLSK++IERMV EAE+YK EDE Q+E+IAAKN+LESY++ MKS V DE LKDKISESD+KKI++KC E ++WLE NQ A KDEFD+  KELE +CNPI+ K+YQ          G+        G    GPT+EEVD
Sbjct:    6 GMAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVINEAGKPKVMVSYKGEKKAFYPEEISSMVLTKMKETAEAFLGHNVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGSHGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKSLRDAKMDKAKIHDIVLVGGSTRIPKVQKLLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTVLIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEGQREKIAAKNALESYAFNMKSAVGDEGLKDKISESDKKKILDKCNEVLSWLEANQLAEKDEFDHKRKELENMCNPIITKLYQSGCTGPTCTPGYT------PGRAATGPTIEEVD 641          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Mouse
Match: Hspa8 (heat shock protein 8 [Source:MGI Symbol;Acc:MGI:105384])

HSP 1 Score: 993.416 bits (2567), Expect = 0.000e+0
Identity = 514/609 (84.40%), Postives = 558/609 (91.63%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD++ VQSDMKHW F V+N+ GRPK++VE+KGETK+F+PEE+SSMVL KMKEIAEAYLGK                   ATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE Q++++++KNSLESY++ MK+TVEDEKL+ KI++ D++KI++KC E I+WL+KNQ A K+EF++  KELEK+CNPI+ K+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGK-------------------ATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 593          
BLAST of Heat shock cognate 71 kDa protein vs. UniProt/SwissProt
Match: sp|P63018|HSP7C_RAT (Heat shock cognate 71 kDa protein OS=Rattus norvegicus OX=10116 GN=Hspa8 PE=1 SV=1)

HSP 1 Score: 1040.41 bits (2689), Expect = 0.000e+0
Identity = 531/609 (87.19%), Postives = 576/609 (94.58%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD++ VQSDMKHW F V+N+ GRPK++VE+KGETK+F+PEE+SSMVL KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE Q++++++KNSLESY++ MK+TVEDEKL+ KI++ D++KI++KC E I+WL+KNQ A K+EF++  KELEK+CNPI+ K+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. UniProt/SwissProt
Match: sp|P63017|HSP7C_MOUSE (Heat shock cognate 71 kDa protein OS=Mus musculus OX=10090 GN=Hspa8 PE=1 SV=1)

HSP 1 Score: 1040.41 bits (2689), Expect = 0.000e+0
Identity = 531/609 (87.19%), Postives = 576/609 (94.58%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD++ VQSDMKHW F V+N+ GRPK++VE+KGETK+F+PEE+SSMVL KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE Q++++++KNSLESY++ MK+TVEDEKL+ KI++ D++KI++KC E I+WL+KNQ A K+EF++  KELEK+CNPI+ K+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. UniProt/SwissProt
Match: sp|Q5NVM9|HSP7C_PONAB (Heat shock cognate 71 kDa protein OS=Pongo abelii OX=9601 GN=HSPA8 PE=2 SV=2)

HSP 1 Score: 1039.25 bits (2686), Expect = 0.000e+0
Identity = 531/609 (87.19%), Postives = 575/609 (94.42%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD++ VQSDMKHW F V+N+ GRPK++VE+KGETK+F+PEE+SSMVL KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE Q++++++KNSLESY++ MK+TVEDEKL+ KI++ D++KI++KC E I WL+KNQ A K+EF++  KELEK+CNPI+ K+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLAKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. UniProt/SwissProt
Match: sp|Q71U34|HSP7C_SAGOE (Heat shock cognate 71 kDa protein OS=Saguinus oedipus OX=9490 GN=HSPA8 PE=2 SV=1)

HSP 1 Score: 1038.87 bits (2685), Expect = 0.000e+0
Identity = 531/609 (87.19%), Postives = 575/609 (94.42%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD++ VQSDMKHW F V+N+ GRPK++VE+KGETK+F+PEE+SSMVL KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE Q++++++KNSLESY++ MK+TVEDEKL+ KI++ D++KI++KC E I WL+KNQ A K+EF++  KELEK+CNPI+ K+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. UniProt/SwissProt
Match: sp|P11142|HSP7C_HUMAN (Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1)

HSP 1 Score: 1038.87 bits (2685), Expect = 0.000e+0
Identity = 531/609 (87.19%), Postives = 575/609 (94.42%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD++ VQSDMKHW F V+N+ GRPK++VE+KGETK+F+PEE+SSMVL KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKALRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK EDE Q++++++KNSLESY++ MK+TVEDEKL+ KI++ D++KI++KC E I WL+KNQ A K+EF++  KELEK+CNPI+ K+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. TrEMBL
Match: B0LVF7 (Heat shock protein 70 OS=Dugesia japonica OX=6161 GN=hsp70 PE=2 SV=1)

HSP 1 Score: 1064.29 bits (2751), Expect = 0.000e+0
Identity = 558/645 (86.51%), Postives = 599/645 (92.87%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQXXXXXXXXXXXXXXXXXXHSGDDK---QGPTVEEVD 2087
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+FD+++VQSDMKHWSFDV+ E GRPKI+V +KGE K FFPEEISSMVL+KMKE AE YLG+ V DAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+QEFKRKHKKDISDNKRAVRRLRTACERA+RTLSSSAQAN+EIDSLYEGIDFYTS+TRARFEELNADLFRSTLEPVEK+LRDAK+DK  IH+IVLVGGSTRIPKIQKLLQDLF+GKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSA+EK TGKENKITI+NDKGRLSKDDIERMVNEAEKYK++DE QK+R+AAKN+LES SYQMK+T+EDEKLKDK+SESDRK II+KC E I WL+ NQ A K+E+++H KELEK+CNPIM K YQ +GG  G   G  G   G  G      QGPT+EEVD
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRRFDDATVQSDMKHWSFDVVCEGGRPKIQVNYKGELKKFFPEEISSMVLLKMKETAEGYLGRPVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKHKKDISDNKRAVRRLRTACERARRTLSSSAQANIEIDSLYEGIDFYTSMTRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAIEKSTGKENKITISNDKGRLSKDDIERMVNEAEKYKQQDELQKDRVAAKNALESCSYQMKTTMEDEKLKDKLSESDRKTIIDKCSEVIGWLDHNQTAEKEEYEHHQKELEKVCNPIMTKFYQASGGMPGGFPGAAGGGPGAPGAHGTAGQGPTIEEVD 648          
BLAST of Heat shock cognate 71 kDa protein vs. TrEMBL
Match: A0A484DIC7 (Uncharacterized protein OS=Perca flavescens OX=8167 GN=EPR50_G00024460 PE=3 SV=1)

HSP 1 Score: 1055.05 bits (2727), Expect = 0.000e+0
Identity = 552/643 (85.85%), Postives = 592/643 (92.07%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQXXXXXXXXXXXXXXXXX-XHSGDDKQGPTVEEVD 2087
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA+NPNNTVFDAKRLIGR+FD+S VQSDMKHW F VIN+  RPK++VE+KGETKTF+PEEISSMVLIKMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRK+KKDI DNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEG+DFYTSITRARFEELNADLFR TLEPVEKALRDAK+DK  IHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQV+EGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK ED+ Q+E+++AKNSLESY++ MKSTVEDEKLKDKIS+ D++KI++KC E I+WL++NQ A KDEF++  KELEK+CNP+M K+YQ AGG  G   G     G    G    GPT+EEVD
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPNNTVFDAKRLIGRRFDDSVVQSDMKHWPFIVINDATRPKVQVEYKGETKTFYPEEISSMVLIKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFISEFKRKYKKDIGDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKSEDDVQREKVSAKNSLESYAFNMKSTVEDEKLKDKISDEDKRKIVDKCNEVISWLDRNQSAEKDEFEHQQKELEKVCNPVMTKLYQNAGGMPGGMPGGFPGAGDVPGGGASSGPTIEEVD 646          
BLAST of Heat shock cognate 71 kDa protein vs. TrEMBL
Match: A0A3B4Y452 (Uncharacterized protein OS=Seriola lalandi dorsalis OX=1841481 PE=3 SV=1)

HSP 1 Score: 1051.2 bits (2717), Expect = 0.000e+0
Identity = 537/610 (88.03%), Postives = 576/610 (94.43%), Query Frame = 3
Query:  159 SGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            +G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA+NP NTVFDAKRLIGR+FD++ VQSDMKHW F VIN+  RPK++VE+KGETKTF+PEEISSMVL+KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRK+KKDISDNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TLEPVEKALRDAK+DK  IHDIVLVGGSTRIPKIQKLLQD FNGK+LNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQV+EGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK ED+ Q+E++AAKN LESY++ MKSTVEDEKLKDKIS+ D++KI++KC E I+WL+KNQ A KDEF++  KELEK+CNPIM K+YQ
Sbjct:    4 NGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPTNTVFDAKRLIGRRFDDTVVQSDMKHWPFTVINDASRPKVKVEYKGETKTFYPEEISSMVLLKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFISEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLEPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKDLNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTTLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQREKVAAKNGLESYAFNMKSTVEDEKLKDKISDEDKQKILDKCNEVISWLDKNQSAEKDEFEHQQKELEKVCNPIMTKLYQ 613          
BLAST of Heat shock cognate 71 kDa protein vs. TrEMBL
Match: A0A3B4XNT5 (Uncharacterized protein OS=Seriola lalandi dorsalis OX=1841481 PE=3 SV=1)

HSP 1 Score: 1050.04 bits (2714), Expect = 0.000e+0
Identity = 537/609 (88.18%), Postives = 575/609 (94.42%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA+NP NTVFDAKRLIGR+FD++ VQSDMKHW F VIN+  RPK++VE+KGETKTF+PEEISSMVL+KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRK+KKDISDNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TLEPVEKALRDAK+DK  IHDIVLVGGSTRIPKIQKLLQD FNGK+LNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQV+EGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK ED+ Q+E++AAKN LESY++ MKSTVEDEKLKDKIS+ D++KI++KC E I+WL+KNQ A KDEF++  KELEK+CNPIM K+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPTNTVFDAKRLIGRRFDDTVVQSDMKHWPFTVINDASRPKVKVEYKGETKTFYPEEISSMVLLKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFISEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLEPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKDLNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTTLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQREKVAAKNGLESYAFNMKSTVEDEKLKDKISDEDKQKILDKCNEVISWLDKNQSAEKDEFEHQQKELEKVCNPIMTKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. TrEMBL
Match: A0A3B4TE88 (Uncharacterized protein OS=Seriola dumerili OX=41447 PE=3 SV=1)

