Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30008292
Length (bp)2303
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30008292) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30008292) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30008292) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30008292) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008292

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30008292SMESG000074938.1 SmedASXL_014770SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30008292SMESG000074938.1 SMESG000074937.1 dd_Smed_v4_9531_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30008292SMESG000074938.1 SMESG000074937.1 dd_Smed_v4_9531_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008292SMESG000074938.1 SMESG000074937.1 dd_Smed_v4_9531_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30008292SMESG000074938.1 SMESG000074937.1 dd_Smed_v4_9531_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K15 (mitogen-activated protein kinase kinase kinase 15 [Source:HGNC Symbol;Acc:HGNC:31689])

HSP 1 Score: 132.494 bits (332), Expect = 6.027e-31
Identity = 89/263 (33.84%), Postives = 133/263 (50.57%), Query Frame = 2
Query: 1457 IDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKND-VKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHP--YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTT-AISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLNE*N 2230
            + +G Y I+   +  S    I +K   EI   D   +  L +E+++ + LK H   ++  G   E  Y  I ME + GGS+   ++ K  P+ E  I F++KQILEGLKYLH+ + V+RD+K  N+L++  +  VK+     SK L   N   E         L+YMAPEI+ Q P  YG  AD+WS G  I+EM T   P+ EL E  A    +    I      A+S   + FI  C   +P +R++  +L+   FL + N
Sbjct:  658 LGKGTYGIVYAGRDLSNQVRIAIK---EIPERDSRYSQPLHEEIALHKYLK-HRNIVQYLGSVSENGYIKIFMEQVPGGSLSALLRSKWGPMKEPTIKFYTKQILEGLKYLHENQIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLAGVNPCTETF----TGTLQYMAPEIIDQGPRGYGAPADIWSLGCTIIEMATSKPPFHELGEPQAAMFKVGMFKIHPEIPEALSAEARAFILSCFEPDPHKRATTAELLREGFLRQVN 912          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K5 (mitogen-activated protein kinase kinase kinase 5 [Source:HGNC Symbol;Acc:HGNC:6857])

HSP 1 Score: 128.257 bits (321), Expect = 1.237e-29
Identity = 89/261 (34.10%), Postives = 136/261 (52.11%), Query Frame = 2
Query: 1457 IDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPL--DEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDV-KLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHP--YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQ-RIIQDRTIKYNTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
            + +G Y I+   +  S    I +K   EI   D   +  L +E+++ + LK H   ++  G + E  +  I ME + GGS+   ++ K  PL  +E+ I F++KQILEGLKYLHD + V+RD+K  N+LI+  + V K+     SK L   N   E         L+YMAPEI+ + P  YG  AD+WS G  I+EM TG  P+ EL E  A   ++   +       ++S   K FI  C   +P++R+  + L+   FL
Sbjct:  686 LGKGTYGIVYAGRDLSNQVRIAIK---EIPERDSRYSQPLHEEIALHKHLK-HKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETF----TGTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHPEIPESMSAEAKAFILKCFEPDPDKRACANDLLVDEFL 938          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: STK4 (serine/threonine kinase 4 [Source:HGNC Symbol;Acc:HGNC:11408])

HSP 1 Score: 122.479 bits (306), Expect = 7.274e-29
Identity = 81/262 (30.92%), Postives = 137/262 (52.29%), Query Frame = 2
Query: 1442 EVIEEIDRGYYSILLKAKIKSKDKDIVLKKY-TEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTTAI-SHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
            +V+E++  G Y  + KA  K   + + +K+   E DL ++      +KE+SI Q   S H  +K +G Y +    +I ME    GS+   I+ +NK L E +IA   +  L+GL+YLH    ++RD+K  NIL++ +   KL    ++  L D   K   +      P  +MAPE++Q+  Y   AD+WS G   +EM  G  PY++++   AI  I  +    +    + S N  +F+  CL+ +PE+R++  +L+ H F+
Sbjct:   31 DVLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEI------IKEISIMQQCDSPH-VVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTV---IGTPF-WMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQHPFV 281          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: STK4 (serine/threonine kinase 4 [Source:HGNC Symbol;Acc:HGNC:11408])

HSP 1 Score: 121.324 bits (303), Expect = 2.459e-28
Identity = 81/262 (30.92%), Postives = 137/262 (52.29%), Query Frame = 2
Query: 1442 EVIEEIDRGYYSILLKAKIKSKDKDIVLKKY-TEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTTAI-SHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
            +V+E++  G Y  + KA  K   + + +K+   E DL ++      +KE+SI Q   S H  +K +G Y +    +I ME    GS+   I+ +NK L E +IA   +  L+GL+YLH    ++RD+K  NIL++ +   KL    ++  L D   K   +      P  +MAPE++Q+  Y   AD+WS G   +EM  G  PY++++   AI  I  +    +    + S N  +F+  CL+ +PE+R++  +L+ H F+
Sbjct:   31 DVLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEI------IKEISIMQQCDSPH-VVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTV---IGTPF-WMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQHPFV 281          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: STK3 (serine/threonine kinase 3 [Source:HGNC Symbol;Acc:HGNC:11406])

HSP 1 Score: 120.168 bits (300), Expect = 6.472e-28
Identity = 84/272 (30.88%), Postives = 141/272 (51.84%), Query Frame = 2
Query: 1442 EVIEEIDRGYYSILLKAKIKSKDKDIVLKKY-TEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTTAI-SHNLKEFIGLCLIFNPEERSSDDKLMNHSFLNE*NVKEFNI 2248
            +V+E++  G Y  + KA  K   + + +K+   E DL ++      +KE+SI Q   S +  +K +G Y +    +I ME    GS+   I+ +NK L E +IA   K  L+GL+YLH    ++RD+K  NIL++ +   KL    ++  L D   K   +      P  +MAPE++Q+  Y   AD+WS G   +EM  G  PY++++   AI  I  +    +    + S +  +F+  CL+ NPE+R++  +L+ H F+   N K  +I
Sbjct:   56 DVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEI------IKEISIMQQCDSPY-VVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTV---IGTPF-WMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIK--NAKPVSI 314          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: nsy-1 (Mitogen-activated protein kinase kinase kinase nsy-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21029])

HSP 1 Score: 120.939 bits (302), Expect = 9.182e-28
Identity = 84/264 (31.82%), Postives = 137/264 (51.89%), Query Frame = 2
Query: 1457 IDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLK-----LFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDV-KLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQ--QHPYGIKADVWSFGAIIVEMVTGIQPYSEL-NETDAIQRIIQDRTIKYNTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
            + +G Y  +  A+     + IV+K   EI++    +   L++E+S+  TL  H   ++     L G     ++F I ME++ GGS+ + ++ K  P++E  + ++ KQILEGLKYLH+ + V+RD+K  N+L++  + V K+      K L   N   E         L+YMAPE++   Q  YG  AD+WSFG  +VEM TG  P+ E+ N   A+ R+   +T     T I+   + FI  C +    +R S   L+   F+
Sbjct:  670 LGKGTYGTVYAARDMDTQRQIVVK---EIEVKYDEEVQPLMEEISLHSTL-CHANIVQYLGCDLVGKDGSNDHFLIFMEHVPGGSLSSLLRSKWGPMNENAMNYYGKQILEGLKYLHELKIVHRDIKGDNVLVNTYSGVCKISDFGTCKRLAGLNPVTETFTGT----LQYMAPEVIDHGQRGYGAPADIWSFGCTMVEMATGRPPFVEMQNPQAAMFRVGMFKTHPPIPTEITEKCRNFIKSCFLPEACDRPSAKDLLQDPFI 925          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: cst-2 (Caenorhabditis STE20-like kinase [Source:UniProtKB/TrEMBL;Acc:Q304D8])

HSP 1 Score: 117.087 bits (292), Expect = 9.269e-28
Identity = 82/261 (31.42%), Postives = 136/261 (52.11%), Query Frame = 2
Query: 1442 EVIEEIDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTT-AISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
            +++ ++  G Y  + KA I  +   ++  K   +D  DL +   ++KE+SI Q  KS +  +K +G Y + +  +I ME    GSI   ++ + KPL E++I+   +  L+GL+YLHD + ++RD+K  NIL++     KL    ++  L D   K   +      P  +MAPE++++  Y  KAD+WS G   +EM  G  PYS+++   AI  I       +      S    +FI  CLI  PEER +  +L  H+F+
Sbjct:   36 DIVGKLGEGSYGSVHKA-IHRESGHVLAIKKVPVDT-DLQE---IIKEISIMQQCKSKY-VVKYYGSYFKHSDLWIVMEYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHRDIKAGNILLNTDGIAKLADFGVAGQLTDTMAKRNTV---IGTPF-WMAPEVIEEIGYDTKADIWSLGITAIEMAEGRPPYSDIHPMRAIFMIPTKPPPTFKKPEEWSSEFNDFIRSCLIKKPEERKTALRLCEHTFI 286          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: nsy-1 (Mitogen-activated protein kinase kinase kinase nsy-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21029])

HSP 1 Score: 120.939 bits (302), Expect = 1.133e-27
Identity = 84/264 (31.82%), Postives = 137/264 (51.89%), Query Frame = 2
Query: 1457 IDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLK-----LFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDV-KLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQ--QHPYGIKADVWSFGAIIVEMVTGIQPYSEL-NETDAIQRIIQDRTIKYNTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
            + +G Y  +  A+     + IV+K   EI++    +   L++E+S+  TL  H   ++     L G     ++F I ME++ GGS+ + ++ K  P++E  + ++ KQILEGLKYLH+ + V+RD+K  N+L++  + V K+      K L   N   E         L+YMAPE++   Q  YG  AD+WSFG  +VEM TG  P+ E+ N   A+ R+   +T     T I+   + FI  C +    +R S   L+   F+
Sbjct:  656 LGKGTYGTVYAARDMDTQRQIVVK---EIEVKYDEEVQPLMEEISLHSTL-CHANIVQYLGCDLVGKDGSNDHFLIFMEHVPGGSLSSLLRSKWGPMNENAMNYYGKQILEGLKYLHELKIVHRDIKGDNVLVNTYSGVCKISDFGTCKRLAGLNPVTETFTGT----LQYMAPEVIDHGQRGYGAPADIWSFGCTMVEMATGRPPFVEMQNPQAAMFRVGMFKTHPPIPTEITEKCRNFIKSCFLPEACDRPSAKDLLQDPFI 911          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: cst-1 (Serine/threonine-protein kinase cst-1 Serine/threonine-protein kinase cst-1 37kDa subunit Serine/threonine-protein kinase cst-1 18kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:Q9NB31])

HSP 1 Score: 117.087 bits (292), Expect = 2.329e-27
Identity = 82/261 (31.42%), Postives = 136/261 (52.11%), Query Frame = 2
Query: 1442 EVIEEIDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTT-AISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
            +++ ++  G Y  + KA I  +   ++  K   +D  DL +   ++KE+SI Q  KS +  +K +G Y + +  +I ME    GSI   ++ + KPL E++I+   +  L+GL+YLHD + ++RD+K  NIL++     KL    ++  L D   K   +      P  +MAPE++++  Y  KAD+WS G   +EM  G  PYS+++   AI  I       +      S    +FI  CLI  PEER +  +L  H+F+
Sbjct:   36 DIVGKLGEGSYGSVHKA-IHRESGHVLAIKKVPVDT-DLQE---IIKEISIMQQCKSKY-VVKYYGSYFKHSDLWIVMEYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHRDIKAGNILLNTDGIAKLADFGVAGQLTDTMAKRNTV---IGTPF-WMAPEVIEEIGYDTKADIWSLGITAIEMAEGRPPYSDIHPMRAIFMIPTKPPPTFKKPEEWSSEFNDFIRSCLIKKPEERKTALRLCEHTFI 286          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: cst-1 (Serine/threonine-protein kinase cst-1 Serine/threonine-protein kinase cst-1 37kDa subunit Serine/threonine-protein kinase cst-1 18kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:Q9NB31])

HSP 1 Score: 117.087 bits (292), Expect = 2.347e-27
Identity = 82/261 (31.42%), Postives = 136/261 (52.11%), Query Frame = 2
Query: 1442 EVIEEIDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTT-AISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
            +++ ++  G Y  + KA I  +   ++  K   +D  DL +   ++KE+SI Q  KS +  +K +G Y + +  +I ME    GSI   ++ + KPL E++I+   +  L+GL+YLHD + ++RD+K  NIL++     KL    ++  L D   K   +      P  +MAPE++++  Y  KAD+WS G   +EM  G  PYS+++   AI  I       +      S    +FI  CLI  PEER +  +L  H+F+
Sbjct:   36 DIVGKLGEGSYGSVHKA-IHRESGHVLAIKKVPVDT-DLQE---IIKEISIMQQCKSKY-VVKYYGSYFKHSDLWIVMEYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHRDIKAGNILLNTDGIAKLADFGVAGQLTDTMAKRNTV---IGTPF-WMAPEVIEEIGYDTKADIWSLGITAIEMAEGRPPYSDIHPMRAIFMIPTKPPPTFKKPEEWSSEFNDFIRSCLIKKPEERKTALRLCEHTFI 286          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Ask1 (gene:FBgn0014006 transcript:FBtr0300256)

HSP 1 Score: 125.946 bits (315), Expect = 3.464e-29
Identity = 90/265 (33.96%), Postives = 134/265 (50.57%), Query Frame = 2
Query: 1457 IDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNV--LLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPL--DEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKND-VKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQ--HPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTT-AISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLNE 2224
            + +G Y  +  A+ K     I +K     ++P+ N  +V  L +E+ +   L+ H   ++  G   E  +F I ME + GGS+   ++ K  PL  +E  +AF+SKQILEGLKYLH+Q+ V+RD+K  N+L++  +  VK+     SK L   N   E         L+YMAPE++ Q    YG  AD+WSFG   VEM TG  P+ EL    A    +       N    +S N K FI  C   +  +R S  +L+   FL +
Sbjct:  591 LGKGTYGTVYAARDKQTQVRIAIK-----EVPEKNSQDVQPLHEEIKLHSQLR-HRNIVRYLGSCSENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAFYSKQILEGLKYLHEQDIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLARINPMTETF----TGTLQYMAPEVIDQGVRGYGPAADIWSFGCTNVEMATGKPPFIELGSAHAAMFKVGFYKKHPNIPEELSANAKNFILRCFAISVMDRPSASQLLEDPFLQD 845          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Ask1 (gene:FBgn0014006 transcript:FBtr0083819)

HSP 1 Score: 125.561 bits (314), Expect = 4.050e-29
Identity = 90/265 (33.96%), Postives = 134/265 (50.57%), Query Frame = 2
Query: 1457 IDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNV--LLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPL--DEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKND-VKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQ--HPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTT-AISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLNE 2224
            + +G Y  +  A+ K     I +K     ++P+ N  +V  L +E+ +   L+ H   ++  G   E  +F I ME + GGS+   ++ K  PL  +E  +AF+SKQILEGLKYLH+Q+ V+RD+K  N+L++  +  VK+     SK L   N   E         L+YMAPE++ Q    YG  AD+WSFG   VEM TG  P+ EL    A    +       N    +S N K FI  C   +  +R S  +L+   FL +
Sbjct:  424 LGKGTYGTVYAARDKQTQVRIAIK-----EVPEKNSQDVQPLHEEIKLHSQLR-HRNIVRYLGSCSENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAFYSKQILEGLKYLHEQDIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLARINPMTETF----TGTLQYMAPEVIDQGVRGYGPAADIWSFGCTNVEMATGKPPFIELGSAHAAMFKVGFYKKHPNIPEELSANAKNFILRCFAISVMDRPSASQLLEDPFLQD 678          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: mbt (gene:FBgn0025743 transcript:FBtr0074285)

HSP 1 Score: 108.227 bits (269), Expect = 5.805e-24
Identity = 74/267 (27.72%), Postives = 132/267 (49.44%), Query Frame = 2
Query: 1454 EIDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLR--------YMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRI--IQDRTIKYNTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLNE 2224
            +I  G    +  A  KS  + + +KK   +DL    +  +L  E+ I +    H   ++ +  +   +  ++ ME ++GG++ T I  +  +DE+QIA   KQ L+ L YLH Q  ++RD+K+ +IL+     VKL        +               LP R        +M+PE++ + PYG + D+WS G +++EMV G  P+       A++RI  +Q   +K N   +S  L+ F+   L+ +P +R++  +L+ H FL +
Sbjct:  373 KIGEGSTGTVCIATDKSTGRQVAVKK---MDLRKQQRRELLFNEVVIMRDYH-HPNIVETYSSFLVNDELWVVMEYLEGGAL-TDIVTHSRMDEEQIATVCKQCLKALAYLHSQGVIHRDIKSDSILLAADGRVKLSDFGFCAQV------------SQELPKRKSLVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMVDGEPPFFNEPPLQAMRRIRDMQPPNLK-NAHKVSPRLQSFLDRMLVRDPAQRATAAELLAHPFLRQ 621          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: aPKC (gene:FBgn0261854 transcript:FBtr0303429)

HSP 1 Score: 102.449 bits (254), Expect = 2.106e-22
Identity = 60/235 (25.53%), Postives = 119/235 (50.64%), Query Frame = 2
Query: 1427 NLHDVEVIEEIDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPY--------SELNETDAIQRIIQDRTIK 2107
            +L+D E+I  I RG Y+ +L  +++   +   +K   +  + D    + +  E  +F+T  +H   + L   ++  +  +  +E ++GG +  H+++ + L E+   F++ +I   L +LH++  +YRDLK  N+L+D +  +KL    + K   +  R  +        P  Y+APEIL+   YG   D W+ G ++ EM+ G  P+         + N  D + ++I ++TI+
Sbjct:  178 SLNDFELIRVIGRGSYAKVLMVELRRTRRIYAMKVIKKALVTDDEDIDWVQTEKHVFETASNHPFLVGLHSCFQTPSRLFFVIEFVRGGDLMYHMQRQRRLPEEHARFYAAEISLALNFLHEKGIIYRDLKLDNVLLDHEGHIKLTDYGMCK---EGIRPGDTTSTFCGTP-NYIAPEILRGEDYGFSVDWWALGVLLYEMLAGRSPFDLAGASENPDQNTEDYLFQVILEKTIR 408          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: aPKC (gene:FBgn0261854 transcript:FBtr0303433)

HSP 1 Score: 102.064 bits (253), Expect = 2.172e-22
Identity = 60/235 (25.53%), Postives = 119/235 (50.64%), Query Frame = 2
Query: 1427 NLHDVEVIEEIDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPY--------SELNETDAIQRIIQDRTIK 2107
            +L+D E+I  I RG Y+ +L  +++   +   +K   +  + D    + +  E  +F+T  +H   + L   ++  +  +  +E ++GG +  H+++ + L E+   F++ +I   L +LH++  +YRDLK  N+L+D +  +KL    + K   +  R  +        P  Y+APEIL+   YG   D W+ G ++ EM+ G  P+         + N  D + ++I ++TI+
Sbjct:  157 SLNDFELIRVIGRGSYAKVLMVELRRTRRIYAMKVIKKALVTDDEDIDWVQTEKHVFETASNHPFLVGLHSCFQTPSRLFFVIEFVRGGDLMYHMQRQRRLPEEHARFYAAEISLALNFLHEKGIIYRDLKLDNVLLDHEGHIKLTDYGMCK---EGIRPGDTTSTFCGTP-NYIAPEILRGEDYGFSVDWWALGVLLYEMLAGRSPFDLAGASENPDQNTEDYLFQVILEKTIR 387          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-1i11.3 (si:ch211-1i11.3 [Source:ZFIN;Acc:ZDB-GENE-030131-8638])

HSP 1 Score: 134.035 bits (336), Expect = 1.021e-31
Identity = 90/283 (31.80%), Postives = 149/283 (52.65%), Query Frame = 2
Query: 1391 NQHSEVKFVCIRNLHDVEVIEEIDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPL--DEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDV-KLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHP--YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQ-RIIQDRTIKYNTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
             +  +++++  RN +  +V+  + +G Y ++   +  S    I +K   EI   D   +  L +E+++ + LK H   ++  G   E+ +  I ME + GGS+ + ++ K  PL  +E  I F++KQIL+GLKYLHD + V+RD+K  N+L++  + V K+     SK L   N   E         L+YMAPEI+ Q P  YG  AD+WS G  I+EM TG  P+ EL    A   ++   +        +S   K+FI  C   NP++R++  +L+ + FL
Sbjct:  618 GEEGDLEYIYERNENGDKVV--LGKGTYGVVYAGRDLSNQVRIAIK---EIPEKDSTYSQPLHEEIALHKRLK-HRNIVQYLGSVSEDGFIKIFMEEVPGGSLSSLLRSKWGPLKDNEATIVFYTKQILDGLKYLHDNQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGINPCTETFTGT----LQYMAPEIIDQGPRGYGKPADIWSLGCTIIEMATGKPPFHELGSPQAAMFKVGMFKIHPAVPECMSEQAKDFIMCCFEPNPDKRTTASELLKNGFL 890          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-1i11.3 (si:ch211-1i11.3 [Source:ZFIN;Acc:ZDB-GENE-030131-8638])

HSP 1 Score: 134.035 bits (336), Expect = 1.119e-31
Identity = 90/283 (31.80%), Postives = 149/283 (52.65%), Query Frame = 2
Query: 1391 NQHSEVKFVCIRNLHDVEVIEEIDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPL--DEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDV-KLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHP--YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQ-RIIQDRTIKYNTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
             +  +++++  RN +  +V+  + +G Y ++   +  S    I +K   EI   D   +  L +E+++ + LK H   ++  G   E+ +  I ME + GGS+ + ++ K  PL  +E  I F++KQIL+GLKYLHD + V+RD+K  N+L++  + V K+     SK L   N   E         L+YMAPEI+ Q P  YG  AD+WS G  I+EM TG  P+ EL    A   ++   +        +S   K+FI  C   NP++R++  +L+ + FL
Sbjct:  618 GEEGDLEYIYERNENGDKVV--LGKGTYGVVYAGRDLSNQVRIAIK---EIPEKDSTYSQPLHEEIALHKRLK-HRNIVQYLGSVSEDGFIKIFMEEVPGGSLSSLLRSKWGPLKDNEATIVFYTKQILDGLKYLHDNQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGINPCTETFTGT----LQYMAPEIIDQGPRGYGKPADIWSLGCTIIEMATGKPPFHELGSPQAAMFKVGMFKIHPAVPECMSEQAKDFIMCCFEPNPDKRTTASELLKNGFL 890          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-1i11.3 (si:ch211-1i11.3 [Source:ZFIN;Acc:ZDB-GENE-030131-8638])

HSP 1 Score: 134.035 bits (336), Expect = 1.237e-31
Identity = 90/283 (31.80%), Postives = 149/283 (52.65%), Query Frame = 2
Query: 1391 NQHSEVKFVCIRNLHDVEVIEEIDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPL--DEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDV-KLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHP--YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQ-RIIQDRTIKYNTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
             +  +++++  RN +  +V+  + +G Y ++   +  S    I +K   EI   D   +  L +E+++ + LK H   ++  G   E+ +  I ME + GGS+ + ++ K  PL  +E  I F++KQIL+GLKYLHD + V+RD+K  N+L++  + V K+     SK L   N   E         L+YMAPEI+ Q P  YG  AD+WS G  I+EM TG  P+ EL    A   ++   +        +S   K+FI  C   NP++R++  +L+ + FL
Sbjct:  467 GEEGDLEYIYERNENGDKVV--LGKGTYGVVYAGRDLSNQVRIAIK---EIPEKDSTYSQPLHEEIALHKRLK-HRNIVQYLGSVSEDGFIKIFMEEVPGGSLSSLLRSKWGPLKDNEATIVFYTKQILDGLKYLHDNQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGINPCTETFTGT----LQYMAPEIIDQGPRGYGKPADIWSLGCTIIEMATGKPPFHELGSPQAAMFKVGMFKIHPAVPECMSEQAKDFIMCCFEPNPDKRTTASELLKNGFL 739          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k5 (mitogen-activated protein kinase kinase kinase 5 [Source:ZFIN;Acc:ZDB-GENE-030827-3])