HSP 1 Score: 1050.04 bits (2714), Expect = 0.000e+0
Identity = 536/610 (87.87%), Postives = 576/610 (94.43%), Query Frame = 3
Query:  159 SGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            +G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA+NP NTVFDAKRLIGR+FD++ VQSDMKHW F VIN+  RPK++VE+KGETKTF+PEEISSMVL+KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG+ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRK+KKDISDNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEGIDFYTSITRARFEELNADLFR TLEPVEKALRDAK+DK  IHDIVLVGGSTRIPKIQKLLQD FNGK+LNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQV+EGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK ED+ Q+E++AAKN LESY++ MKSTVEDEKLKDKIS+ D++KI++KC E I+WL+KNQ A KDEF++  KELEK+CNPIM K+YQ
Sbjct:    4 NGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPTNTVFDAKRLIGRRFDDTVVQSDMKHWPFTVINDASRPKVKVEYKGETKTFYPEEISSMVLLKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFISEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLEPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKDLNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTTLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQREKVAAKNGLESYAFNMKSTVEDEKLKDKISDEDKQKILDKCNEVISWLDKNQSAEKDEFEHQQKELEKVCNPIMTKLYQ 613          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Cavefish
Match: hspa8b (heat shock cognate 70 kDa protein-like [Source:NCBI gene;Acc:103047344])

HSP 1 Score: 1040.41 bits (2689), Expect = 0.000e+0
Identity = 530/609 (87.03%), Postives = 575/609 (94.42%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD++ VQSDMKHW F VIN++ RPK++VE+KGETK F+PEEISSMVL+KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG+ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRK+KKDISDNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEG+DFYTSITRARFEELNADLFR TL+PVEK+LRDAKLDK+ IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAIL+GDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSK++IERMV +AEKYK ED+ Q++++AAKN LESY++ MKSTVEDEKLK KIS+ D++KI++KC E I+WL+KNQ A KDEF++  KELEK+CNPI+ K+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFTVINDSTRPKVQVEYKGETKAFYPEEISSMVLVKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFISEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTILIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEEIERMVQDAEKYKAEDDVQRDKVAAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKDEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Cavefish
Match: hspa8 (heat shock cognate 71 kDa protein [Source:NCBI gene;Acc:103043364])

HSP 1 Score: 1036.94 bits (2680), Expect = 0.000e+0
Identity = 526/609 (86.37%), Postives = 573/609 (94.09%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NT+FDAKRLIGR+FD+  VQSDMKHW F VIN++ RPK++V++KGE K+F+PEEISSMVL+KMKEIAEAYLGKTV +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG+ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDISDNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEG+DFYTSITRARFEELNADLFR TL+PVEK+LRDAK+DK  IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGI+NVSA +K TGKENKITITNDKGRLSK+DIERMV EAEKYK ED+ Q++++++KNSLESY++ MKSTVEDEKLK KIS+ D++KI++KC E I+WL+KNQ A +DEF++  KELEK+CNPI+ K+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRRFDDGVVQSDMKHWPFTVINDSTRPKVQVDYKGEAKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAADKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSSKNSLESYAFNMKSTVEDEKLKGKISDEDKQKIMDKCNEVISWLDKNQTAERDEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Cavefish
Match: ENSAMXT00000004733.2 (pep primary_assembly:Astyanax_mexicanus-2.0:20:27541457:27560661:-1 gene:ENSAMXG00000004628.2 transcript:ENSAMXT00000004733.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1032.32 bits (2668), Expect = 0.000e+0
Identity = 523/609 (85.88%), Postives = 575/609 (94.42%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G A+GIDLGTTYSCVG+FQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NT+FDAKRLIGR+F+++ VQSDMKHW F VI++ GRPK+ VE+KGETK F+PEEISSMVL+KMKEIAEAYLGK++ +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG+ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRK+KKDISDNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEG+DFYTSITRARFEELNADLFR TL+PVEK+LRDAKLDK  IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMTALIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK ED+ Q++++++KNSLESY++ MKSTVED+KL+ KIS+ D++KI++KC E I+WL+KNQ A K+E+++  +ELEK+CNPI+ K+YQ
Sbjct:    4 GTAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRRFEDTVVQSDMKHWPFKVISDGGRPKVEVEYKGETKNFYPEEISSMVLVKMKEIAEAYLGKSINNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKLDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSSKNSLESYAFNMKSTVEDDKLQGKISDEDKQKILDKCNEIISWLDKNQTAEKEEYEHQQQELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Cavefish
Match: hsc70 (heat shock cognate 71 kDa protein-like [Source:NCBI gene;Acc:103045816])

HSP 1 Score: 1017.68 bits (2630), Expect = 0.000e+0
Identity = 516/609 (84.73%), Postives = 566/609 (92.94%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G A+GIDLGTTYSCVG+FQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGR+FD++ VQSDMKHW F V+++ G+PK+ VE+KGE KTF+PEE+SSMVL KMKEI+EAYLGK V +AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRK KKDI+ NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEG+DFYTSITRARFEELN+DLFR TL+PVEKALRDAKLDK  IHDIVLVGGSTRIPKIQKLLQD FNG++LNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNN+LGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EA++Y+ EDE Q+E++ +KN+LES ++ MKSTVEDEKLKDKIS  D+K I++KC E I WL++NQ A K+E+++  KELEK+CNPI+ K+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFDDAVVQSDMKHWPFKVVSDGGKPKMEVEYKGEIKTFYPEEVSSMVLTKMKEISEAYLGKPVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKFKKDITGNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNSDLFRGTLDPVEKALRDAKLDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEADQYRAEDEAQREKVTSKNTLESLAFNMKSTVEDEKLKDKISAEDKKTIVDKCNEVIAWLDRNQTAEKEEYEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Cavefish
Match: ENSAMXT00000037064.1 (heat shock 70 kDa protein [Source:NCBI gene;Acc:111193176])

HSP 1 Score: 1003.82 bits (2594), Expect = 0.000e+0
Identity = 521/642 (81.15%), Postives = 582/642 (90.65%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQXXXXXXXXXXXXXXXXXXHSGDDKQGPTVEEVD 2087
            G AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFD+  VQSDMKHW F V+++ G+PK++VE+KGE KTF PEEISSMVL+KMKEIAEAYLG+ V +AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK    ER+VLIFDLGGGTFDVSILTIEDGIFEVK+TAGDTHLGGEDFDNR+VNHF++EFKRKHKKDIS NKRA+RRLRTACERAKRTLSSS+QA++EIDSL+EG+DFYTSITRARFEE+ +DLFR TLEPVEKALRDAK+DK+ IH+IVLVGGSTRIPKIQKLLQD FNG++LNKSINPDEAVAYGAAVQAAIL GD S  VQDLLLLDVAPLSLGIETAGGVM  LIKRNTTIPTKQTQ F+TY+DNQPGVLIQV+EGERAMTKDNNLLGKF+L GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGK+NKITITNDKGRLSK++IERMV EA++YK ED+ Q+E+IAAKNSLES+++ MK++VEDE LK KISE D+KK+IEKC +AI+WLE NQ A K+EF++  KELEK+CNPI+ K+YQG   AGG       +    SG   QGPT+EEVD
Sbjct:    6 GVAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDDPVVQSDMKHWPFQVVSDGGKPKVQVEYKGEQKTFNPEEISSMVLVKMKEIAEAYLGQKVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGKKGERHVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLHEGVDFYTSITRARFEEMCSDLFRGTLEPVEKALRDAKMDKSQIHEIVLVGGSTRIPKIQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDTSGNVQDLLLLDVAPLSLGIETAGGVMATLIKRNTTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKQNKITITNDKGRLSKEEIERMVQEADQYKAEDDLQREKIAAKNSLESFAFNMKNSVEDENLKGKISEDDKKKVIEKCNQAISWLENNQLADKEEFEHQLKELEKVCNPIITKLYQGGMPAGGCGAQARAS----SGGSAQGPTIEEVD 643          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Sea Lamprey
Match: hspa5 (heat shock protein 5 [Source:NCBI gene;Acc:378848])

HSP 1 Score: 759.214 bits (1959), Expect = 0.000e+0
Identity = 399/611 (65.30%), Postives = 500/611 (81.83%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVE-FKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVED-EKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMY 1985
            G  IGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP NTVFDAKRLIGR + + +VQ D+K W F V+ + G+P I+VE   GE+KTF PEEIS+MVL KMKE AEAYLGK V  AVVTVPAYFND+QRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+L+FDLGGGTFDVS+LTI+ G+FEV +T GDTHLGGEDFD R++ HFI+ +K+K  KD+  + RAV++LR   E+AKRTLS+  QA ++I+S Y+G DF  ++TRA+FEELN DLFRST++PV+K + D+ L K  I +IVLVGGSTRIPKIQ+L+++LFNGKE ++ INPDEAVAYGAAVQA +LSG+ +    DL+LLDV PL+LGIET GGVMT LI RNT +PTK++QIF+T +DNQP V IQV+EGER MTKDN+LLGKF+L GIPPAPRGVPQIEVTF+ID NGIL VSA +KGTG +NKITITND+ RL+ ++IERMV++AE++  +D+  KER+ A+N LESY+Y +K+ + D EKL  K+S+ DR+ + +  ++ I WLE +Q+A  D+F    KELE++  PI++K+Y
Sbjct:   33 GTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTSNPENTVFDAKRLIGRSWTDPTVQHDIKFWPFTVLEKKGKPHIQVEVIAGESKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKEG-EKNILVFDLGGGTFDVSLLTIDHGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDHRAVQKLRREVEKAKRTLSTQHQARIDIESFYDGDDFSETLTRAKFEELNMDLFRSTMKPVQKVMEDSDLKKTDIDEIVLVGGSTRIPKIQQLVKELFNGKEPSRGINPDEAVAYGAAVQAGVLSGEDNTG--DLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTAADNQPTVTIQVFEGERPMTKDNHLLGKFDLTGIPPAPRGVPQIEVTFEIDVNGILRVSAEDKGTGNKNKITITNDQNRLTPEEIERMVSDAERFADDDKRVKERVEARNELESYAYSLKNQIGDKEKLGGKLSDEDRETVEKAVEDKIAWLEGHQEADTDDFKAQKKELEEVVQPIVSKLY 640          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Sea Lamprey
Match: hspa9 (heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030828-12])