HSP 1 Score: 127.872 bits (320), Expect = 1.280e-29
Identity = 87/262 (33.21%), Postives = 134/262 (51.15%), Query Frame = 2
Query: 1457 IDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPL--DEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDV-KLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHP--YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTT-AISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLN 2221
            + +G + ++   +  S    + +K   EI   D   +  L +E+++ + LK H   ++  G   E  +  I ME + GGS+   ++ K  PL  +E  I F++KQIL+GLKYLHD + V+RD+K  N+LI+  + V K+     SK L   N   E         L+YMAPEI+ + P  YG  AD+WS G  I+EM TG  P+ EL E  A    +    I      ++S   K FI  C   +P+ R++ + L+ H FL 
Sbjct:  667 LGKGTFGVVYAGRDLSNQVRLAIK---EIPERDSRYSQPLHEEIALHKHLK-HKNIVQYLGSISENGFIKIFMEQVPGGSLSALLRSKWGPLKNNEPTIGFYTKQILDGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTGT----LQYMAPEIIDKGPRGYGKPADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKIHPEIPDSMSSEAKAFILRCFEPDPDSRATANDLLTHEFLT 920          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k5 (mitogen-activated protein kinase kinase kinase 5 [Source:ZFIN;Acc:ZDB-GENE-030827-3])

HSP 1 Score: 127.487 bits (319), Expect = 1.489e-29
Identity = 87/262 (33.21%), Postives = 134/262 (51.15%), Query Frame = 2
Query: 1457 IDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPL--DEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDV-KLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHP--YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTT-AISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLN 2221
            + +G + ++   +  S    + +K   EI   D   +  L +E+++ + LK H   ++  G   E  +  I ME + GGS+   ++ K  PL  +E  I F++KQIL+GLKYLHD + V+RD+K  N+LI+  + V K+     SK L   N   E         L+YMAPEI+ + P  YG  AD+WS G  I+EM TG  P+ EL E  A    +    I      ++S   K FI  C   +P+ R++ + L+ H FL 
Sbjct:  675 LGKGTFGVVYAGRDLSNQVRLAIK---EIPERDSRYSQPLHEEIALHKHLK-HKNIVQYLGSISENGFIKIFMEQVPGGSLSALLRSKWGPLKNNEPTIGFYTKQILDGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTGT----LQYMAPEIIDKGPRGYGKPADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKIHPEIPDSMSSEAKAFILRCFEPDPDSRATANDLLTHEFLT 928          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: MAP3K15 (mitogen-activated protein kinase kinase kinase 5 [Source:NCBI gene;Acc:549376])

HSP 1 Score: 134.806 bits (338), Expect = 1.128e-31
Identity = 90/263 (34.22%), Postives = 135/263 (51.33%), Query Frame = 2
Query: 1457 IDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDV-KLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHP--YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTT-AISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLNE*N 2230
            + RG Y ++   +  S    I +K   EI   D   +  L +E+++ + LK H   ++  G   E+ Y  I ME + GGS+   ++ K  PL E  I F++KQILEGLKYLH+ + V+RD+K  N+L++  + V K+     SK L   N   E         L+YMAPEI+ + P  YG  AD+WS G  I+EM TG  P+ EL E  A    +    I      ++S   + FI LC   +P +R++   L+   FL + N
Sbjct:  657 LGRGTYGVVYAGRDLSNQVRIAIK---EIPEKDSRYSQPLHEEIALHKYLK-HRNIVQYLGSISEDGYIKIFMEQVPGGSLSVLLRSKWGPLKEPTIKFYTKQILEGLKYLHENQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGVNPCTETF----TGTLQYMAPEIIDKGPRGYGAPADIWSLGCTIIEMATGRPPFHELGEPQAAMFKVGMFKIHPEIPESLSAEARAFILLCFEPDPAKRATVTDLLRDFFLKQSN 911          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: MAP3K15 (mitogen-activated protein kinase kinase kinase 5 [Source:NCBI gene;Acc:549376])

HSP 1 Score: 134.42 bits (337), Expect = 1.465e-31
Identity = 90/263 (34.22%), Postives = 135/263 (51.33%), Query Frame = 2
Query: 1457 IDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDV-KLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHP--YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTT-AISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLNE*N 2230
            + RG Y ++   +  S    I +K   EI   D   +  L +E+++ + LK H   ++  G   E+ Y  I ME + GGS+   ++ K  PL E  I F++KQILEGLKYLH+ + V+RD+K  N+L++  + V K+     SK L   N   E         L+YMAPEI+ + P  YG  AD+WS G  I+EM TG  P+ EL E  A    +    I      ++S   + FI LC   +P +R++   L+   FL + N
Sbjct:  649 LGRGTYGVVYAGRDLSNQVRIAIK---EIPEKDSRYSQPLHEEIALHKYLK-HRNIVQYLGSISEDGYIKIFMEQVPGGSLSVLLRSKWGPLKEPTIKFYTKQILEGLKYLHENQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGVNPCTETF----TGTLQYMAPEIIDKGPRGYGAPADIWSLGCTIIEMATGRPPFHELGEPQAAMFKVGMFKIHPEIPESLSAEARAFILLCFEPDPAKRATVTDLLRDFFLKQSN 903          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: MAP3K15 (mitogen-activated protein kinase kinase kinase 5 [Source:NCBI gene;Acc:549376])

HSP 1 Score: 134.035 bits (336), Expect = 1.532e-31
Identity = 90/263 (34.22%), Postives = 135/263 (51.33%), Query Frame = 2
Query: 1457 IDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDV-KLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHP--YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTT-AISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLNE*N 2230
            + RG Y ++   +  S    I +K   EI   D   +  L +E+++ + LK H   ++  G   E+ Y  I ME + GGS+   ++ K  PL E  I F++KQILEGLKYLH+ + V+RD+K  N+L++  + V K+     SK L   N   E         L+YMAPEI+ + P  YG  AD+WS G  I+EM TG  P+ EL E  A    +    I      ++S   + FI LC   +P +R++   L+   FL + N
Sbjct:  639 LGRGTYGVVYAGRDLSNQVRIAIK---EIPEKDSRYSQPLHEEIALHKYLK-HRNIVQYLGSISEDGYIKIFMEQVPGGSLSVLLRSKWGPLKEPTIKFYTKQILEGLKYLHENQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGVNPCTETF----TGTLQYMAPEIIDKGPRGYGAPADIWSLGCTIIEMATGRPPFHELGEPQAAMFKVGMFKIHPEIPESLSAEARAFILLCFEPDPAKRATVTDLLRDFFLKQSN 893          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: MAP3K15 (mitogen-activated protein kinase kinase kinase 5 [Source:NCBI gene;Acc:549376])

HSP 1 Score: 134.035 bits (336), Expect = 1.717e-31
Identity = 90/263 (34.22%), Postives = 135/263 (51.33%), Query Frame = 2
Query: 1457 IDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDV-KLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHP--YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTT-AISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLNE*N 2230
            + RG Y ++   +  S    I +K   EI   D   +  L +E+++ + LK H   ++  G   E+ Y  I ME + GGS+   ++ K  PL E  I F++KQILEGLKYLH+ + V+RD+K  N+L++  + V K+     SK L   N   E         L+YMAPEI+ + P  YG  AD+WS G  I+EM TG  P+ EL E  A    +    I      ++S   + FI LC   +P +R++   L+   FL + N
Sbjct:  657 LGRGTYGVVYAGRDLSNQVRIAIK---EIPEKDSRYSQPLHEEIALHKYLK-HRNIVQYLGSISEDGYIKIFMEQVPGGSLSVLLRSKWGPLKEPTIKFYTKQILEGLKYLHENQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGVNPCTETF----TGTLQYMAPEIIDKGPRGYGAPADIWSLGCTIIEMATGRPPFHELGEPQAAMFKVGMFKIHPEIPESLSAEARAFILLCFEPDPAKRATVTDLLRDFFLKQSN 911          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: MAP3K15 (mitogen-activated protein kinase kinase kinase 5 [Source:NCBI gene;Acc:549376])

HSP 1 Score: 134.035 bits (336), Expect = 1.721e-31
Identity = 90/263 (34.22%), Postives = 135/263 (51.33%), Query Frame = 2
Query: 1457 IDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDV-KLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHP--YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTT-AISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLNE*N 2230
            + RG Y ++   +  S    I +K   EI   D   +  L +E+++ + LK H   ++  G   E+ Y  I ME + GGS+   ++ K  PL E  I F++KQILEGLKYLH+ + V+RD+K  N+L++  + V K+     SK L   N   E         L+YMAPEI+ + P  YG  AD+WS G  I+EM TG  P+ EL E  A    +    I      ++S   + FI LC   +P +R++   L+   FL + N
Sbjct:  649 LGRGTYGVVYAGRDLSNQVRIAIK---EIPEKDSRYSQPLHEEIALHKYLK-HRNIVQYLGSISEDGYIKIFMEQVPGGSLSVLLRSKWGPLKEPTIKFYTKQILEGLKYLHENQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGVNPCTETF----TGTLQYMAPEIIDKGPRGYGAPADIWSLGCTIIEMATGRPPFHELGEPQAAMFKVGMFKIHPEIPESLSAEARAFILLCFEPDPAKRATVTDLLRDFFLKQSN 903          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k15 (mitogen-activated protein kinase kinase kinase 15 [Source:MGI Symbol;Acc:MGI:2448588])

HSP 1 Score: 132.494 bits (332), Expect = 4.286e-31
Identity = 89/263 (33.84%), Postives = 133/263 (50.57%), Query Frame = 2
Query: 1457 IDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKND-VKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHP--YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTT-AISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLNE*N 2230
            + +G Y I+   +  S    I +K   EI   D+  +  L +E+++ + LK H   ++  G   E  Y  I ME + GGS+   ++ K  P+ E  I F++KQILEGLKYLH+ + V+RD+K  N+L++  +  VK+     SK L   N   E         L+YMAPEI+ Q P  YG  AD+WS G  I+EM T   P+ EL E  A    +    I      A+S   + FI  C   +P++R +   L+   FL + N
Sbjct:  662 LGKGSYGIVYAGRDLSNQVRIAIK---EIPERDIRYSQPLHEEIALHKYLK-HRNIVQYLGSVSENGYIKIFMEQVPGGSLSALLRSKWGPMKEPTIKFYTKQILEGLKYLHENQIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLAGINPCTETF----TGTLQYMAPEIIDQGPRGYGAPADIWSLGCTIIEMATSRPPFHELGEPQAAMFKVGMFKIHPEIPEALSAEARAFILSCFEPDPQKRVTAADLLQEGFLRQVN 916          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k5 (mitogen-activated protein kinase kinase kinase 5 [Source:MGI Symbol;Acc:MGI:1346876])

HSP 1 Score: 128.257 bits (321), Expect = 8.631e-30
Identity = 89/261 (34.10%), Postives = 136/261 (52.11%), Query Frame = 2
Query: 1457 IDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPL--DEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDV-KLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHP--YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQ-RIIQDRTIKYNTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
            + +G Y I+   +  S    I +K   EI   D   +  L +E+++ + LK H   ++  G + E  +  I ME + GGS+   ++ K  PL  +E+ I F++KQILEGLKYLHD + V+RD+K  N+LI+  + V K+     SK L   N   E         L+YMAPEI+ + P  YG  AD+WS G  I+EM TG  P+ EL E  A   ++   +       ++S   K FI  C   +P++R+  + L+   FL
Sbjct:  685 LGKGTYGIVYAGRDLSNQVRIAIK---EIPERDSRYSQPLHEEIALHKHLK-HKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETF----TGTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHPEIPESMSAEAKAFILKCFEPDPDKRACANDLLIDEFL 937          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k5 (mitogen-activated protein kinase kinase kinase 5 [Source:MGI Symbol;Acc:MGI:1346876])