HSP 1 Score: 536.954 bits (1382), Expect = 0.000e+0
Identity = 316/620 (50.97%), Postives = 431/620 (69.52%), Query Frame = 3
Query:  156 MSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGID------FYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKI---IEKCQEAITWLEKN------------QQASKDEFDYHYKEL 1949
            + G  IGIDLGTT SCV V +  + +++ N +G RTTPS VAFT D ERL+G  AK Q   NPNNT +  KRLIGR+FD+S VQ DM + S+ ++  +      VE  G  K + P +I + VL+KMKE AE ++G +VK+AV+TVPAYFNDSQRQATKDAG ISGLNVLR+INEPTAAA+AYGLDK    ++ + ++DLGGGTFD+SIL I+ G+FEVKST GDT LGGEDFDN ++ + ++EFKR+   D++ +  A++R+R A E+AK  LSSS Q ++ +   Y  +D          +TR++FE +  DL R T+ P +KAL+D ++ K+ I D++LVGG TR+PK+Q+ +Q++F G+  +K++NPDEAVA GAA+Q  +L+GD    V D+LLLDV PLSLGIET GGV T LI RNTTIPTK++Q+F+T +D Q  V I+V++GER M  DN  LG+F L G+PPAPRGVPQIEVTFDIDANGI++VSA +KGTG+E +I I +  G LSKD+IE MV  AEKY +ED  +K+R+ A N  E   + ++S +E+   KD++   +  K+   I K +E +T  +              QQ+S   F+  YK++
Sbjct:   51 IRGAVIGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRFDDSDVQKDMNNLSYKIVRAS-NGDAWVEAHG--KMYSPSQIGAFVLLKMKETAENFMGTSVKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--ADDKVIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDNALLKYIVKEFKRESGVDLTKDSMALQRVREAAEKAKCELSSSLQTDINLP--YLTMDSSGPKHLNMKLTRSQFENIVGDLIRKTIAPCQKALQDGEVAKSDIGDVILVGGMTRMPKVQQTVQEVF-GRAPSKAVNPDEAVAIGAAIQGGVLAGD----VTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVFQGEREMAGDNKNLGQFTLVGVPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGG-LSKDEIENMVKNAEKYAEEDRRRKDRVEAVNQAEGIVHDIESKMEE--FKDQLPADECTKLKEEIAKVRELLTRKDTETGEAIKQAASTLQQSSLKLFEMAYKKM 655          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Sea Lamprey
Match: hspa14 (heat shock protein 14 [Source:NCBI gene;Acc:565232])

HSP 1 Score: 285.034 bits (728), Expect = 3.889e-88
Identity = 168/505 (33.27%), Postives = 271/505 (53.66%), Query Frame = 3
Query:  168 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAER-NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKS-----EAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEG-ERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITI 1661
            A+G+ LG+T +CV +++ G+ ++IAND G+R TP+ VAF D+E+++G AAK     N   TV   KR++G +F++  VQ  +   S  VI + G P   +      K     E+++++L KMKE A   +G   KDAV+T P  F   Q    + A   +G NVLRI++EP AA +A+G+ ++    +  VL++ LGG     + + +  G++ V  +  D  +GGE+F   +  +   EF++ H++D+  N RA+ +L T  E AK  LS+ A +N  +DSL++G+DF  +ITRARF+ L + LF+ +L+P+   L    L  +    +VL GGS RIPK+Q+LLQ+ F G EL  SI  DE +A GAA +A IL G  +     EA+          +    E      T +    T +P ++   F       P VL+ VYEG  +  + +   L +  L  +     G+  I   F +  +G L ++  ++ +G    +T+
Sbjct:    3 AVGVHLGSTCACVAIYKDGRADVIANDAGDRVTPAMVAFRDSEKIVGLAAKQGRIRNATTTVVGVKRILGHRFEDDVVQKYISSSSCPVIEKDGCPVFSINNGTVKKHITRHEVATLILQKMKETALFAVGADAKDAVITTPLNFTTQQVDELRQAAESAGFNVLRILSEPAAALLAFGIGQESSHSKCKVLVYKLGGTCAYATAIEVNSGLYRVLGSVSDDTVGGEEFTEALAEYLATEFQKFHRQDLRGNSRAMMKLHTNAEMAKHVLSTMAISNCFVDSLHDGLDFECNITRARFDSLCSVLFQQSLQPIHDLLAQINLTTSDFQKVVLCGGSARIPKLQQLLQEQFVGSELMCSIPVDEVIALGAAAEAGILLGRDAVRFEPEALSIECASLDILVKEQDEAGQDCYTVVFPVGTPLPARRQHTFQA-PGTLPSVLVDVYEGVAKGSSFEGVHLAQLVLKDLQQQDNGLRDISTVFTMKRDGSLLITCTDQLSGTSETVTV 506          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Sea Lamprey
Match: hspa13 (heat shock protein 70 family, member 13 [Source:ZFIN;Acc:ZDB-GENE-070410-58])

HSP 1 Score: 247.284 bits (630), Expect = 2.983e-74
Identity = 154/422 (36.49%), Postives = 233/422 (55.21%), Query Frame = 3
Query:  171 IGIDLGTTYSCVGVFQHG--KVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVE-FKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKH---------------------KKDISDNKRAVRRLR----------TACERA------KRTLSSSAQAN-----LEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSG 1298
            +GIDLGTTY  +GV+  G  +VE++A+  G R  PS VA  +D   L G  A  Q A NP+ T++DAKR IGR F    ++ +   + F V   +G     +    G  +T  PE + + +L +++ +AE  LG  V+ AV+ VPA F++ QR +T  A  ++GL VLR++NEPTAAA+AYGL ++     +VL+ DLGGGT DVS+LT + G+F  ++ AG+ HLGG+DF  R+V H       +H                     K +++ N RA   LR            C         +R L +   A+     L++   +  ++   ++TR  FE LN DLF+  +EP+ + LR  +L    +  +VLVGGSTRIP+++++L D F G E + S++P+ AV  G AVQA +L+G
Sbjct:   34 VGIDLGTTYCSIGVYHAGVGEVEVLADADGRRAFPSVVAAGSDGRVLAGFPALQQAADNPHATLYDAKRFIGRAFSPGELEREAGRYQFTVRQVSGEVVFVLRGHGGAEQTVTPEWVGAQMLDQLRLLAEERLGLPVRYAVLAVPAEFDERQRNSTIKAATMAGLEVLRVVNEPTAAALAYGLHEEESVS-SVLVVDLGGGTTDVSLLTKQGGMFFTRAMAGNNHLGGQDFTQRLVEHLTGRLADRHGGGRPWGRADTQLLREAAEMAKLELTHNDRARVSLRLSLVFMPDNRPCCVHQETTVYIRRPLCTGGNAHVLFFGLKLKGTHNTVEMDETVTRQEFESLNEDLFQKVMEPIVEVLRSGRLVAKQVDRVVLVGGSTRIPRVRRMLADYF-GSEPDTSVDPELAVVTGVAVQAGVLAG 453          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003663.1 (pep scaffold:Pmarinus_7.0:GL498042:47:1690:1 gene:ENSPMAG00000003351.1 transcript:ENSPMAT00000003663.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 4.064e-6
Identity = 26/69 (37.68%), Postives = 38/69 (55.07%), Query Frame = 3
Query: 1047 RARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDE 1253
            R  FE+ +A LF   + PV + L+ A L  + +  I L+GG  RIPKIQ++L       +L   +N DE
Sbjct:    1 REEFEDASAHLFDRAITPVYEVLKRANLSIDEVDQIELLGGGIRIPKIQEMLIQTLQKNDLGVHLNGDE 69          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Yeast
Match: SSA1 (ATPase involved in protein folding and NLS-directed nuclear transport; member of HSP70 family; required for ubiquitin-dependent degradation of short-lived proteins; forms chaperone complex with Ydj1p; localized to nucleus, cytoplasm, cell wall; 98% identical to paralog Ssa2p with different functional specificity in propagation of yeast [URE3] prions, vacuolar-mediated degradations of gluconeogenesis enzymes; general targeting factor of Hsp104p to prion fibrils [Source:SGD;Acc:S000000004])

HSP 1 Score: 905.59 bits (2339), Expect = 0.000e+0
Identity = 480/642 (74.77%), Postives = 557/642 (86.76%), Query Frame = 3
Query:  168 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ--XXXXXXXXXXXXXXXXXXHSGDDKQGPTVEEVD 2087
            A+GIDLGTTYSCV  F + +V+IIANDQGNRTTPS+VAFTDTERLIGDAAKNQ AMNP+NTVFDAKRLIGR F++  VQ+DMKH+ F +I+  G+P+I+VEFKGETK F PE+ISSMVL KMKE AE+YLG  V DAVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK G E +VLIFDLGGGTFDVS+L+IEDGIFEVK+TAGDTHLGGEDFDNR+VNHFIQEFKRK+KKD+S N+RA+RRLRTACERAKRTLSSSAQ ++EIDSL+EGIDFYTSITRARFEEL ADLFRSTL+PVEK LRDAKLDK+ + +IVLVGGSTRIPK+QKL+ D FNGKE N+SINPDEAVAYGAAVQAAIL+GD+S   QDLLLLDVAPLSLGIETAGGVMT LI RN+TIPTK+++IF+TY+DNQPGVLIQV+EGERA TKDNNLLGKFEL+GIPPAPRGVPQIEVTFD+D+NGILNVSAVEKGTGK NKITITNDKGRLSK+DIE+MV EAEK+K+EDE + +RIA+KN LES +Y +K+T+ +    DK+ ++D+  + +K +E I+WL+ N  ASK+EFD   KEL+ + NPIM+K+YQ  GA G            G     + +GPTVEEVD
Sbjct:    4 AVGIDLGTTYSCVAHFANDRVDIIANDQGNRTTPSFVAFTDTERLIGDAAKNQAAMNPSNTVFDAKRLIGRNFNDPEVQADMKHFPFKLIDVDGKPQIQVEFKGETKNFTPEQISSMVLGKMKETAESYLGAKVNDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKK-GKEEHVLIFDLGGGTFDVSLLSIEDGIFEVKATAGDTHLGGEDFDNRLVNHFIQEFKRKNKKDLSTNQRALRRLRTACERAKRTLSSSAQTSVEIDSLFEGIDFYTSITRARFEELCADLFRSTLDPVEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVTDYFNGKEPNRSINPDEAVAYGAAVQAAILTGDESSKTQDLLLLDVAPLSLGIETAGGVMTKLIPRNSTIPTKKSEIFSTYADNQPGVLIQVFEGERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLSKEDIEKMVAEAEKFKEEDEKESQRIASKNQLESIAYSLKNTISEA--GDKLEQADKDTVTKKAEETISWLDSNTTASKEEFDDKLKELQDIANPIMSKLYQAGGAPGGAAGGAPGGFPGGAPPAPEAEGPTVEEVD 642          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Yeast
Match: SSA2 (HSP70 family ATP-binding protein; involved in protein folding, vacuolar import of proteins; required for ubiquitin-dependent degradation of short-lived proteins; associated with chaperonin-containing T-complex; 98% identical to paralog Ssa1p with distinct functional specificity in propagation of yeast [URE3] prions and vacuolar-mediated degradation of gluconeogenesis enzymes; binds tRNA, has role in tRNA nuclear import during starvation [Source:SGD;Acc:S000003947])

HSP 1 Score: 902.508 bits (2331), Expect = 0.000e+0
Identity = 476/640 (74.38%), Postives = 554/640 (86.56%), Query Frame = 3
Query:  168 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQXXXXXXXXXXXXXXXXXXHSGDDKQGPTVEEVD 2087
            A+GIDLGTTYSCV  F + +V+IIANDQGNRTTPS+V FTDTERLIGDAAKNQ AMNP NTVFDAKRLIGR F++  VQ DMKH+ F +I+  G+P+I+VEFKGETK F PE+ISSMVL KMKE AE+YLG  V DAVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK G E +VLIFDLGGGTFDVS+L+IEDGIFEVK+TAGDTHLGGEDFDNR+VNHFIQEFKRK+KKD+S N+RA+RRLRTACERAKRTLSSSAQ ++EIDSL+EGIDFYTSITRARFEEL ADLFRSTL+PVEK LRDAKLDK+ + +IVLVGGSTRIPK+QKL+ D FNGKE N+SINPDEAVAYGAAVQAAIL+GD+S   QDLLLLDVAPLSLGIETAGGVMT LI RN+TIPTK++++F+TY+DNQPGVLIQV+EGERA TKDNNLLGKFEL+GIPPAPRGVPQIEVTFD+D+NGILNVSAVEKGTGK NKITITNDKGRLSK+DIE+MV EAEK+K+EDE + +RIA+KN LES +Y +K+T+ +    DK+ ++D+  + +K +E I WL+ N  A+K+EFD   KEL+++ NPIM+K+YQ  G   G   G        +  + +GPTVEEVD
Sbjct:    4 AVGIDLGTTYSCVAHFSNDRVDIIANDQGNRTTPSFVGFTDTERLIGDAAKNQAAMNPANTVFDAKRLIGRNFNDPEVQGDMKHFPFKLIDVDGKPQIQVEFKGETKNFTPEQISSMVLGKMKETAESYLGAKVNDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKK-GKEEHVLIFDLGGGTFDVSLLSIEDGIFEVKATAGDTHLGGEDFDNRLVNHFIQEFKRKNKKDLSTNQRALRRLRTACERAKRTLSSSAQTSVEIDSLFEGIDFYTSITRARFEELCADLFRSTLDPVEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVTDYFNGKEPNRSINPDEAVAYGAAVQAAILTGDESSKTQDLLLLDVAPLSLGIETAGGVMTKLIPRNSTIPTKKSEVFSTYADNQPGVLIQVFEGERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLSKEDIEKMVAEAEKFKEEDEKESQRIASKNQLESIAYSLKNTISEA--GDKLEQADKDAVTKKAEETIAWLDSNTTATKEEFDDQLKELQEVANPIMSKLYQAGGAPEGAAPGGFPGGAPPA-PEAEGPTVEEVD 639          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Yeast
Match: SSA4 (Heat shock protein that is highly induced upon stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the HSP70 family; cytoplasmic protein that concentrates in nuclei upon starvation; SSA4 has a paralog, SSA3, that arose from the whole genome duplication [Source:SGD;Acc:S000000905])

HSP 1 Score: 888.641 bits (2295), Expect = 0.000e+0
Identity = 470/640 (73.44%), Postives = 546/640 (85.31%), Query Frame = 3
Query:  168 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQXXXXXXXXXXXXXXXXXXHSGDDKQGPTVEEVD 2087
            A+GIDLGTTYSCV  F + +VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ AMNP+NTVFDAKRLIGRKFD+  V +D KH+ F VI++ G+P ++VE+KGETKTF PEEISSM+L KMKE AE +LG  VKDAVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   E NVLIFDLGGGTFDVS+L+I++G+FEVK+TAGDTHLGGEDFD+R+VN   +EFKRK+KKD++ N+R++RRLRTA ERAKRTLSSSAQ ++EIDSL+EGIDFYTSITRARFEEL ADLFRSTLEPVEK L D+KLDK+ I +IVLVGGSTRIPK+QKL+ D FNGKE N+SINPDEAVAYGAAVQAAIL+GD+S   QDLLLLDVAPLSLGIETAGG+MT LI RN+TIPTK++++F+TY+DNQPGVLIQV+EGER  TKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGK NKITITNDKGRLSK+DI++MV EAEK+K EDE + +R+ AKN LESY++ +K++V +   K+K+ E D +K+    Q+AI WL+ +Q AS +E+    KELE + NPIM+K Y  AGGA G         G     D  GPTVEEVD
Sbjct:    4 AVGIDLGTTYSCVAHFANDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQAAMNPHNTVFDAKRLIGRKFDDPEVTNDAKHYPFKVIDKGGKPVVQVEYKGETKTFTPEEISSMILTKMKETAENFLGTEVKDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKSQKEHNVLIFDLGGGTFDVSLLSIDEGVFEVKATAGDTHLGGEDFDSRLVNFLAEEFKRKNKKDLTTNQRSLRRLRTAAERAKRTLSSSAQTSIEIDSLFEGIDFYTSITRARFEELCADLFRSTLEPVEKVLADSKLDKSQIDEIVLVGGSTRIPKVQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILTGDQSSTTQDLLLLDVAPLSLGIETAGGIMTKLIPRNSTIPTKKSEVFSTYADNQPGVLIQVFEGERTRTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKSNKITITNDKGRLSKEDIDKMVAEAEKFKAEDEQEAQRVQAKNQLESYAFTLKNSVSENNFKEKVGEEDARKLEAAAQDAINWLDASQAASTEEYKERQKELEGVANPIMSKFYGAAGGAPGAGPVPGAGAGPTGAPD-NGPTVEEVD 642          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Yeast
Match: SSA3 (ATPase involved in protein folding and the response to stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the heat shock protein 70 (HSP70) family; localized to the cytoplasm; SSA3 has a paralog, SSA4, that arose from the whole genome duplication [Source:SGD;Acc:S000000171])

HSP 1 Score: 888.641 bits (2295), Expect = 0.000e+0
Identity = 472/646 (73.07%), Postives = 544/646 (84.21%), Query Frame = 3
Query:  168 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQXXXXXXXXXXX------XXXXXXXHSGDDKQGPTVEEVD 2087
            A+GIDLGTTYSCV  F + +VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ A+NP+NTVFDAKRLIGRKFD+  V +D KH+ F VI+  G+P ++VE+KGETKTF PEEISSMVL KMKE AE YLG TV DAVVTVPAYFNDSQRQATKDAG I+G+NVLRIINEPTAAAIAYGLDKK  AE NVLIFDLGGGTFDVS+L+I++G+FEVK+TAGDTHLGGEDFDNR+VNH   EFKRK KKDIS+N+R++RRLRTA ERAKR LSSS+Q ++EIDSL+EG+DFYTS+TRARFEEL ADLFRSTLEPVEK L+D+KLDK+ I +IVLVGGSTRIPKIQKL+ D FNGKE N+SINPDEAVAYGAAVQAAIL+GD+S   QDLLLLDVAPLSLGIETAGG+MT LI RN+TIPTK+++ F+TY+DNQPGVLIQV+EGER  TKDNNLLGKFEL+GIPPAPRGVPQI+VTFDIDANGILNVSA+EKGTGK NKITITNDKGRLSKDDI+RMV+EAEKY+ +DE + ER+ AKN LESY++ +K+T+ +   K+K+ E D K++    QE I WL+ +Q AS DE+    KELE + NPIM K Y    GAG   G            G   G +  GPTVEEVD
Sbjct:    4 AVGIDLGTTYSCVAHFSNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQAAINPHNTVFDAKRLIGRKFDDPEVTTDAKHFPFKVISRDGKPVVQVEYKGETKTFTPEEISSMVLSKMKETAENYLGTTVNDAVVTVPAYFNDSQRQATKDAGTIAGMNVLRIINEPTAAAIAYGLDKKGRAEHNVLIFDLGGGTFDVSLLSIDEGVFEVKATAGDTHLGGEDFDNRLVNHLATEFKRKTKKDISNNQRSLRRLRTAAERAKRALSSSSQTSIEIDSLFEGMDFYTSLTRARFEELCADLFRSTLEPVEKVLKDSKLDKSQIDEIVLVGGSTRIPKIQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILTGDQSTKTQDLLLLDVAPLSLGIETAGGIMTKLIPRNSTIPTKKSETFSTYADNQPGVLIQVFEGERTRTKDNNLLGKFELSGIPPAPRGVPQIDVTFDIDANGILNVSALEKGTGKSNKITITNDKGRLSKDDIDRMVSEAEKYRADDEREAERVQAKNQLESYAFTLKNTINEASFKEKVGEDDAKRLETASQETIDWLDASQAASTDEYKDRQKELEGIANPIMTKFYGAGAGAGPGAGESGGFPGSMPNSGATGGGEDTGPTVEEVD 649          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Yeast
Match: KAR2 (ATPase involved in protein import into the ER; also acts as a chaperone to mediate protein folding in the ER and may play a role in ER export of soluble proteins; regulates the unfolded protein response via interaction with Ire1p [Source:SGD;Acc:S000003571])

HSP 1 Score: 737.258 bits (1902), Expect = 0.000e+0
Identity = 381/627 (60.77%), Postives = 492/627 (78.47%), Query Frame = 3
Query:  108 NFENNCTILRF*KIFQMSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKN-QQASKDEFDYHYKELEKLCNPIMAKMY 1985
            +F ++  ++R     +  G  IGIDLGTTYSCV V ++GK EI+AN+QGNR TPSYVAFTD ERLIGDAAKNQVA NP NT+FD KRLIG K+++ SVQ D+KH  F+V+N+ G+P + V  KGE K F PEEIS M+L KMK+IAE YLG  V  AVVTVPAYFND+QRQATKDAG I+GLNVLRI+NEPTAAAIAYGLDK    E  ++++DLGGGTFDVS+L+IE+G+FEV++T+GDTHLGGEDFD ++V   I+ FK+KH  D+SDN +A+ +L+   E+AKR LSS     +EIDS  +GID   ++TRA+FEELN DLF+ TL+PVEK L+D+ L+K  + DIVLVGGSTRIPK+Q+LL+  F+GK+ +K INPDEAVAYGAAVQA +LSG+  E V+D++LLDV  L+LGIET GGVMT LIKRNT IPTK++QIF+T  DNQP V+I+VYEGERAM+KDNNLLGKFEL GIPPAPRGVPQIEVTF +DANGIL VSA +KGTGK   ITITNDKGRL++++I+RMV EAEK+  ED   K ++ ++N LE+Y++ +K+ V  + L +K+ E D++ +++   + + WL+ N + A  ++FD  ++ L K+  PI +K+Y
Sbjct:   32 SFHSSNVLVRGADDVENYGTVIGIDLGTTYSCVAVMKNGKTEILANEQGNRITPSYVAFTDDERLIGDAAKNQVAANPQNTIFDIKRLIGLKYNDRSVQKDIKHLPFNVVNKDGKPAVEVSVKGEKKVFTPEEISGMILGKMKQIAEDYLGTKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIVNEPTAAAIAYGLDKS-DKEHQIIVYDLGGGTFDVSLLSIENGVFEVQATSGDTHLGGEDFDYKIVRQLIKAFKKKHGIDVSDNNKALAKLKREAEKAKRALSSQMSTRIEIDSFVDGIDLSETLTRAKFEELNLDLFKKTLKPVEKVLQDSGLEKKDVDDIVLVGGSTRIPKVQQLLESYFDGKKASKGINPDEAVAYGAAVQAGVLSGE--EGVEDIVLLDVNALTLGIETTGGVMTPLIKRNTAIPTKKSQIFSTAVDNQPTVMIKVYEGERAMSKDNNLLGKFELTGIPPAPRGVPQIEVTFALDANGILKVSATDKGTGKSESITITNDKGRLTQEEIDRMVEEAEKFASEDASIKAKVESRNKLENYAHSLKNQVNGD-LGEKLEEEDKETLLDAANDVLEWLDDNFETAIAEDFDEKFESLSKVAYPITSKLY 654          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Nematostella
Match: EDO37280 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG65])