HSP 1 Score: 128.257 bits (321), Expect = 8.661e-30
Identity = 89/261 (34.10%), Postives = 136/261 (52.11%), Query Frame = 2
Query: 1457 IDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPL--DEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDV-KLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHP--YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQ-RIIQDRTIKYNTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
            + +G Y I+   +  S    I +K   EI   D   +  L +E+++ + LK H   ++  G + E  +  I ME + GGS+   ++ K  PL  +E+ I F++KQILEGLKYLHD + V+RD+K  N+LI+  + V K+     SK L   N   E         L+YMAPEI+ + P  YG  AD+WS G  I+EM TG  P+ EL E  A   ++   +       ++S   K FI  C   +P++R+  + L+   FL
Sbjct:  693 LGKGTYGIVYAGRDLSNQVRIAIK---EIPERDSRYSQPLHEEIALHKHLK-HKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETF----TGTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHPEIPESMSAEAKAFILKCFEPDPDKRACANDLLIDEFL 945          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Stk4 (serine/threonine kinase 4 [Source:MGI Symbol;Acc:MGI:1929004])

HSP 1 Score: 120.939 bits (302), Expect = 2.027e-28
Identity = 81/262 (30.92%), Postives = 137/262 (52.29%), Query Frame = 2
Query: 1442 EVIEEIDRGYYSILLKAKIKSKDKDIVLKKY-TEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTTAI-SHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
            +V+E++  G Y  + KA  K   + + +K+   E DL ++      +KE+SI Q   S H  +K +G Y +    +I ME    GS+   I+ +NK L E +IA   +  L+GL+YLH    ++RD+K  NIL++ +   KL    ++  L D   K   +      P  +MAPE++Q+  Y   AD+WS G   +EM  G  PY++++   AI  I  +    +    + S N  +F+  CL+ +PE+R++  +L+ H F+
Sbjct:   31 DVLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEI------IKEISIMQQCDSPH-VVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTV---IGTPF-WMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDNFMDFVKQCLVKSPEQRATATQLLQHPFV 281          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Stk3 (serine/threonine kinase 3 [Source:MGI Symbol;Acc:MGI:1928487])

HSP 1 Score: 120.168 bits (300), Expect = 4.539e-28
Identity = 83/272 (30.51%), Postives = 141/272 (51.84%), Query Frame = 2
Query: 1442 EVIEEIDRGYYSILLKAKIKSKDKDIVLKKY-TEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTTAI-SHNLKEFIGLCLIFNPEERSSDDKLMNHSFLNE*NVKEFNI 2248
            +V+E++  G Y  + KA  K   + + +K+   E DL ++      +KE+SI Q   S +  +K +G Y +    +I ME    GS+   I+ +NK L E +IA   K  L+GL+YLH    ++RD+K  NIL++ +   KL    ++  L D   K   +      P  +MAPE++Q+  Y   AD+WS G   +EM  G  PY++++   AI  I  +    +    + S +  +F+  CL+ +PE+R++  +L+ H F+   N K  +I
Sbjct:   26 DVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEI------IKEISIMQQCDSPY-VVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTV---IGTPF-WMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKSPEQRATATQLLQHPFIK--NAKPVSI 284          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6ZN16|M3K15_HUMAN (Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens OX=9606 GN=MAP3K15 PE=1 SV=2)

HSP 1 Score: 132.494 bits (332), Expect = 2.894e-30
Identity = 89/263 (33.84%), Postives = 133/263 (50.57%), Query Frame = 2
Query: 1457 IDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKND-VKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHP--YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTT-AISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLNE*N 2230
            + +G Y I+   +  S    I +K   EI   D   +  L +E+++ + LK H   ++  G   E  Y  I ME + GGS+   ++ K  P+ E  I F++KQILEGLKYLH+ + V+RD+K  N+L++  +  VK+     SK L   N   E         L+YMAPEI+ Q P  YG  AD+WS G  I+EM T   P+ EL E  A    +    I      A+S   + FI  C   +P +R++  +L+   FL + N
Sbjct:  658 LGKGTYGIVYAGRDLSNQVRIAIK---EIPERDSRYSQPLHEEIALHKYLK-HRNIVQYLGSVSENGYIKIFMEQVPGGSLSALLRSKWGPMKEPTIKFYTKQILEGLKYLHENQIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLAGVNPCTETF----TGTLQYMAPEIIDQGPRGYGAPADIWSLGCTIIEMATSKPPFHELGEPQAAMFKVGMFKIHPEIPEALSAEARAFILSCFEPDPHKRATTAELLREGFLRQVN 912          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|A2AQW0|M3K15_MOUSE (Mitogen-activated protein kinase kinase kinase 15 OS=Mus musculus OX=10090 GN=Map3k15 PE=1 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 2.998e-30
Identity = 89/263 (33.84%), Postives = 133/263 (50.57%), Query Frame = 2
Query: 1457 IDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKND-VKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHP--YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTT-AISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLNE*N 2230
            + +G Y I+   +  S    I +K   EI   D+  +  L +E+++ + LK H   ++  G   E  Y  I ME + GGS+   ++ K  P+ E  I F++KQILEGLKYLH+ + V+RD+K  N+L++  +  VK+     SK L   N   E         L+YMAPEI+ Q P  YG  AD+WS G  I+EM T   P+ EL E  A    +    I      A+S   + FI  C   +P++R +   L+   FL + N
Sbjct:  662 LGKGSYGIVYAGRDLSNQVRIAIK---EIPERDIRYSQPLHEEIALHKYLK-HRNIVQYLGSVSENGYIKIFMEQVPGGSLSALLRSKWGPMKEPTIKFYTKQILEGLKYLHENQIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLAGINPCTETF----TGTLQYMAPEIIDQGPRGYGAPADIWSLGCTIIEMATSRPPFHELGEPQAAMFKVGMFKIHPEIPEALSAEARAFILSCFEPDPQKRVTAADLLQEGFLRQVN 916          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99683|M3K5_HUMAN (Mitogen-activated protein kinase kinase kinase 5 OS=Homo sapiens OX=9606 GN=MAP3K5 PE=1 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 5.939e-29
Identity = 89/261 (34.10%), Postives = 136/261 (52.11%), Query Frame = 2
Query: 1457 IDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPL--DEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDV-KLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHP--YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQ-RIIQDRTIKYNTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
            + +G Y I+   +  S    I +K   EI   D   +  L +E+++ + LK H   ++  G + E  +  I ME + GGS+   ++ K  PL  +E+ I F++KQILEGLKYLHD + V+RD+K  N+LI+  + V K+     SK L   N   E         L+YMAPEI+ + P  YG  AD+WS G  I+EM TG  P+ EL E  A   ++   +       ++S   K FI  C   +P++R+  + L+   FL
Sbjct:  686 LGKGTYGIVYAGRDLSNQVRIAIK---EIPERDSRYSQPLHEEIALHKHLK-HKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETF----TGTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHPEIPESMSAEAKAFILKCFEPDPDKRACANDLLVDEFL 938          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|O35099|M3K5_MOUSE (Mitogen-activated protein kinase kinase kinase 5 OS=Mus musculus OX=10090 GN=Map3k5 PE=1 SV=3)

HSP 1 Score: 128.257 bits (321), Expect = 6.058e-29
Identity = 89/261 (34.10%), Postives = 136/261 (52.11%), Query Frame = 2
Query: 1457 IDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPL--DEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDV-KLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHP--YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQ-RIIQDRTIKYNTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
            + +G Y I+   +  S    I +K   EI   D   +  L +E+++ + LK H   ++  G + E  +  I ME + GGS+   ++ K  PL  +E+ I F++KQILEGLKYLHD + V+RD+K  N+LI+  + V K+     SK L   N   E         L+YMAPEI+ + P  YG  AD+WS G  I+EM TG  P+ EL E  A   ++   +       ++S   K FI  C   +P++R+  + L+   FL
Sbjct:  693 LGKGTYGIVYAGRDLSNQVRIAIK---EIPERDSRYSQPLHEEIALHKHLK-HKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETF----TGTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHPEIPESMSAEAKAFILKCFEPDPDKRACANDLLIDEFL 945          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6PA14|STK4_XENLA (Serine/threonine-protein kinase 4 OS=Xenopus laevis OX=8355 GN=stk4 PE=2 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 6.731e-29
Identity = 85/262 (32.44%), Postives = 137/262 (52.29%), Query Frame = 2
Query: 1442 EVIEEIDRGYYSILLKAKIKSKDKDIVLKKY-TEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTTAI-SHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
            +V+E++  G Y  + KA  K   + + +K+   E DL ++      +KE+SI Q   S H  +K +G Y +    +I ME   GGS+   I+ + + L+E +IA   +  L+GL+YLH    ++RD+K  NIL+  +   KL    ++  L D   K   +      P  +MAPE++Q+  Y   AD+WS G   +EM  G  PY+E++   AI  I  +    +    + S +  +FI LCL+ NPE RSS  +L+ H F+
Sbjct:   31 DVLEKLGEGSYGSVYKASHKETSQIVAIKQIPVESDLQEI------IKEISIMQQCDSPH-VVKYYGSYFKNTDLWIVMEFCGGGSVSDIIRLRKQTLNEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLSCEGTAKLADFGVAGQLTDTMAKRNTV---IGTPF-WMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYAEIHPMRAIFMIPSNPPPTFRKPELWSKDFVDFINLCLVKNPELRSSATELLQHPFI 281          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: K0KR26 (Protein kinase domain-containing protein OS=Wickerhamomyces ciferrii (strain F-60-10 / ATCC 14091 / CBS 111 / JCM 3599 / NBRC 0793 / NRRL Y-1031) OX=1206466 GN=BN7_5169 PE=4 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 2.098e-32
Identity = 96/265 (36.23%), Postives = 139/265 (52.45%), Query Frame = 2
Query: 1430 LHDVEVIEEIDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLNE 2224
            L   E  E I RG ++ + +A  K  + ++ +K   EI + D +    L+ E+ + + LK H   +K  G  K +    I +E   GGS++T  KK  PL EKQ+A +  Q+LEGLKYLH Q  V+RD+K +NIL+  K D+KL    +S  +     K   +    N    +MAPEI+        +D+WS GA IVE++TG   YS LNE  A+  I+ D +     T IS   K+FI  C    P ER S  +L NH +L +
Sbjct:  151 LSSYEFKETIGRGAFANVYRAINKITNDEVAIK---EIFIEDDDNILELMCEIDLLKILK-HKNIVKYHGFIKNDKKLLIFLEYCSGGSLRTLYKKQGPLSEKQVAKYLVQVLEGLKYLHSQGVVHRDVKAANILLTSKGDIKLTDFGVSTKVSSNTIKTYSIAGTPN----WMAPEIISMDGTSTASDIWSLGATIVELLTGEPLYSHLNEMAALHAIVTDDSPPI-PTFISELCKDFIMKCFAKQPNERISAKELFNHPWLTK 406          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A8I1H8 (Predicted protein (Fragment) OS=Chlamydomonas reinhardtii OX=3055 GN=CHLREDRAFT_98709 PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 2.425e-32
Identity = 76/269 (28.25%), Postives = 143/269 (53.16%), Query Frame = 2
Query: 1451 EEIDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNN--------VLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLR----YMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQ-RIIQDRTIKYNTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
             +I +G +  + +  + +  ++I +K   ++ LP  N N+         L  E+++ ++L+ H   ++  G  +   +  I +E + GG I + + +  PL E+ +  ++KQIL GL+YLH Q+ ++RD+K +NIL+D    VKL     SK + D       +G   +  +R    +MAPE+++Q  +G  AD+WS G +++EM TG  P++  ++  A+   +   + +     ++SH  K+FI LC    P ER +  +L+ H +L
Sbjct:   12 RQIGQGAFGTVYQGLVHATGQEIAVK---QVQLPRDNANSGKVSEHIRSLESEVAVLRSLR-HENIVRYLGTERTSEHLNIFLEYVAGGPISSKLAQFGPLREETVRVYTKQILRGLEYLHKQKVMHRDIKGANILVDSNGVVKLADFGASKKIEDL----ATIG-GGSRSIRGTANWMAPEVIKQSGHGRAADIWSLGCVVIEMATGRAPWANFSDPYAVMYHVAATKELPAMPDSLSHAAKDFITLCFNRVPRERPNATRLLQHPWL 271          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0BC86 (Protein kinase domain-containing protein OS=Paramecium tetraurelia OX=5888 GN=GSPATT00004247001 PE=3 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 8.776e-32
Identity = 78/217 (35.94%), Postives = 121/217 (55.76%), Query Frame = 2
Query: 1574 LLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTTA--ISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
            L KE+ +   L+ H   ++  G  ++  +  I +E + GGS+++ +++     E  I  + +QIL GL YLH +  ++RD+K  NILID+    KL     SK L D+    + +G     P  YMAPE++ Q  YG KAD+WS G  I+EM TG+ P+SEL +  AI   I   T   +     IS   + F+ LCL  +P++R++ D+L+NH FL
Sbjct:  109 LQKEIQMLSKLQ-HPNIVRYLGCEQKNQFINIFLEYVSGGSVQSMLERFGCFKESLIKTYLRQILLGLSYLHAKNVIHRDIKGGNILIDNSGKCKLADFGSSKQLSDFAH--DTLGSICGTP-NYMAPEVINQEQYGKKADIWSLGCTIIEMATGLPPFSELKDAIAIMVRIGKSTKPPSIPPQLISAESRHFVSLCLQIDPKKRATVDELLNHPFL 321          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: Q233Z3 (Cyclin-dependent kinase-like Serine/Threonine kinase family protein OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=TTHERM_00107120 PE=4 SV=2)