HSP 1 Score: 983.015 bits (2540), Expect = 0.000e+0
Identity = 504/609 (82.76%), Postives = 556/609 (91.30%), Query Frame = 3
Query:  168 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLD--KNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF+DTERLIGDAAKNQVAMNP NTVFDAKRLIGRKFD+  V  DM HW F VI E  RPKI+VEFKGE K+FFPEEISSMVL KMKE AEAYLG  V DAVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVG ERNVLI+DLGGGTFDVS+LTIEDGIFEVKSTAGDTHLGGEDFDN+MV+HF+++FK+K+KKDI+ NKRA+RRLRTACERAKRTLSSS QA++EIDSL+EGIDFYTSITRARFEELN DLF+ T EPVE+A+RD+K+   K +IHDIVLVGGSTRIPKIQK+LQ+LF GKELNKSINPDEAVAYGAAVQAAIL GDK + V+DLLLLDVAPLS+GIETAGGVM+ LIKRN+TIPTKQTQ FTTYSDNQPGVLIQV+EGER+MT  NNLLGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMVNEA KYK+EDE Q++RI  KNSLESY+Y MKSTVED+K+KDKISE D+K I++KC E + WL+ NQ A KDEF+YH KELEK+CNPI+ K+YQ
Sbjct:    6 AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFSDTERLIGDAAKNQVAMNPENTVFDAKRLIGRKFDDPVVARDMTHWPFHVIREGERPKIQVEFKGEKKSFFPEEISSMVLTKMKETAEAYLGAKVTDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGVERNVLIYDLGGGTFDVSVLTIEDGIFEVKSTAGDTHLGGEDFDNKMVDHFVKQFKQKYKKDITPNKRAMRRLRTACERAKRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELNQDLFKKTTEPVEQAIRDSKIPGGKESIHDIVLVGGSTRIPKIQKMLQELFGGKELNKSINPDEAVAYGAAVQAAILHGDKDDTVKDLLLLDVAPLSMGIETAGGVMSVLIKRNSTIPTKQTQTFTTYSDNQPGVLIQVFEGERSMTAHNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVNEASKYKEEDEKQRDRIQTKNSLESYAYSMKSTVEDDKVKDKISEEDKKAILDKCTEVLKWLDTNQTAEKDEFEYHQKELEKVCNPIITKLYQ 614          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Nematostella
Match: EDO30323 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T144])

HSP 1 Score: 968.763 bits (2503), Expect = 0.000e+0
Identity = 494/608 (81.25%), Postives = 554/608 (91.12%), Query Frame = 3
Query:  168 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLD-KNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD ERL+GDAAKNQVAMNP NT+FDAKRLIGR+FD+  V+ DMKHWSF+V+NE GRPK++VE+KGETKTFF EEISSMVL KMKE AEAYLG  V DAVVTVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVS+L+IEDGIFEVKST GDTHLGGEDFDN MV+ F+++FK+K+KKDI+ NKRA+RRLRTACERAKRTLSSS QA++EIDSLY+GIDFYTSITRARFEE+NA LF+ TLEPVEKA++D+KL+ K  I +IV+VGGSTRIPKIQ LLQ+ FNGKELNKSINPDEAVAYGAAVQAAIL GDKSEA QDLLLLDVAPL+LG+ETAGGVMTA IKRNTTIPTKQTQ FTTYSDNQ  VLIQVYEGER++TKDNNLLGKFEL+GIPPAPRGVPQI+VTFD+D+NGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEK+K  DE  +ERI +KNSLESY++ MKST+EDEK+KDK+SE +R+K+I +C+  + WLE NQ A K+E D H KELE +CNPI+ K+YQ
Sbjct:    6 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDEERLVGDAAKNQVAMNPTNTIFDAKRLIGRRFDDPGVKDDMKHWSFEVVNEAGRPKVKVEYKGETKTFFAEEISSMVLNKMKETAEAYLGCKVTDAVVTVPAYFNDSQRQATKDAGVISGLNVLRIINEPTAAAIAYGLDKKVGQERNVLIFDLGGGTFDVSVLSIEDGIFEVKSTHGDTHLGGEDFDNNMVDFFVKQFKQKYKKDITPNKRALRRLRTACERAKRTLSSSTQASIEIDSLYDGIDFYTSITRARFEEMNAHLFKKTLEPVEKAIKDSKLESKEKIDEIVMVGGSTRIPKIQSLLQNFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEATQDLLLLDVAPLTLGLETAGGVMTAAIKRNTTIPTKQTQTFTTYSDNQTSVLIQVYEGERSLTKDNNLLGKFELSGIPPAPRGVPQIDVTFDVDSNGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVKEAEKFKAADEAVRERIQSKNSLESYAFSMKSTMEDEKVKDKLSEDEREKVISRCKATLDWLEHNQSAEKEEIDAHQKELEGVCNPIITKLYQ 613          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Nematostella
Match: EDO44530 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV88])

HSP 1 Score: 867.455 bits (2240), Expect = 0.000e+0
Identity = 460/641 (71.76%), Postives = 546/641 (85.18%), Query Frame = 3
Query:  168 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDG-IFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQXXXXXXXXXXXXXXXXXXHSGDDKQGPTVEEVD 2087
            AIGIDLGTTYSCVGVFQ+GKVEIIANDQGNRTTPSYV FTDTERL+GDAAKNQVA+NP NT+FDAKRLIGR++D+++VQSDMK W F +I++  +PKI+VE+KGE KTF  EEISSMVL KMKE AEAYLG+ V  AV+TVPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYGLDK +  E+NVLIFDLGGGTFDVSILTI+DG +FEVKSTAGDTHLGGEDFDNR+VNHF+ EFKRK+KKD+S N RA+RRLRTACERAKRTLSSS +A++E+DSL+EGIDFYT I+RARFE+L +DLF S L+PV KAL DAK  K+ IH++VLVGGSTR+PKIQK+L++ F+GK LNKSINPDEAVAYGAAVQAAILSGDKS+ V+D+LL+DVAPLSLGIETAG VMT LI+RN  IPTK TQ FTTYSDNQP V I+V+EGER +TK NNLLGKF+L+GIPPAPRGVPQIEVTFDIDANGILNVSA +K TGK   ITITNDKGRLSK++I+RM+N+AEKYK EDE Q+E+IAA+N LESY++ +KS + +  L+ K+S+SD+  +  K +E + WLEKN  A K+EF+   KEL+++C+PIMAK++      GG  G          G    GPT+EEVD
Sbjct:    6 AIGIDLGTTYSCVGVFQNGKVEIIANDQGNRTTPSYVGFTDTERLVGDAAKNQVALNPENTIFDAKRLIGRRYDDATVQSDMKLWPFKIISDNNKPKIQVEYKGERKTFAAEEISSMVLGKMKETAEAYLGQKVTSAVITVPAYFNDSQRQATKDAGTIAGLNVLRVINEPTAAALAYGLDKSLSGEKNVLIFDLGGGTFDVSILTIDDGSLFEVKSTAGDTHLGGEDFDNRLVNHFVAEFKRKYKKDMSKNSRAMRRLRTACERAKRTLSSSTEASIEVDSLFEGIDFYTKISRARFEDLCSDLFLSCLDPVNKALSDAKFSKSDIHEVVLVGGSTRVPKIQKMLEEYFSGKSLNKSINPDEAVAYGAAVQAAILSGDKSDEVKDVLLVDVAPLSLGIETAGEVMTKLIERNARIPTKATQTFTTYSDNQPAVTIRVFEGERPLTKHNNLLGKFDLSGIPPAPRGVPQIEVTFDIDANGILNVSAKDKSTGKTGSITITNDKGRLSKEEIDRMINDAEKYKSEDEAQREKIAARNRLESYAFGVKSAISEPSLEGKLSQSDKDTVKNKVEEVLNWLEKNSLAEKEEFEEQEKELQRVCSPIMAKVH------GGSGGTQMPGQTAGHGQSAGGPTIEEVD 640          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Nematostella
Match: EDO33296 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL5])

HSP 1 Score: 741.495 bits (1913), Expect = 0.000e+0
Identity = 397/610 (65.08%), Postives = 496/610 (81.31%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVED-EKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMY 1985
            G  IGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT+  ERLIGD AKNQ+  NP NTVFDAKRLIGR +D++SVQ+D+K + F V+++  +P ++V+ K E KTF  EEIS+MVL KMKE AEAYLGK V  AVVTVPAYFND+QRQATKDAGAI+GL V+RIINEPTAAAIAYG+DKK G E+N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD  ++ HFI+ +K+K  K+I  + RAV++LR   E+AKR LS+  QA +EI+S +EG DF   +TRARFEELNA LF+STL+PV+K L DA L K+ IH+IVLVGGSTRIPK+Q+L++D F GKE ++ INPDEAVAYGAAVQA +L G+  E   +++LLDV PL+LGIET GGVMT LI RNT IPTK++Q+F+T +DNQ  V IQV+EGER MTKDN+ LGKF+L GIPPAPRGVPQIEVTF+ID NGIL VSA +KGTG + KITITND+ RL+ +DIERMVN+AEK+  ED+  KE++ A+N LESY+Y +K+ V D EKL  K+SE D+K I E  ++AI+W++KNQ AS ++F    KELE +  PI++K+Y
Sbjct:   33 GTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTEEGERLIGDGAKNQLTTNPENTVFDAKRLIGRSWDDTSVQNDLKFFPFKVVDKNKKPHVQVKVKDEIKTFAAEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGAIAGLTVMRIINEPTAAAIAYGMDKKEG-EKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQNVMEHFIKLYKKKKGKNIRKDNRAVQKLRREVEKAKRALSTQHQARVEIESFFEGEDFSEMLTRARFEELNAKLFKSTLKPVQKVLEDADLKKSEIHEIVLVGGSTRIPKVQQLVKDFFEGKEPSRGINPDEAVAYGAAVQAGVLGGE--EDTGEVVLLDVNPLTLGIETVGGVMTKLISRNTVIPTKKSQVFSTAADNQNTVTIQVFEGERPMTKDNHPLGKFDLNGIPPAPRGVPQIEVTFEIDVNGILRVSAEDKGTGNKEKITITNDQNRLTPEDIERMVNDAEKFADEDKKTKEKVEARNELESYAYSLKNQVGDKEKLGGKLSEDDKKTITEAVEKAISWMDKNQDASVEDFKKEKKELEDVVQPIVSKLY 639          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Nematostella
Match: EDO47723 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLN7])

HSP 1 Score: 522.702 bits (1345), Expect = 7.708e-178
Identity = 303/605 (50.08%), Postives = 418/605 (69.09%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGID------FYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEK 1955
            G   GIDLGTT SCV V      ++I N +G+RTTPS VAFT + ERL+G  A+ Q   NP NT++  KR IGR+FD   ++ D+K+ S+ ++  +        F+   K + P ++ + VL+KMKE AE+YLG  V +AVVTVPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYG+DK    ++ + ++DLGGGTFD+SIL I+ G+FEVK+T GDT+LGGEDFDN ++   I EFK++   D+S +  A++RLR A E+AK  LSSS Q ++ +   Y  +D          ++R++FE L ADL   T+ P +K L+DA+++K  I D++LVGG TR+PK+Q+ +QD+F G+  +K++NPDEAVA GAA+Q  +L+GD    V+D+LLLDV PLSLGIET GGV T LI RNTTIPTK++Q+F+T +D Q  V I+V++GER M  DN LLG+F+L GIPPAPRGVPQ+EVTFDIDANGI+NVSA +KGTG+E +I I +  G LSKD IE M+ EAEKY + D+ +KE   A N  E   +  ++ +E+   KD++   + +K+ E+  +    L      + +     Y EL++
Sbjct:   12 GAVCGIDLGTTNSCVAVMDGKTPKVIENAEGSRTTPSVVAFTPEGERLVGAPARRQAITNPQNTLYATKRYIGRRFDAPEIKKDLKNVSYKIVRASNG---DAWFEVAGKVYSPSQVGAFVLMKMKETAESYLGTNVNNAVVTVPAYFNDSQRQATKDAGQIAGLNVLRVINEPTAAALAYGMDKT--EDKIIAVYDLGGGTFDISILEIQKGVFEVKATNGDTYLGGEDFDNTLLKFLIAEFKKESGVDLSKDSMALQRLREAAEKAKIELSSSVQTDINLP--YITVDASGPKHLNMKLSRSKFESLVADLINRTVGPCKKCLQDAEINKGEIGDVLLVGGMTRMPKVQQTVQDIF-GRVPSKAVNPDEAVAIGAAIQGGVLAGD----VKDVLLLDVTPLSLGIETLGGVFTKLITRNTTIPTKKSQVFSTAADGQTQVEIKVFQGEREMAIDNKLLGQFQLVGIPPAPRGVPQVEVTFDIDANGIVNVSARDKGTGREQQIVIQSSGG-LSKDAIENMIKEAEKYAEADKQKKETTEAVNQAEGMIHDTETKMEE--FKDQLPSEEVEKLKEEIAKVREVLANKDNETGETIRQAYSELQQ 601          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Medaka
Match: hspa8b (heat shock cognate 70 kDa protein [Source:NCBI gene;Acc:100125490])

HSP 1 Score: 1045.42 bits (2702), Expect = 0.000e+0
Identity = 534/609 (87.68%), Postives = 575/609 (94.42%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA+NPNNTVFDAKRLIGR+FD+S VQSDMKHW F VIN+  RPK++VE+KGETKTF+PEEISSMVL+KMKEIAEAYLGKTV +AVVTVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRK+KKDISDNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEG+DFYTSITRARFEELNADLFR TL+PVEKALRDAK+DK  IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTY+DNQPGVLIQV+EGERAMTKDNNLLGKF+L GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK ED+ Q+E+++AKN LESY++ MKSTVE+EKLKDKISE DRKKI++KC E I+WL++NQ A K+EF++  KELEK+CNPIM K+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPNNTVFDAKRLIGRRFDDSVVQSDMKHWPFTVINDNTRPKVKVEYKGETKTFYPEEISSMVLVKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFISEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILCGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYADNQPGVLIQVFEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQREKVSAKNGLESYAFNMKSTVEEEKLKDKISEDDRKKILDKCNEVISWLDRNQSAEKEEFEHQQKELEKVCNPIMTKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Medaka
Match: hsc70 (heat shock protein 70 cognate [Source:NCBI gene;Acc:100049425])

HSP 1 Score: 1032.32 bits (2668), Expect = 0.000e+0
Identity = 526/608 (86.51%), Postives = 571/608 (93.91%), Query Frame = 3
Query:  165 NAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            + IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD+  VQSDMKHW F+VIN+  RPK++VE+KGETK+F+PEEISSMVL KMKEIAEAYLGKTV +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG+ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRK+KKDISDNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEG+DFYTSITRARFEELNADLFR TL+PVEK+LRDAK+DK  IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK ED+ Q+++++AKN LESY++ MKSTVEDEKL  KIS+ D++KI++KC E I+WL+KNQ A +DE+++  KELEK+CNPI+ K+YQ
Sbjct:    2 DTIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDHVVQSDMKHWPFNVINDNTRPKVQVEYKGETKSFYPEEISSMVLTKMKEIAEAYLGKTVNNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKMDKGQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLAGKISDEDKQKILDKCNEVISWLDKNQTAERDEYEHQQKELEKVCNPIITKLYQ 609          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Medaka
Match: hsc70 (heat shock protein 70 cognate [Source:NCBI gene;Acc:100049425])

HSP 1 Score: 1031.55 bits (2666), Expect = 0.000e+0
Identity = 527/609 (86.54%), Postives = 572/609 (93.92%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FD+  VQSDMKHW F+VIN+  RPK++VE+KGETK+F+PEEISSMVL KMKEIAEAYLGKTV +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG+ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRK+KKDISDNKRAVRRLRTACERAKRTLSSS QA++EIDSLYEG+DFYTSITRARFEELNADLFR TL+PVEK+LRDAK+DK  IHDIVLVGGSTRIPKIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFEL GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSK+DIERMV EAEKYK ED+ Q+++++AKN LESY++ MKSTVEDEKL  KIS+ D++KI++KC E I+WL+KNQ A +DE+++  KELEK+CNPI+ K+YQ
Sbjct:   54 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDHVVQSDMKHWPFNVINDNTRPKVQVEYKGETKSFYPEEISSMVLTKMKEIAEAYLGKTVNNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKMDKGQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLAGKISDEDKQKILDKCNEVISWLDKNQTAERDEYEHQQKELEKVCNPIITKLYQ 662          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Medaka
Match: hsp70-3 (heat shock protein 70 [Source:NCBI gene;Acc:100125493])

HSP 1 Score: 1021.54 bits (2640), Expect = 0.000e+0
Identity = 517/609 (84.89%), Postives = 569/609 (93.43%), Query Frame = 3
Query:  162 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            G A+GIDLGTTYSCVG+FQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRKFD++ VQSDMKHW F V+N++ +PK+ VE+KGE KTF+PEEISSMVL KMKEI+EAYLGK+V +AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVK+TAGDTHLGGEDFDNRMVNHFI EFKRK KK+I++NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEG DFYTSITRARFEELNADLFR T+EPVEKALRDAK+DK+ IHD+VLVGGSTRIPKIQKLLQDLFNG++LNKSINPDEAVAYGAAVQAAIL+GDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNN+LGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAE++K EDE Q+++I AKNSLES ++ MKSTV+DEKL+DKIS  D+K I++KC E I WL+KNQ A KDE+++  KELEK+CNPI++K+YQ
Sbjct:    4 GPAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPANTVFDAKRLIGRKFDDAVVQSDMKHWPFKVVNDSSKPKVEVEYKGEIKTFYPEEISSMVLTKMKEISEAYLGKSVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVNHFITEFKRKFKKEITNNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGTDFYTSITRARFEELNADLFRGTIEPVEKALRDAKMDKSQIHDVVLVGGSTRIPKIQKLLQDLFNGRDLNKSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEQFKAEDESQRDKITAKNSLESLAFNMKSTVDDEKLQDKISSEDKKTIVDKCNEIIAWLDKNQMAEKDEYEHQQKELEKVCNPIISKLYQ 612          
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Medaka
Match: hsp70-3 (heat shock protein 70 [Source:NCBI gene;Acc:100125493])

HSP 1 Score: 1015.37 bits (2624), Expect = 0.000e+0
Identity = 515/607 (84.84%), Postives = 568/607 (93.57%), Query Frame = 3
Query:  168 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 1988
            ++GIDLGTTYSCVG+FQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRKFD++ VQSDMKHW F V+N++ +PK+ VE+KGE KTF+PEEISSMVL KMKEI+EAYLGK+V +AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVK+TAGDTHLGGEDFDNRMVNHFI EFKRK KK+I++NKRAVRRLRTACERAKRTLSSS QA++EIDSLYEG DFYTSITRARFEELNADLFR T+EPVEKALRDAK+DK+ IHD+VLVGGSTRIPKIQKLLQDLFNG++LNKSINPDEAVAYGAAVQAAIL+GDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTKDNN+LGKFEL GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSK+DIERMV EAE++K EDE Q+++I AKNSLES ++ MKSTV+DEKL+DKIS  D+K I++KC E I WL+KNQ A KDE+++  KELEK+CNPI++K+YQ
Sbjct:   23 SLGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPANTVFDAKRLIGRKFDDAVVQSDMKHWPFKVVNDSSKPKVEVEYKGEIKTFYPEEISSMVLTKMKEISEAYLGKSVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVNHFITEFKRKFKKEITNNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGTDFYTSITRARFEELNADLFRGTIEPVEKALRDAKMDKSQIHDVVLVGGSTRIPKIQKLLQDLFNGRDLNKSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEQFKAEDESQRDKITAKNSLESLAFNMKSTVDDEKLQDKISSEDKKTIVDKCNEIIAWLDKNQMAEKDEYEHQQKELEKVCNPIISKLYQ 629          
BLAST of Heat shock cognate 71 kDa protein vs. Planmine SMEST
Match: SMESG000051815.1 (SMESG000051815.1)

HSP 1 Score: 1173.69 bits (3035), Expect = 0.000e+0
Identity = 630/644 (97.83%), Postives = 637/644 (98.91%), Query Frame = 3
Query:  156 MSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQXXXXXXXXXXXXXXXXXXHSGDDKQGPTVEEVD 2087
            MS NAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDE SVQSDMKHWSFDVI+E GRPKI++EFKGE KTF+PEEISSMVLIKMKEIAEAYLGK VKDAV+TVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQAN+EIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEK+LRDAKLDKN IHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEDQKERIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQGAGGAGGFPGGFPGAPG HSGDDKQGPTVEEVD
Sbjct:    1 MSVNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDEPSVQSDMKHWSFDVISEAGRPKIKIEFKGEKKTFYPEEISSMVLIKMKEIAEAYLGKIVKDAVITVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANVEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKLDKNAIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEDQKERIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQGAGGAGGFPGGFPGAPGAHSGDDKQGPTVEEVD 644          
BLAST of Heat shock cognate 71 kDa protein vs. Planmine SMEST
Match: SMESG000051570.1 (SMESG000051570.1)