HSP 1 Score: 144.436 bits (363), Expect = 1.505e-31
Identity = 110/340 (32.35%), Postives = 166/340 (48.82%), Query Frame = 2
Query: 1253 EFESSDMVSTLKSNLANNVNSSPDNYALFYYNEY--LDDTKLLF-------DYGINQHSEVKFVCIRNLHDVEVIEEIDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNN----VLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQ----DNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLN 2221
            +F   ++ S L+SN  N +NS   N  LF  N+   L + K L        DY  N+H ++        HDVE+ E +  G Y  + K  IK   K I +K+  ++ L D NK        L+E+++   L+ H   +K +    EE+   I ME M GGS+ + ++K    +E  I  + KQI+ GL YLH Q  V+RD+K +NIL D    VKL     ++Y  D    P   G +        L +MAPE+L Q  +G K+D+WS G  ++EM TG  P+ +      +  I++          +S   K+FI  C  F+ +ER + D L+ H FLN
Sbjct:  877 KFPQFNLQSQLQSNGQNILNSINQNNNLFSLNQMSTLLNIKTLSIKKAISNDYS-NRHDDIMITGTNPFHDVELRELLGEGAYGKVYKGFIKKTGKFIAVKQL-KLGLKDNNKLQEKLEQYLQEIALLNHLE-HPNIVKYYDCKHEEDNILIYMEQMPGGSLSSMLEKFGRFEEALIKKFVKQIISGLAYLHSQGIVHRDIKGANILTDGNGTVKLADFGAARY-RDTICLPTADGSEFCNSIKGSLYWMAPELLNQESHGRKSDIWSLGCTMIEMATGKHPWPDCRTFPQLALIVKTNQCPPIPEHLSDECKDFIRQCCTFDKKERPTADVLLKHPFLN 1212          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: T1EDA5 (Protein kinase domain-containing protein OS=Helobdella robusta OX=6412 GN=20194557 PE=4 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 1.545e-31
Identity = 75/219 (34.25%), Postives = 120/219 (54.79%), Query Frame = 2
Query: 1568 NVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTT-AISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLN 2221
            + L +E++I +    H   ++ FG   +   F I ME M GGS+K  IK+  PL E+    ++KQ+L GL+YLH +  V+RD+K +NIL D++ +VKL     SK L   +    Q        + YM+PE+L  + YG K D+WS G  +VEM+TG  P+ +L    AI +I+      Y+   ++S   ++F+  C   + E R +  +L+ HSF+ 
Sbjct:   50 SALREEINILKEGVKHPHIVQYFGCQDDGVVFSILMEYMPGGSVKDQIKQYGPLTERNTISYTKQVLLGLEYLHKKSIVHRDVKGANILRDNEGNVKLSDFGASKRLQTISNSIMQT---QTGTIYYMSPELLDGNGYGRKTDIWSLGCSVVEMLTGHPPWHQLENFAAIFKIVTSDEPGYSLPDSVSKQARDFVSECFTRSLERRPTSSQLLYHSFVT 265          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-1i11.3 (mitogen-activated protein kinase kinase kinase 5-like [Source:NCBI gene;Acc:103038360])

HSP 1 Score: 134.035 bits (336), Expect = 1.068e-31
Identity = 89/261 (34.10%), Postives = 135/261 (51.72%), Query Frame = 2
Query: 1457 IDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKN-KPL--DEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDV-KLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHP--YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTT-AISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
            + RG Y ++   +  S    I +K   EI   D   +  L +E+++ + LK H   ++  G   E  +  I ME + GGS+ + ++    PL  +E  I F++KQILEGLKYLHD + V+RD+K  N+LI+  + V K+     SK L   N   E         L+YMAPEI+ Q P  YG  AD+WS G  I+EM TG  P+ EL    A    +    I  N   ++S   K  +  C   NP++R++  +L+ ++FL
Sbjct:  636 LGRGTYGVVYAGRDLSNQVRIAIK---EIPEKDSTYSQPLHEEIALHKRLK-HRNIVQYLGSVSEGGFIKIFMEEVPGGSLSSLLRSQWGPLKDNEPTIVFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTGT----LQYMAPEIIDQGPRGYGKPADIWSLGCTIIEMATGKPPFHELGSPQAAMFKVGMFKIHPNVPESMSEEAKACLMCCFESNPDKRATASELLKNAFL 888          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k5 (mitogen-activated protein kinase kinase kinase 5 [Source:NCBI gene;Acc:103033000])

HSP 1 Score: 128.257 bits (321), Expect = 6.775e-30
Identity = 94/295 (31.86%), Postives = 145/295 (49.15%), Query Frame = 2
Query: 1358 DDTKLLFDYGINQHSEVKFVCIRNLHDVEVIEEIDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPL--DEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDV-KLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHP--YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTT-AISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLN 2221
            D   L +DY  ++H E             V+  + +G + ++   +  S    + +K   EI   D   +  L +E+++ + LK H   ++  G   E  +  I ME + GGS+   ++ K  PL  +E  I F++KQILEGLKYLHD +  +RD+K  N+LI+  + V K+     SK L   N   E         L+YMAPEI+ + P  YG  AD+WS G  I+EM TG  P+ EL E  A    +    I      ++S   K FI  C   +P+ R++ ++L+ H FL 
Sbjct:  636 DSEALEYDYEYDEHGE------------RVV--LGKGTFGVVYAGRDLSNQVRLAIK---EIPERDSRYSQPLHEEIALHKHLK-HKNIVQYLGSISENGFIKIFMEQVPGGSLSALLRSKWGPLKNNEPTIGFYTKQILEGLKYLHDNQIAHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTGT----LQYMAPEIIDKGPRGYGKPADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKIHPEIPDSMSSEAKAFILRCFEPDPDLRATANELLTHEFLT 908          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k5 (mitogen-activated protein kinase kinase kinase 5 [Source:NCBI gene;Acc:103033000])

HSP 1 Score: 128.257 bits (321), Expect = 7.077e-30
Identity = 94/295 (31.86%), Postives = 145/295 (49.15%), Query Frame = 2
Query: 1358 DDTKLLFDYGINQHSEVKFVCIRNLHDVEVIEEIDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPL--DEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDV-KLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHP--YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTT-AISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLN 2221
            D   L +DY  ++H E             V+  + +G + ++   +  S    + +K   EI   D   +  L +E+++ + LK H   ++  G   E  +  I ME + GGS+   ++ K  PL  +E  I F++KQILEGLKYLHD +  +RD+K  N+LI+  + V K+     SK L   N   E         L+YMAPEI+ + P  YG  AD+WS G  I+EM TG  P+ EL E  A    +    I      ++S   K FI  C   +P+ R++ ++L+ H FL 
Sbjct:  644 DSEALEYDYEYDEHGE------------RVV--LGKGTFGVVYAGRDLSNQVRLAIK---EIPERDSRYSQPLHEEIALHKHLK-HKNIVQYLGSISENGFIKIFMEQVPGGSLSALLRSKWGPLKNNEPTIGFYTKQILEGLKYLHDNQIAHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTGT----LQYMAPEIIDKGPRGYGKPADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKIHPEIPDSMSSEAKAFILRCFEPDPDLRATANELLTHEFLT 916          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k5 (mitogen-activated protein kinase kinase kinase 5 [Source:NCBI gene;Acc:103033000])

HSP 1 Score: 127.487 bits (319), Expect = 1.139e-29
Identity = 87/262 (33.21%), Postives = 134/262 (51.15%), Query Frame = 2
Query: 1457 IDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPL--DEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDV-KLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHP--YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTT-AISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLN 2221
            + +G + ++   +  S    + +K   EI   D   +  L +E+++ + LK H   ++  G   E  +  I ME + GGS+   ++ K  PL  +E  I F++KQILEGLKYLHD +  +RD+K  N+LI+  + V K+     SK L   N   E         L+YMAPEI+ + P  YG  AD+WS G  I+EM TG  P+ EL E  A    +    I      ++S   K FI  C   +P+ R++ ++L+ H FL 
Sbjct:  652 LGKGTFGVVYAGRDLSNQVRLAIK---EIPERDSRYSQPLHEEIALHKHLK-HKNIVQYLGSISENGFIKIFMEQVPGGSLSALLRSKWGPLKNNEPTIGFYTKQILEGLKYLHDNQIAHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTGT----LQYMAPEIIDKGPRGYGKPADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKIHPEIPDSMSSEAKAFILRCFEPDPDLRATANELLTHEFLT 905          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k15 (mitogen-activated protein kinase kinase kinase 15 [Source:ZFIN;Acc:ZDB-GENE-091204-246])

HSP 1 Score: 127.102 bits (318), Expect = 1.648e-29
Identity = 85/259 (32.82%), Postives = 132/259 (50.97%), Query Frame = 2
Query: 1457 IDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDV-KLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHP--YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTT-AISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
            + RG Y ++   +  S    I +K   EI   D   +  L +E+++ + LK  +  ++  G   E+ Y  I ME + GGS+   ++ K  PL E  I F+++QILEGL+YLH+ + V+RD+K  N+L++  + V K+     SK L   N   E         L+YMAPEI+ + P  YG  AD+WS G  I+EM TG  P+ EL E  A    +    I      ++S   K FI  C   +P +R++   L+   F+
Sbjct:  647 LGRGTYGVVYAGRDLSNQVRIAIK---EIPERDSRYSQPLHEEIALHKYLKQRN-IVQYLGSVSEDGYIKIFMEQVPGGSLSALLRSKWGPLKEATIIFYTRQILEGLRYLHENQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGVNPCTETF----TGTLQYMAPEIIDKGPRGYGAPADIWSLGCTIIEMATGKPPFHELGEPQAAMFKVGMFKIHPEIPESLSTEAKSFILRCFEPDPNKRATAGDLLKDLFV 897          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: plk3 (polo-like kinase 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-030131-6134])

HSP 1 Score: 111.309 bits (277), Expect = 1.049e-25
Identity = 63/217 (29.03%), Postives = 116/217 (53.46%), Query Frame = 2
Query: 1580 KELSIFQTLKSHHR-FLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYN-TTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLNE 2224
            +E+S+ + L  HHR  ++    +K+EN+ YI +E   G S+   ++  K L E ++ ++ +Q++ GL+YLH    V+RDLK  N  + D  +VK+  + L+  L     +   +    N    Y+APE+L +  +G +AD+WS G  +  M+ G  P+S  +  +    I   R+ ++N   ++SH  ++ +   L  +P+ R+S   L +H FL +
Sbjct:   74 QEISLHRKL--HHRHIVQFISSFKDENFIYIILELCNGQSLAHMLRSRKVLTETEVKYYLRQLISGLRYLHQCGVVHRDLKLGNFFVTDSMEVKIGDLGLATTLEPPEMRKRTVCGTPN----YLAPEVLNKRGHGPEADIWSLGCAVFTMLAGRPPFSTSDLANTYACI---RSGRFNFPPSLSHAARDLLTSALTPDPDLRASLLDLQSHPFLTQ 281          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 109.383 bits (272), Expect = 4.284e-25
Identity = 69/220 (31.36%), Postives = 110/220 (50.00%), Query Frame = 2
Query: 1568 NVLLKELSIFQTLKSHHRFLKLFGIYK--EENYFYIAMENMKGGSIKTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLN 2221
            N L  E+ + + L+ H R ++ FG  +  ++    I ME M GGSIK  ++    L E     +++QILEG+ +LH    V+RD+K +NIL D   +VKL     SK L     +   M      P  +M+PE++    YG KAD+WS G  +VEM+T   P++E     AI +I    T        S + ++ +    +   + R S + L+ H F++
Sbjct:  404 NALECEIQLLKNLQ-HERIVQYFGCLRDPQQKTLSIFMEYMPGGSIKDQLRAYGALTENVTRKYTRQILEGVSFLHGNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICSQGTAMRSVTGTPY-WMSPEVINGEGYGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTDPRLPLHASEHARDLLRRIFV-EAKLRPSAEDLLRHPFVH 620          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: stk25a (serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-GENE-041010-92])