HSP 1 Score: 1158.67 bits (2996), Expect = 0.000e+0
Identity = 622/650 (95.69%), Postives = 629/650 (96.77%), Query Frame = 3
Query:  156 MSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ------XXXXXXXXXXXXXXXXXXHSGDDKQGPTVEEVD 2087
            MSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDE+QK+RIA KNSLESY+YQMKSTVEDEKLKDKISESDRK II+KCQEAI WLEKNQQA+K+EF+YHYKELEKLCNPIM KMYQ           GGFPGG PGA GG  G  KQGPTVEEVD
Sbjct:    1 MSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEEQKDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQGAGGAGAGAFPGGFPGGAPGAAGGPGGAGKQGPTVEEVD 650          
BLAST of Heat shock cognate 71 kDa protein vs. Planmine SMEST
Match: SMESG000051567.1 (SMESG000051567.1)

HSP 1 Score: 1158.67 bits (2996), Expect = 0.000e+0
Identity = 622/650 (95.69%), Postives = 629/650 (96.77%), Query Frame = 3
Query:  156 MSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ------XXXXXXXXXXXXXXXXXXHSGDDKQGPTVEEVD 2087
            MSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDE+QK+RIA KNSLESY+YQMKSTVEDEKLKDKISESDRK II+KCQEAI WLEKNQQA+K+EF+YHYKELEKLCNPIM KMYQ           GGFPGG PGA GG  G  KQGPTVEEVD
Sbjct:    1 MSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEEQKDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQGAGGAGAGAFPGGFPGGAPGAAGGPGGAGKQGPTVEEVD 650          
BLAST of Heat shock cognate 71 kDa protein vs. Planmine SMEST
Match: SMESG000051541.1 (SMESG000051541.1)

HSP 1 Score: 1158.67 bits (2996), Expect = 0.000e+0
Identity = 622/650 (95.69%), Postives = 629/650 (96.77%), Query Frame = 3
Query:  156 MSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ------XXXXXXXXXXXXXXXXXXHSGDDKQGPTVEEVD 2087
            MSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDE+QK+RIA KNSLESY+YQMKSTVEDEKLKDKISESDRK II+KCQEAI WLEKNQQA+K+EF+YHYKELEKLCNPIM KMYQ           GGFPGG PGA GG  G  KQGPTVEEVD
Sbjct:    1 MSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEEQKDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQGAGGAGAGAFPGGFPGGAPGAAGGPGGAGKQGPTVEEVD 650          
BLAST of Heat shock cognate 71 kDa protein vs. Planmine SMEST
Match: SMESG000051540.1 (SMESG000051540.1)

HSP 1 Score: 1158.67 bits (2996), Expect = 0.000e+0
Identity = 622/650 (95.69%), Postives = 629/650 (96.77%), Query Frame = 3
Query:  156 MSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNXXXXXXXXXXXXXXRIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ------XXXXXXXXXXXXXXXXXXHSGDDKQGPTVEEVD 2087
            MSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDE+QK+RIA KNSLESY+YQMKSTVEDEKLKDKISESDRK II+KCQEAI WLEKNQQA+K+EF+YHYKELEKLCNPIM KMYQ           GGFPGG PGA GG  G  KQGPTVEEVD
Sbjct:    1 MSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEEQKDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQGAGGAGAGAFPGGFPGGAPGAAGGPGGAGKQGPTVEEVD 650          
The following BLAST results are available for this feature:
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSPA80.000e+087.19heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA80.000e+087.19heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA80.000e+087.19heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA20.000e+084.29heat shock protein family A (Hsp70) member 2 [Sour... [more]
HSPA20.000e+084.29heat shock protein family A (Hsp70) member 2 [Sour... [more]
back to top
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp-10.000e+084.56Heat shock 70 kDa protein A [Source:UniProtKB/Swi... [more]
hsp-10.000e+084.56Heat shock 70 kDa protein A [Source:UniProtKB/Swi... [more]
F44E5.50.000e+069.30pep chromosome:WBcel235:II:11759681:11761808:1 gen... [more]
F44E5.50.000e+069.30pep chromosome:WBcel235:II:11759640:11761853:1 gen... [more]
F44E5.40.000e+069.30pep chromosome:WBcel235:II:11757106:11759323:-1 ge... [more]
back to top
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hsc70-40.000e+083.36gene:FBgn0266599 transcript:FBtr0083059[more]
Hsc70-40.000e+083.36gene:FBgn0266599 transcript:FBtr0337053[more]
Hsc70-40.000e+083.36gene:FBgn0266599 transcript:FBtr0083058[more]
Hsc70-40.000e+083.36gene:FBgn0266599 transcript:FBtr0083060[more]
Hsc70-40.000e+083.36gene:FBgn0266599 transcript:FBtr0083057[more]
back to top
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa80.000e+087.19heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa80.000e+087.19heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa80.000e+087.19heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa80.000e+087.19heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa80.000e+087.19heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
back to top
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr260.000e+084.74WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
wdr260.000e+086.95WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
wdr260.000e+087.19WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
wdr260.000e+087.19WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
wdr260.000e+087.19WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
back to top
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hspa80.000e+087.19heat shock protein 8 [Source:MGI Symbol;Acc:MGI:10... [more]
Hspa20.000e+083.96heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96... [more]
Hspa20.000e+083.96heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96... [more]
Hspa1l0.000e+081.00heat shock protein 1-like [Source:MGI Symbol;Acc:M... [more]
Hspa80.000e+084.40heat shock protein 8 [Source:MGI Symbol;Acc:MGI:10... [more]
back to top
BLAST of Heat shock cognate 71 kDa protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P63018|HSP7C_RAT0.000e+087.19Heat shock cognate 71 kDa protein OS=Rattus norveg... [more]
sp|P63017|HSP7C_MOUSE0.000e+087.19Heat shock cognate 71 kDa protein OS=Mus musculus ... [more]
sp|Q5NVM9|HSP7C_PONAB0.000e+087.19Heat shock cognate 71 kDa protein OS=Pongo abelii ... [more]
sp|Q71U34|HSP7C_SAGOE0.000e+087.19Heat shock cognate 71 kDa protein OS=Saguinus oedi... [more]
sp|P11142|HSP7C_HUMAN0.000e+087.19Heat shock cognate 71 kDa protein OS=Homo sapiens ... [more]
back to top
BLAST of Heat shock cognate 71 kDa protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B0LVF70.000e+086.51Heat shock protein 70 OS=Dugesia japonica OX=6161 ... [more]
A0A484DIC70.000e+085.85Uncharacterized protein OS=Perca flavescens OX=816... [more]
A0A3B4Y4520.000e+088.03Uncharacterized protein OS=Seriola lalandi dorsali... [more]
A0A3B4XNT50.000e+088.18Uncharacterized protein OS=Seriola lalandi dorsali... [more]
A0A3B4TE880.000e+087.87Uncharacterized protein OS=Seriola dumerili OX=414... [more]
back to top
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa8b0.000e+087.03heat shock cognate 70 kDa protein-like [Source:NCB... [more]
hspa80.000e+086.37heat shock cognate 71 kDa protein [Source:NCBI gen... [more]
ENSAMXT00000004733.20.000e+085.88pep primary_assembly:Astyanax_mexicanus-2.0:20:275... [more]
hsc700.000e+084.73heat shock cognate 71 kDa protein-like [Source:NCB... [more]
ENSAMXT00000037064.10.000e+081.15heat shock 70 kDa protein [Source:NCBI gene;Acc:11... [more]
back to top
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa50.000e+065.30heat shock protein 5 [Source:NCBI gene;Acc:378848][more]
hspa90.000e+050.97heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
hspa143.889e-8833.27heat shock protein 14 [Source:NCBI gene;Acc:565232... [more]
hspa132.983e-7436.49heat shock protein 70 family, member 13 [Source:ZF... [more]
ENSPMAT00000003663.14.064e-637.68pep scaffold:Pmarinus_7.0:GL498042:47:1690:1 gene:... [more]
back to top
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SSA10.000e+074.77ATPase involved in protein folding and NLS-directe... [more]
SSA20.000e+074.38HSP70 family ATP-binding protein; involved in prot... [more]
SSA40.000e+073.44Heat shock protein that is highly induced upon str... [more]
SSA30.000e+073.07ATPase involved in protein folding and the respons... [more]
KAR20.000e+060.77ATPase involved in protein import into the ER; als... [more]
back to top
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO372800.000e+082.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303230.000e+081.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445300.000e+071.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332960.000e+065.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477237.708e-17850.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Heat shock cognate 71 kDa protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa8b0.000e+087.68heat shock cognate 70 kDa protein [Source:NCBI gen... [more]
hsc700.000e+086.51heat shock protein 70 cognate [Source:NCBI gene;Ac... [more]
hsc700.000e+086.54heat shock protein 70 cognate [Source:NCBI gene;Ac... [more]
hsp70-30.000e+084.89heat shock protein 70 [Source:NCBI gene;Acc:100125... [more]
hsp70-30.000e+084.84heat shock protein 70 [Source:NCBI gene;Acc:100125... [more]
back to top
BLAST of Heat shock cognate 71 kDa protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051815.10.000e+097.83SMESG000051815.1[more]
SMESG000051570.10.000e+095.69SMESG000051570.1[more]
SMESG000051567.10.000e+095.69SMESG000051567.1[more]
SMESG000051541.10.000e+095.69SMESG000051541.1[more]
SMESG000051540.10.000e+095.69SMESG000051540.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008295 ID=SMED30008295|Name=Heat shock cognate 71 kDa protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2192bp
GTTCGATTTGTATTCTAGAATTTATGTTTGTTTTAAAATTTGTTTTCTAG
AATTTTTATATTTGTAATTATATAAAGTGTCAGCAGTTCGGTGCGTGCAT
ATTTGCAAATTTTGAAAATAATTGTACTATATTAAGATTTTGAAAAATTT
TTCAAATGTCAGGTAACGCTATAGGTATTGATTTAGGAACTACTTATTCA
TGCGTTGGTGTATTTCAACATGGTAAAGTTGAAATTATTGCAAACGATCA
AGGAAATCGCACAACGCCCAGTTATGTAGCATTTACTGATACAGAACGGT
TGATTGGGGATGCTGCAAAAAACCAAGTGGCAATGAATCCTAATAATACG
GTTTTTGATGCAAAGCGATTGATAGGTCGAAAATTTGATGAATCGTCAGT
TCAAAGTGACATGAAACATTGGTCGTTCGATGTAATAAATGAAACTGGTA
GACCAAAAATTCGAGTCGAATTCAAAGGTGAAACAAAAACATTTTTCCCC
GAAGAAATTTCATCAATGGTTTTAATAAAAATGAAAGAAATTGCAGAAGC
ATACTTGGGTAAAACAGTGAAAGATGCAGTTGTAACTGTTCCAGCTTATT
TCAATGATAGTCAAAGACAAGCAACTAAAGATGCTGGTGCAATTAGTGGA
TTGAACGTTTTAAGAATTATTAATGAACCAACAGCTGCTGCTATAGCTTA
TGGATTAGACAAAAAAGTGGGCGCTGAACGCAATGTGTTAATATTTGATT
TAGGCGGCGGAACTTTTGATGTTTCGATTTTAACAATTGAAGATGGTATT
TTTGAAGTTAAATCTACTGCTGGTGATACTCATCTGGGCGGTGAAGATTT
TGATAATCGTATGGTGAATCATTTTATCCAAGAATTCAAGAGGAAGCATA
AGAAAGATATTAGTGACAACAAACGAGCAGTTAGAAGACTGAGAACAGCT
TGTGAGCGAGCAAAGAGAACTTTGAGTTCTAGTGCACAGGCAAATTTGGA
AATTGATTCATTGTATGAAGGTATTGATTTCTACACTTCAATTACAAGAG
CAAGATTTGAGGAATTGAATGCTGATTTGTTTCGTTCGACTTTAGAGCCA
GTAGAGAAGGCATTAAGAGATGCTAAGTTGGACAAAAATACAATCCATGA
TATTGTGTTAGTTGGCGGATCAACAAGAATACCGAAAATTCAAAAGCTCC
TTCAAGATTTATTCAATGGAAAGGAATTGAACAAATCCATTAATCCCGAT
GAGGCAGTTGCGTACGGAGCAGCAGTACAAGCAGCAATTTTGTCTGGAGA
TAAATCGGAAGCTGTGCAAGATTTATTATTGTTAGACGTGGCACCATTGA
GTTTGGGTATAGAAACTGCTGGTGGAGTAATGACGGCTCTGATTAAACGA
AATACAACTATTCCAACAAAGCAAACGCAAATATTTACTACATATTCTGA
TAACCAGCCGGGAGTATTAATTCAAGTTTATGAAGGTGAACGTGCAATGA
CAAAGGACAATAATTTGCTGGGTAAATTTGAATTGGCTGGAATTCCTCCA
GCTCCCAGAGGAGTTCCACAAATTGAGGTGACATTTGATATTGATGCTAA
CGGCATATTGAATGTGTCAGCGGTCGAGAAAGGTACAGGGAAAGAAAATA
AAATTACGATTACGAATGACAAAGGTCGATTGTCAAAAGATGATATAGAG
CGCATGGTTAATGAGGCCGAGAAATACAAGAAAGAGGACGAAGATCAAAA
AGAACGAATAGCTGCTAAAAATTCTTTAGAAAGTTATTCATATCAAATGA
AATCAACAGTTGAGGATGAGAAGTTGAAAGATAAAATTTCAGAATCAGAT
CGTAAGAAAATAATTGAAAAGTGTCAAGAGGCAATAACCTGGCTTGAGAA
AAATCAGCAAGCTTCGAAGGACGAATTTGATTATCATTACAAAGAATTGG
AAAAGTTATGCAATCCTATTATGGCGAAAATGTATCAGGGAGCGGGAGGA
GCAGGTGGATTTCCTGGCGGGTTTCCGGGAGCTCCAGGGGGACACAGTGG
TGACGACAAGCAAGGGCCAACTGTCGAGGAGGTTGATTAAATGTTCATTC
GGGGTGTCTTGTTGTGTTTTGTTGAATTAAATTTGCGTTAATTTCTTTTA
GTAGTTAATAAATTTGTGTTTTAAAAAAAAAGATCGGAAGAG
back to top