HSP 1 Score: 105.531 bits (262), Expect = 2.597e-24
Identity = 82/261 (31.42%), Postives = 134/261 (51.34%), Query Frame = 2
Query: 1451 EEIDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLK-ELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLK--TSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDR--TIKYNTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
            E I +G +  + K  I ++ K++V  K   IDL +       ++ E+++     S +     FG Y +    +I ME + GGS    IK   PL+E QIA   ++IL+GL YLH +  ++RD+K   +N+L+ ++ DVKL    ++  L D   K          P  +MAPE+++Q  Y  KAD+WS G   +E+  G  P SEL+    +  I ++   T++ N    S   KEF+  CL  +P+ R +  +L+ H F+
Sbjct:   30 ERIGKGSFGEVFKG-IDNRTKEVVAIKI--IDLEEAEDEIEDIQQEITVLSQCDSPY-VTHYFGSYLKGTKLWIIMEYLGGGSALDLIKPG-PLEEHQIATILREILKGLDYLHSERKIHRDIKGPAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTF---VGTPF-WMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKNNPPTLEGN---YSKAFKEFVDSCLNKDPQFRPTAKELLKHKFI 278          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: phkg1b (phosphorylase kinase, gamma 1b (muscle) [Source:ZFIN;Acc:ZDB-GENE-050522-52])

HSP 1 Score: 103.605 bits (257), Expect = 6.695e-24
Identity = 77/304 (25.33%), Postives = 142/304 (46.71%), Query Frame = 2
Query: 1379 DYGINQHSEVKFVCIRNLHD-VEVIEEIDRGYYSILLKAKIKSKDKDIVLK-------KYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEIL-----QQHP-YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTTAI---SHNLKEFIGLCLIFNPEERSSDDKLMNHSFLNE*NVKE 2239
            D  I +    + V  ++ +D  E  E +  G  S++ +   K   +D  +K       + +E +L D+  + V  KE+ I + +  H   + L   Y+   +F++  + MK G +  ++ +   L EK      + I E + +LH +  V+RDLK  NIL+DD  +++L     S  L    R  E  G        Y++PE+L     + HP YG + D+W+ G I+  ++ G  P+    +   + R+I D    ++T      S  +K+ I   L+  PE+R + ++ + H F  + +V+E
Sbjct:    4 DLAIPEGDHTEPVAAQDFNDKYEPKEVLGSGVSSVVRRCVHKRTGQDFAVKIIDITPDRLSEEELEDIYSSTV--KEVDILKAVSGHPHIITLIDAYESSTFFFLVFDLMKRGELFDYLTEKVALSEKDTRSIMRSIFEVVHFLHAKNIVHRDLKPENILLDDNMNIRLSDFGFSMQLRPGERLRELCGTPG-----YLSPELLKCSMDESHPGYGKEVDLWACGVIMYTLLAGSPPFWHRKQMTML-RLIMDGKYDFSTPEWEDRSDTVKDLISRLLVVEPEKRFTAEQALAHPFFQQYDVEE 299          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009481.1 (pep scaffold:Pmarinus_7.0:GL477866:614:5163:1 gene:ENSPMAG00000008570.1 transcript:ENSPMAT00000009481.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.219 bits (256), Expect = 1.867e-23
Identity = 70/267 (26.22%), Postives = 134/267 (50.19%), Query Frame = 2
Query: 1439 VEVIEEIDRGYYSI----LLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKPLDEK----------QIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSK--YLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGI-QPYSELNETDAIQRIIQDRTIKYNTTAISHNLKEFIGLCLIFNPEERSS 2188
            V+++ E+ +G + +    L +  +K +D+  V  K T  +   + +    L E S+ ++   HH  ++L G+  +     + ME M  G +K++++  +P  EK          ++   + +I +G+ YL+ ++FV+RDL   N ++ +   VK+    +++  Y  DY RK    G +  LP+R+M+PE L+   +   +DVWSFG ++ E+ T   QPY  L+  + + + + D  +     A    L+E I  C  +NP  R +
Sbjct:   61 VKMMRELGQGTFGMVYEGLARGIVKGEDETRVAIK-TVNETATMRERYEFLNEASVMKSFNCHH-VVRLLGVVSQAQPILVIMELMTRGDLKSYLRSLRPDAEKKPTRPPSSLPEMLQMAGEIADGMAYLNAKKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRK----GGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATQAEQPYQGLS-NEQVLKFVMDGGLLVLPPACPERLQELIRKCWQYNPRMRPT 320          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 115.546 bits (288), Expect = 6.535e-27
Identity = 77/257 (29.96%), Postives = 130/257 (50.58%), Query Frame = 2
Query: 1457 IDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKP-LDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLNE 2224
            I RG Y ++ KA  K  D+ + +K+    +  +LN    ++ E+S+ + L +H+  +K  G  ++    YI +E    GS++  I ++   L E +   +  Q L GLKYLH +  ++RD+K +NIL+   N VKL    +S  +   N     +       L +MAPEIL        +D+WS GA +VEM+T   PY  L + +    +  D    Y  ++ S  LK+F+  C + N  +R + D+L+ H ++N 
Sbjct:   31 IGRGSYGVVYKAINKHTDQVVAIKEVVYENDEELND---IMAEISLLKNL-NHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIV---NSSALTLAGT----LNWMAPEILGNRGASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVEND--TYYPPSSFSEPLKDFLSKCFVKNMYKRPTADQLLKHVWINS 274          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 114.39 bits (285), Expect = 1.834e-26
Identity = 65/214 (30.37%), Postives = 117/214 (54.67%), Query Frame = 2
Query: 1580 KELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPY-GIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
            +E+    +LK      + +G Y ++   +I ME+  GGS+++ ++  K +DEK I    +++L  LK +H    ++RD+K +N+LI ++ +VKL    ++  ++  + + + M         +MAPE++ +  Y   K D+WS G    E+ TG  PY ++    A+Q II+ +  +    + S +LKEFI LCL  +P+ER S D L+   F+
Sbjct:   68 REIQFLASLKQISNITRYYGSYLKDTSLWIIMEHCAGGSLRSLLRPGK-IDEKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMAGTP----YWMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDEDPKERLSADDLLKSKFI 276          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 111.694 bits (278), Expect = 6.792e-26
Identity = 68/230 (29.57%), Postives = 121/230 (52.61%), Query Frame = 2
Query: 1550 PDLNKN------NVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLN 2221
            P  N+N      + L  E+++ + L  H   +  +G  +E     I +E + GGS+ + +    P +E  I  +++QIL G+ YLH +  ++RD+K +NILID K  VK+    +SK L   N+K  +        + +M+PE+++Q     KAD+WS G +++EM TG  P+ + ++  AI +I  + T +  + A S   K F+      + + R S  +L+ H +L+
Sbjct:  487 PKTNQNIHRKMVDALQHEMNLLKELH-HENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQNKRASLQG-SVFWMSPEVVKQTATTAKADIWSTGCVVIEMFTGKHPFPDFSQMQAIFKIGTNTTPEIPSWATSEG-KNFLRKAFELDYQYRPSALELLQHPWLD 713          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 109.383 bits (272), Expect = 5.463e-25
Identity = 64/195 (32.82%), Postives = 106/195 (54.36%), Query Frame = 2
Query: 1661 FYIAMENMKGGSI-------KTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKY-NTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLN 2221
             ++ ME M+GGS+        T+   + PL E QIA+  ++  +GLK+LHD+  ++RD+K+ N+L+D +  VK+        L D   K   M      P  +MAPE+++Q  Y  K DVWS G + +EM+ G  PY   +   A+  I  + T K  +  ++S  +K F+ +CL  +   R+S ++L++H F N
Sbjct:  636 LWVVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCARLTDKRSKRATMV---GTPY-WMAPEVVKQREYDEKIDVWSLGIMTIEMLEGEPPYLNEDPLKALYLIATNGTPKLKHPESLSLEIKRFLSVCLCVDVRYRASTEELLHHGFFN 826          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 107.071 bits (266), Expect = 2.800e-24
Identity = 71/225 (31.56%), Postives = 121/225 (53.78%), Query Frame = 2
Query: 1562 KNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQM-GYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETD--AIQRIIQDRTIKYNTTA-ISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLNE 2224
            K  +++ E+ + +  K H   +     Y  +   ++ ME M+GGS+ T +  +  L E QI    ++ L GL++LH +  ++RD+K+ NIL+  + D+KL        +++ N K   M G        +MAPE++ +  YG K D+WS G +I+EM+ G  PY  LNET   A+  I  + T K      +S +LK+F+  CL   PE+R+S  +L++  ++ E
Sbjct:  658 KKELIINEILVMKGSK-HPNIVNFIDSYVLKGDLWVIMEYMEGGSL-TDVVTHCILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINELNLKRTTMVGTP-----YWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPY--LNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHDEYITE 873          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 125.946 bits (315), Expect = 2.828e-32
Identity = 85/254 (33.46%), Postives = 130/254 (51.18%), Query Frame = 2
Query: 1508 DKDIVLKKYTEIDLPDLNKNNVLLKELSI-FQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQD--NLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLNE*NVKEFNICSCL 2260
             +++ +K+     L    KN V   E  I F     + R ++ +GI  ++ + YI ME + GGSI  HIK++  L+E     +S+QILEG+ YLH    V+RD+K +NIL D   +VKL     SK L     K    G++     P  +MAPE++    YG KADVWS G  +VEM+T   P+++     A+ +I    T     + +S +  EF+   L  N + R S D+L+  SF     V   ++ +CL
Sbjct:   27 GRELAVKQIETGQLNSSTKNEVKALEGEIEFMKAFRNERIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRLQTIRSK---TGFRSVHGTPY-WMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPPWADFEPMAALFKIATQPTEPELPSDLSVDAVEFVRSTLRMNSKSRPSADELLRFSF-----VTNSSMSTCL 271          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO42845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A9])

HSP 1 Score: 124.79 bits (312), Expect = 2.563e-31
Identity = 85/276 (30.80%), Postives = 145/276 (52.54%), Query Frame = 2
Query: 1442 EVIEEIDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTTA-ISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLNE*NVKEFNICSCLF 2263
            +V+E++  G Y  + KA  K   + + +K+   +D  DL +   ++KE+S+ Q   S +  +K +G Y +    +I ME    GS+   +K +NK L E++I    K  L+GL+YLH +  ++RD+K  NIL++ +   KL    ++  L D   K   +      P  +MAPE++Q+  Y   AD+WS G   +EM  G  PY++++   AI  I       +      S + K+F+  CL+ NPEER++  +L+ HSF+     K+ +I S + 
Sbjct:   25 DVLEKLGEGSYGSVFKAMHKESGQVVAIKQ-VPVDT-DLQE---IIKEISMMQQCDSPY-VVKYYGSYFKNTDLWIVMEYCGAGSVSDLMKIRNKTLTEEEIKCVLKYTLKGLEYLHLRRKIHRDIKAGNILLNSEGHAKLADFGVAGQLTDTMAKRNTV---IGTPF-WMAPEVIQEVGYDCLADIWSLGITAMEMAEGKPPYADIHPMRAIFMIPTKPPPTFRDPGQWSEDFKDFVSKCLVKNPEERATATELLQHSFIQ--GAKQISILSSMI 288          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO45846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRL1])

HSP 1 Score: 115.546 bits (288), Expect = 2.229e-28
Identity = 75/277 (27.08%), Postives = 139/277 (50.18%), Query Frame = 2
Query: 1394 QHSEVKFVCIRNLHDVEVIEEIDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSL-SKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQ-DRTIKYNTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
            +H EV     R   ++    +I  G   I+  A  K   + + +KK   +DL    +  +L  E+ I +    H   ++++G +   +  ++ ME ++GG++ T I  +  L E+Q+A   + +L+ L +LH Q  ++RD+K+ +IL+     VKL      ++   D  R+   +G        +MAPE++ + PYG + D+WS G +++EMV G  PY       A++++   +     N   IS  L+ F+   LI +P  R++  +L+NH F+
Sbjct:   14 RHLEVVVQSTRQPENLGNFMKIGEGSTGIVCLATDKRTGRQVAVKK---MDLKKQQRRELLFNEVVIMRDYP-HPNIVEMYGSHLVGDELWVVMEFLEGGTL-TDIVTHTNLSEEQVACVCRAVLKALTFLHSQGVIHRDIKSDSILLTSNGTVKLSDFGFCAQVTEDMPRRKSLVGTP-----YWMAPEVISRKPYGTEVDIWSLGIMVLEMVDGEPPYFNEPPLQAMRKLRDLEPPTSRNPIQISPRLQSFLDNALIRDPLYRATAFELLNHPFI 280          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49138 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH03])

HSP 1 Score: 108.227 bits (269), Expect = 2.925e-26
Identity = 72/260 (27.69%), Postives = 129/260 (49.62%), Query Frame = 2
Query: 1448 IEEIDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKN-KPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLH---DYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTTAISHN----LKEFIGLCLIFNPEERSSDDKLM 2203
            I+ I +G +      + +   +   LK+     +P  +++ + L E+ I  TLK H   ++    ++E   FYI ME  +GG + T IK+  +P   ++I  W  Q+L  LK++H Q  ++RDLKT NI +   + VK+    +++ L    D+ R      Y       Y++PEI Q+ PY  K+D+W+ G ++ E+ T   P++  N T+ + +I+       N   I       L++ + + L  NP +R S  +L+
Sbjct:    7 IDIIGKGTFGSAWLVESRQSKRLYALKELNATAMPSEDRH-LALNEVKILSTLK-HRNIVRYRDAFEETGRFYIVMEYAEGGDLHTKIKQAVEPFSSERILNWLAQLLLALKHIHGQNILHRDLKTQNIFLTKDDVVKIGDFGIARILDSTCDHARTTVGTPY-------YLSPEICQRQPYNNKSDIWALGCVLYELTTRTHPFTADNLTNLVVKILHG-----NYPPIPRFYGPLLEDLVAVMLKINPADRPSAKQLI 252          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO27976 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7S3])

HSP 1 Score: 107.842 bits (268), Expect = 5.844e-26
Identity = 53/161 (32.92%), Postives = 87/161 (54.04%), Query Frame = 2
Query: 1571 VLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKN-DVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPY 2050
             ++ E++I   LK H   +K  G  +   +F I +E M GGSI   + K  P +E  +  + +QIL+G+ YLH+ + V+RD+K +NIL+D    D+++     +  L        +   Q    + +MAPE+L+   YG   DVWS G +++EM TG  P+
Sbjct:   86 TIMDEIAILARLK-HPHLIKCLGATRHTGHFNIFLEWMAGGSISMLLSKYGPFEEAILIRYLRQILQGVSYLHENQVVHRDIKGANILVDSTGQDIRIADFGAAARLATQITGAGEFQGQLLGTIAFMAPEVLRGESYGRSCDVWSVGCVLIEMATGKPPW 245          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000044704.1 (serine/threonine-protein kinase 4 [Source:NCBI gene;Acc:101175466])

HSP 1 Score: 129.798 bits (325), Expect = 1.454e-31
Identity = 82/262 (31.30%), Postives = 138/262 (52.67%), Query Frame = 2
Query: 1442 EVIEEIDRGYYSILLKAKIKSKDKDIVLKKY-TEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKY-NTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
            +V+E++  G Y  + KA  K   + + +K+   E DL ++      +KE+SI Q   S H  ++ +G Y + +  +I ME    GS+   I+ +NK L E++IA      L+GL+YLH    ++RD+K  NIL++ +   KL    ++  L D   K   +      P  +MAPE++Q+  Y   AD+WS G   +EM  G  PY++++   AI  I  +    + N    S N ++F+  CL+ NPE R++  +L+ H F+
Sbjct:   34 DVLEKLGEGSYGCVFKANYKETGEIVAIKQVPVESDLQEI------IKEISIMQQCNSPH-VVRYYGSYFKNSDLWIVMEYCGAGSVSDIIRIRNKTLSEEEIATVVHSTLKGLEYLHFMRKIHRDIKAGNILLNAEGQAKLADFGVAGQLTDTMAKRNTV---IGTPF-WMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRNPDLWSENFRDFVSQCLVKNPENRATATQLLQHPFI 284          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000024938.2 (serine/threonine-protein kinase 4 [Source:NCBI gene;Acc:101175466])

HSP 1 Score: 129.028 bits (323), Expect = 3.496e-31
Identity = 82/262 (31.30%), Postives = 138/262 (52.67%), Query Frame = 2
Query: 1442 EVIEEIDRGYYSILLKAKIKSKDKDIVLKKY-TEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKY-NTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
            +V+E++  G Y  + KA  K   + + +K+   E DL ++      +KE+SI Q   S H  ++ +G Y + +  +I ME    GS+   I+ +NK L E++IA      L+GL+YLH    ++RD+K  NIL++ +   KL    ++  L D   K   +      P  +MAPE++Q+  Y   AD+WS G   +EM  G  PY++++   AI  I  +    + N    S N ++F+  CL+ NPE R++  +L+ H F+
Sbjct:   34 DVLEKLGEGSYGCVFKANYKETGEIVAIKQVPVESDLQEI------IKEISIMQQCNSPH-VVRYYGSYFKNSDLWIVMEYCGAGSVSDIIRIRNKTLSEEEIATVVHSTLKGLEYLHFMRKIHRDIKAGNILLNAEGQAKLADFGVAGQLTDTMAKRNTV---IGTPF-WMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRNPDLWSENFRDFVSQCLVKNPENRATATQLLQHPFI 284          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: si:ch211-1i11.3 (mitogen-activated protein kinase kinase kinase 5 [Source:NCBI gene;Acc:101167985])

HSP 1 Score: 129.413 bits (324), Expect = 3.123e-30
Identity = 88/261 (33.72%), Postives = 134/261 (51.34%), Query Frame = 2
Query: 1457 IDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPL--DEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDV-KLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHP--YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTT-AISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
            + +G Y ++   +  S    I +K   EI   D   +  L +E+++ + LK H   ++  G   ++ +  I ME + GGS+ + ++ K  PL  +E  I F++KQ+LEGLKYLHD + V+RD+K  N+LI+  + V K+     SK L   N   E         L+YMAPEI+ Q P  YG  AD+WS G  I+EM TG  P+ EL    A    +    I       +S   K FI  C   NP+ R++  +L+  +FL
Sbjct:  583 LGKGTYGVVYAGRDLSNQVRIAIK---EIPEKDSTYSQPLHEEIALHKRLK-HRNIVQYLGSVSQDGFIKIFMEEVPGGSLSSLLRSKWGPLKDNEPTIIFYTKQVLEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFAGT----LQYMAPEIIDQGPRGYGKPADIWSLGCTIIEMATGKTPFHELGSPQAAMFKVGMFKIHPKVPECMSDEAKGFIMSCFEPNPDNRATAAELLMDTFL 835          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: si:ch211-1i11.3 (mitogen-activated protein kinase kinase kinase 5 [Source:NCBI gene;Acc:101167985])

HSP 1 Score: 129.413 bits (324), Expect = 3.385e-30
Identity = 88/261 (33.72%), Postives = 134/261 (51.34%), Query Frame = 2
Query: 1457 IDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPL--DEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDV-KLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHP--YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTT-AISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
            + +G Y ++   +  S    I +K   EI   D   +  L +E+++ + LK H   ++  G   ++ +  I ME + GGS+ + ++ K  PL  +E  I F++KQ+LEGLKYLHD + V+RD+K  N+LI+  + V K+     SK L   N   E         L+YMAPEI+ Q P  YG  AD+WS G  I+EM TG  P+ EL    A    +    I       +S   K FI  C   NP+ R++  +L+  +FL
Sbjct:  639 LGKGTYGVVYAGRDLSNQVRIAIK---EIPEKDSTYSQPLHEEIALHKRLK-HRNIVQYLGSVSQDGFIKIFMEEVPGGSLSSLLRSKWGPLKDNEPTIIFYTKQVLEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFAGT----LQYMAPEIIDQGPRGYGKPADIWSLGCTIIEMATGKTPFHELGSPQAAMFKVGMFKIHPKVPECMSDEAKGFIMSCFEPNPDNRATAAELLMDTFL 891          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k15 (mitogen-activated protein kinase kinase kinase 15 [Source:NCBI gene;Acc:101156777])

HSP 1 Score: 124.79 bits (312), Expect = 9.555e-29
Identity = 85/259 (32.82%), Postives = 129/259 (49.81%), Query Frame = 2
Query: 1457 IDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIK-KNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDV-KLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHP--YGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTT-AISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
            + RG Y ++   +  S    I +K   EI   D   +  L +E+++ + LK H   ++  G   E  +  I ME + GGS+   ++ K  PL E  I F+++QILEGL+YLH+ + V+RD+K  N+L++  + V K+     SK L   N   E         L+YMAPEI+ + P  YG  AD+WS G  I+EM TG  P+ EL E  A    +    I      ++S   K FI  C   +P +R     L+   F+
Sbjct:  624 LGRGTYGVVYAGRDLSNQVRIAIK---EIPERDSRYSQPLHEEIALHKYLK-HRNIVQYLGSISENGFIKIFMEQVPGGSLSALLRSKWGPLKEATIIFYTRQILEGLRYLHENQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGVNPCTETF----TGTLQYMAPEIIDKGPRGYGAPADIWSLGCTIIEMATGKPPFHELGEPQAAMFKVGMFKIHPEIPESLSLEAKSFILRCFEPDPNKRPITTDLLKDPFI 874          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000074938.1 (SMESG000074938.1)

HSP 1 Score: 1413.67 bits (3658), Expect = 0.000e+0
Identity = 720/742 (97.04%), Postives = 721/742 (97.17%), Query Frame = 2
Query:   56 MGVISWIRLDILLFLIFVTHQEQPLSICHIDRPFKTMDNTCMNFNELCVKKEDPECNNFKSVCTQCPPVNYTFIMFQKLNRLIEDQKRVEIKTKEINEAVEKLSLKKEIKSVLNSILAFVIILPVLLFIGLLYLIRKNKLSIKVRSRKVKISENEEQGDMLKPLIISQQVSENEEQGDMLKPLIISQQ-------------------DLKIDERXXXXXXXXXXXXXXNFQKLQAFQGIFANQNKDTKFQLKAAAHPIELNIHIDENIVQIKRKIVSKCPTLRKGCYKIMKLHYNGKVLDDNQYFFSCVSCRDVIISCEVNQSLDPNEIIVLNVHSKERMPDLLQIKKTQAVSELKEIISKIIQRKNFVIFQESKELIDSELINESKLVDFDWIKVIIKNHEEIFLRSIFDERENLVVEFESSDMVSTLKSNLANNVNSSPDNYALFYYNEYLDDTKLLFDYGINQHSEVKFVCIRNLHDVEVIEEIDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLNE 2224
            M VISWIRLDILLFLI VTHQEQPLSICHIDRPFKTMDNTCMNFNELCVKKEDPECNNFKSVCTQCPPVNYTFIMFQKLNRLIEDQKRVEIKTKEINEAVEKLSLKKEIKSVLNSILAFVIILPVLLFIGLLYLIRKNKLSIKVRSRKVKISENEEQGDMLKPLIISQQVSENEEQGDMLKPLIISQQ                   DLKIDERFKEFKLFLDLKLEENFQKLQAFQGIFANQNKDTKFQLKAAAHPIELNIHIDENIVQIKRKIVSKCPTLRKGCYKIMKLHYNGKVLDDNQYFFSCVSCRDVIISCEVNQSLDPNEIIVLNVHSKERMPDLLQIKKTQAVSELKEIISKIIQRKNFVIFQESKELIDSELINESKLVDFDWIKVIIKNHEEIFLRSIFDERENLVVEFESSDMVSTLKSNLANNVNSSPDNYALFYYNEYLDDTKLLFDYGINQHSEVKFVCIRNLHDVEVIEEIDRGYYS+LLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLNE
Sbjct:    1 MDVISWIRLDILLFLISVTHQEQPLSICHIDRPFKTMDNTCMNFNELCVKKEDPECNNFKSVCTQCPPVNYTFIMFQKLNRLIEDQKRVEIKTKEINEAVEKLSLKKEIKSVLNSILAFVIILPVLLFIGLLYLIRKNKLSIKVRSRKVKISENEEQGDMLKPLIISQQVSENEEQGDMLKPLIISQQVSENEEQGDMLKPLIINQQDLKIDERFKEFKLFLDLKLEENFQKLQAFQGIFANQNKDTKFQLKAAAHPIELNIHIDENIVQIKRKIVSKCPTLRKGCYKIMKLHYNGKVLDDNQYFFSCVSCRDVIISCEVNQSLDPNEIIVLNVHSKERMPDLLQIKKTQAVSELKEIISKIIQRKNFVIFQESKELIDSELINESKLVDFDWIKVIIKNHEEIFLRSIFDERENLVVEFESSDMVSTLKSNLANNVNSSPDNYALFYYNEYLDDTKLLFDYGINQHSEVKFVCIRNLHDVEVIEEIDRGYYSVLLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLNE 742          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000074921.1 (SMESG000074921.1)