protein sequence of SMED30008295-orf-1

>SMED30008295-orf-1 ID=SMED30008295-orf-1|Name=SMED30008295-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=645bp
MSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLI
GDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRP
KIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFN
DSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLG
GGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKK
DISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRAR
FEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQ
DLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSL
GIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTK
DNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKI
TITNDKGRLSKDDIERMVNEAEKYKKEDEDQKERIAAKNSLESYSYQMKS
TVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEK
LCNPIMAKMYQGAGGAGGFPGGFPGAPGGHSGDDKQGPTVEEVD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000120progenitor cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR043129ATPase_NBD
IPR019651Glutamate_DH_NAD-spec
IPR013126Hsp_70_fam
IPR029047HSP70_peptide-bd_sf
IPR029048HSP70_C_sf
IPR018181Heat_shock_70_CS
Vocabulary: cellular component
TermDefinition
GO:1990124messenger ribonucleoprotein complex
GO:1990836lysosomal matrix
GO:0000974Prp19 complex
GO:0001917photoreceptor inner segment
GO:0005634nucleus
GO:0005681spliceosomal complex
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0005764lysosome
GO:0005765lysosomal membrane
GO:0005776autophagosome
GO:0005829cytosol
GO:0005874microtubule
GO:0005882intermediate filament
GO:0005886plasma membrane
GO:0008021synaptic vesicle
GO:0009986cell surface
GO:0014069postsynaptic density
GO:0016020membrane
GO:0030424axon
GO:0030425dendrite
GO:0030529intracellular ribonucleoprotein complex
GO:0032279asymmetric synapse
GO:0042470melanosome
GO:0043005neuron projection
GO:0043025neuronal cell body
GO:0043195terminal bouton
GO:0043197dendritic spine
GO:0043198dendritic shaft
GO:0043204perikaryon
GO:0043234protein complex
GO:0044309neuron spine
GO:0045121membrane raft
GO:0048471perinuclear region of cytoplasm
GO:0070062extracellular exosome
GO:0099523presynaptic cytosol
GO:0099524postsynaptic cytosol
Vocabulary: biological process
TermDefinition
GO:1990832slow axonal transport
GO:1990834response to odorant
GO:0000082G1/S transition of mitotic cell cycle
GO:0001822kidney development
GO:0001916positive regulation of T cell mediated cytotoxicity
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006397mRNA processing
GO:0006606protein import into nucleus
GO:0007519skeletal muscle tissue development
GO:0007568aging
GO:0007608sensory perception of smell
GO:0008088axo-dendritic transport
GO:0008380RNA splicing
GO:0009408response to heat
GO:0010045response to nickel cation
GO:0010628positive regulation of gene expression
GO:0010667negative regulation of cardiac muscle cell apoptotic process
GO:0014823response to activity
GO:0016191synaptic vesicle uncoating
GO:0021549cerebellum development
GO:0030900forebrain development
GO:0032355response to estradiol
GO:0032570response to progesterone
GO:0034605cellular response to heat
GO:0042026protein refolding
GO:0042493response to drug
GO:0042594response to starvation
GO:0043085positive regulation of catalytic activity
GO:0043624cellular protein complex disassembly
GO:0044743protein transmembrane import into intracellular organelle
GO:0044849estrous cycle
GO:0045471response to ethanol
GO:0045862positive regulation of proteolysis
GO:0045892negative regulation of transcription, DNA-templated
GO:0046777protein autophosphorylation
GO:0050766positive regulation of phagocytosis
GO:0051085chaperone mediated protein folding requiring cofactor
GO:0061077chaperone-mediated protein folding
GO:0061635regulation of protein complex stability
GO:0061684chaperone-mediated autophagy
GO:0061741chaperone-mediated protein transport involved in chaperone-mediated autophagy
GO:0071276cellular response to cadmium ion
GO:0072318clathrin coat disassembly
GO:0097214positive regulation of lysosomal membrane permeability
GO:1903206negative regulation of hydrogen peroxide-induced cell death
GO:1904592positive regulation of protein refolding
GO:1904764chaperone-mediated autophagy translocation complex disassembly
Vocabulary: molecular function
TermDefinition
GO:1990833clathrin-uncoating ATPase activity
GO:0000166nucleotide binding
GO:0003723RNA binding
GO:0005102signaling receptor binding
GO:0005515protein binding
GO:0005524ATP binding
GO:0008134transcription factor binding
GO:0016887ATPase activity
GO:0019899enzyme binding
GO:0031686A1 adenosine receptor binding
GO:0042277peptide binding
GO:0042623ATPase activity, coupled
GO:0043531ADP binding
GO:0051082unfolded protein binding
GO:1904593prostaglandin binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 570..590
NoneNo IPR availableCOILSCoilCoilcoord: 511..534
NoneNo IPR availablePRINTSPR00301HEATSHOCK70coord: 389..408
score: 84.67
coord: 470..486
score: 86.34
coord: 4..17
score: 82.98
coord: 202..212
score: 81.05
coord: 141..161
score: 93.1
coord: 362..382
score: 81.87
coord: 32..44
score: 85.18
coord: 330..346
score: 76.57
coord: 54..62
score: 76.1
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 6..377
e-value: 6.6E-182
score: 606.2
NoneNo IPR availableGENE3DG3DSA:3.30.30.30coord: 67..113
e-value: 6.6E-182
score: 606.2
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 187..364
e-value: 6.6E-182
score: 606.2
NoneNo IPR availableGENE3DG3DSA:3.90.640.10coord: 228..305
e-value: 6.6E-182
score: 606.2
NoneNo IPR availablePANTHERPTHR19375:SF407HEAT SHOCK COGNATE 71 KDA PROTEIN-RELATEDcoord: 3..609
NoneNo IPR availableCDDcd10233HSPA1-2_6-8-like_NBDcoord: 5..380
e-value: 0.0
score: 880.523
IPR013126Heat shock protein 70 familyPFAMPF00012HSP70coord: 5..609
e-value: 1.7E-261
score: 868.7
IPR013126Heat shock protein 70 familyPANTHERPTHR19375HEAT SHOCK PROTEIN 70KDAcoord: 3..609
IPR029047Heat shock protein 70kD, peptide-binding domain superfamilyGENE3DG3DSA:2.60.34.10coord: 380..508
e-value: 3.1E-66
score: 222.9
IPR029047Heat shock protein 70kD, peptide-binding domain superfamilySUPERFAMILYSSF100920Heat shock protein 70kD (HSP70), peptide-binding domaincoord: 386..542
IPR029048Heat shock protein 70kD, C-terminal domain superfamilyGENE3DG3DSA:1.20.1270.10coord: 509..609
e-value: 6.1E-37
score: 127.9
IPR029048Heat shock protein 70kD, C-terminal domain superfamilySUPERFAMILYSSF100934Heat shock protein 70kD (HSP70), C-terminal subdomaincoord: 538..609
IPR018181Heat shock protein 70, conserved sitePROSITEPS01036HSP70_3coord: 333..347
IPR018181Heat shock protein 70, conserved sitePROSITEPS00329HSP70_2coord: 196..209
IPR018181Heat shock protein 70, conserved sitePROSITEPS00297HSP70_1coord: 8..15
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 5..186
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 191..381