HSP 1 Score: 361.688 bits (927), Expect = 6.193e-114
Identity = 227/736 (30.84%), Postives = 392/736 (53.26%), Query Frame = 2
Query:   80 LDILLFLIF-------VTHQEQPLSICHIDRPFKTMDNTCMNFNELCVKKEDPECNNFKSVCTQCPPVNYTFIMFQKLNRLIEDQKRVE--------IKTKEINEAVEKLSLKKEIKSVLNSILAFVIILPVLLFIGLLYLIRKNKLSIKVRSRKVKISENEEQGDMLKPLIISQQVSENEEQGDMLKPLI--ISQQDLKIDERXXXXXXXXXXXXXXNFQKLQAFQGIFANQNKDTKFQLKAAAHPIELNIHIDENIVQIKRKIVSKCPTLRKGCYKIMKLHYNGKVLDDNQYFFSCVSCRDVIISCEVNQSLDPNEIIVLNVHSKERMPDLLQIKKTQAVSELKEIIS---KIIQRKNFVIFQESKELIDSELINESKLVDFDWIKVIIKNHEEIFLRSIFDERENLVVEFESSDMVSTLKSNLANNVNSSPDNYALFYYNEYLDDTKLLFDYGINQHSEVKFVCIRNLHDVEVI-EEIDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYN--TTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
            + ILL +IF       ++ +E PLS+C I +PFKTM+N+C NF ++CVK  D EC NF++VC QCP  NY+   F  +  + +   ++E        I T  +++  +K+   + I      +L + I+  + L + +L++  + KL  K+         N  Q  +   ++ S++  EN+        +   +S++   ID R      +         +KL     I        KFQ+   + PIELN++++EN++QIKR+I S+ P  ++  YK MK+   GK LDDN Y  + ++     + C ++ S++P + +V+++ S  R+PDL Q+KKT  V E+K +IS   K I         E K+L D   +    L D DWIK+I +   ++ ++S+FD++    + + + D +  LK N A  +     N  LF     L + K ++DY I+  S + F  +     + +    I++ Y+  LL  +     + I++KKY+ +   +L     ++KE+S+FQ  +   +F+KL GIY +E   Y  ME ++  S+   IKKN PL E +I+ W +QILEGL+YLH    ++ +++ +NI++D+K  +KL   ++S  ++ Y      + Y    P RY APEI         AD+WSFG++++ +VTG QPY  L+E++ + +I +D  I ++  T+ +S  LK F+  CLI+NPE+R +  +L+ + F+
Sbjct:    1 MSILLGIIFTFIYSIKISREELPLSMCGIVKPFKTMNNSCANFVDVCVKTGDKECQNFQNVCQQCPAYNYSIQTFLDVRTINDRMSKIEEKINKNQNIITYRMSKIEDKMFQNQNIIINTTLVLVYCIMFMICLILVVLFVEVRFKLCTKIFK-----CLNCRQTQVNYQILKSRKYLENDNLFSKWNEVCQDMSRKMEDIDSRINGITGW--------IEKLLTMPTIVI-----IKFQVTGLSKPIELNVNLNENVIQIKRRICSRWPAAQRDSYKKMKVIDKGKYLDDNHYLLTQINSIASTLKCSIDDSINPEDFLVISLRSNRRIPDLFQVKKTSTVKEMKILISSINKFISDPVIKEMYEGKDLNDMNTLESYSLRDDDWIKIITRESGDLTIKSLFDDKIQYSISYSNFDSIENLKRNFAKKIQLDSVNLVLFLNELDLKNQKFVYDYDIDMDSSLSFCFLERWSGINITGNAIEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAKMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNIS--VNIYETDGLFINYS-VFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTAQQLLENEFI 715          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000074921.1 (SMESG000074921.1)

HSP 1 Score: 360.918 bits (925), Expect = 9.116e-114
Identity = 225/728 (30.91%), Postives = 387/728 (53.16%), Query Frame = 2
Query:   80 LDILLFLIF-------VTHQEQPLSICHIDRPFKTMDNTCMNFNELCVKKEDPECNNFKSVCTQCPPVNYTFIMFQKLNRLIEDQKRVEIKTKEINEAVEKLSLKKEIKSVLNSILAFVIILPVLLFIGLLYLIRKNKLSIKVRSRKVKISENEEQGDMLKPLIISQQVSENEEQGDMLKPLI--ISQQDLKIDERXXXXXXXXXXXXXXNFQKLQAFQGIFANQNKDTKFQLKAAAHPIELNIHIDENIVQIKRKIVSKCPTLRKGCYKIMKLHYNGKVLDDNQYFFSCVSCRDVIISCEVNQSLDPNEIIVLNVHSKERMPDLLQIKKTQAVSELKEIIS---KIIQRKNFVIFQESKELIDSELINESKLVDFDWIKVIIKNHEEIFLRSIFDERENLVVEFESSDMVSTLKSNLANNVNSSPDNYALFYYNEYLDDTKLLFDYGINQHSEVKFVCIRNLHDVEVI-EEIDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYN--TTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 2218
            + ILL +IF       ++ +E PLS+C I +PFKTM+N+C NF ++CVK  D EC NF++VC QCP  NY+   F  +  + +   ++E K  +    +   +L          +L + I+  + L + +L++  + KL  K+         N  Q  +   ++ S++  EN+        +   +S++   ID R      +         +KL     I        KFQ+   + PIELN++++EN++QIKR+I S+ P  ++  YK MK+   GK LDDN Y  + ++     + C ++ S++P + +V+++ S  R+PDL Q+KKT  V E+K +IS   K I         E K+L D   +    L D DWIK+I +   ++ ++S+FD++    + + + D +  LK N A  +     N  LF     L + K ++DY I+  S + F  +     + +    I++ Y+  LL  +     + I++KKY+ +   +L     ++KE+S+FQ  +   +F+KL GIY +E   Y  ME ++  S+   IKKN PL E +I+ W +QILEGL+YLH    ++ +++ +NI++D+K  +KL   ++S  ++ Y      + Y    P RY APEI         AD+WSFG++++ +VTG QPY  L+E++ + +I +D  I ++  T+ +S  LK F+  CLI+NPE+R +  +L+ + F+
Sbjct:    1 MSILLGIIFTFIYSIKISREELPLSMCGIVKPFKTMNNSCANFVDVCVKTGDKECQNFQNVCQQCPAYNYSIQTFLDVRTINDRMSKIEDKMFQNQNIIINTTL----------VLVYCIMFMICLILVVLFVEVRFKLCTKIFK-----CLNCRQTQVNYQILKSRKYLENDNLFSKWNEVCQDMSRKMEDIDSRINGITGW--------IEKLLTMPTIVI-----IKFQVTGLSKPIELNVNLNENVIQIKRRICSRWPAAQRDSYKKMKVIDKGKYLDDNHYLLTQINSIASTLKCSIDDSINPEDFLVISLRSNRRIPDLFQVKKTSTVKEMKILISSINKFISDPVIKEMYEGKDLNDMNTLESYSLRDDDWIKIITRESGDLTIKSLFDDKIQYSISYSNFDSIENLKRNFAKKIQLDSVNLVLFLNELDLKNQKFVYDYDIDMDSSLSFCFLERWSGINITGNAIEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAKMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNIS--VNIYETDGLFINYS-VFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTAQQLLENEFI 697          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000074914.1 (SMESG000074914.1)

HSP 1 Score: 357.451 bits (916), Expect = 1.472e-112
Identity = 204/509 (40.08%), Postives = 313/509 (61.49%), Query Frame = 2
Query:  728 NKDTKFQLKAAAHPIELNIHIDENIVQIKRKIVSKCPTLRKGCYKIMKLHYNGKVLDDNQYFFSCVSCRDVIISCEVNQSLDPNEIIVLNVHSKERMPDLLQIKKTQAVSELKEIISKIIQRKNFVIFQESKELI---DSELINESKLVDFDWIKVIIKNHEEIFLRSIFDERENLVVEFESSDMVSTLKSNLANNVNSSPDNYALFYYNEYLDDTKLLFDYGINQHSEVKFVCIRNLHDVEVIE-EIDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKP---EQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETD----AIQRIIQDRTIKYNTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLN 2221
            N   KF +     PIEL+++  +N++QIKR+I +K P  +   YK+M+L YN + LDDNQY    VS  +V + CE+N  ++ + IIVL V+  +R+P+++Q+ K Q ++E+K+II+KI+    FVIF++ + LI   D+  I E  L D DWI++I K   ++ ++S+F+E E  V+++ + D VS LK   A  +   P+++ LF+ N+YLD+    FDY I+  S VKF C+  L    + + ++D G +S L KAK  +K +D+++KKY E    +L  N  +L EL  +Q  KS  RF++L  I K+E + Y  +ENM+GGSI T +K N PL    I  WS QIL+GLK+LH  + ++R+L TSNIL+D   +VKL S S SKYLH Y  +    E MG Q     RY+APE++ +  YG +AD+WSFG I+VE++ G  PY     TD     I + I++   K+ +  I   LK F+ +CL  +P+ER++ ++L  + FLN
Sbjct:  182 NSKLKFLISGLEKPIELHVNEKDNVIQIKRQICAKWPKAKPHYYKLMRLRYNERYLDDNQYLLLSVSSINVTVVCEMNHKINHSNIIVLKVNGNKRLPEMIQLHKDQKINEIKQIIAKIVYSAEFVIFKDGQNLIELKDNLTIKECNLKDDDWIRIIAKEKGKLVIKSVFEENEPCVIDYSNLDHVSDLKKKAAMKMICDPEDFVLFHNNKYLDEDNYFFDYEIDNESTVKFCCLTKLGQSTLFDGKLDEGDFSELFKAKWGAKFEDVLIKKY-EKSSKNLGDNQDILNELITYQITKSQPRFVQLIRICKDERFLYGILENMEGGSITTFLKDNWPLTNDDIKKWSFQILQGLKFLHYNKIIHRNLSTSNILVDGNRNVKLLSFSTSKYLHGYETQSFDKEFMG-QTEKSSRYLAPEVVNRKQYGAQADIWSFGMILVEIINGKPPY--FKSTDEEAIEIIKEIKESGYKFLSEKICSQLKHFVEICLHPDPKERATIEELFENKFLN 686          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000074914.1 (SMESG000074914.1)

HSP 1 Score: 357.451 bits (916), Expect = 2.908e-112
Identity = 204/509 (40.08%), Postives = 313/509 (61.49%), Query Frame = 2
Query:  728 NKDTKFQLKAAAHPIELNIHIDENIVQIKRKIVSKCPTLRKGCYKIMKLHYNGKVLDDNQYFFSCVSCRDVIISCEVNQSLDPNEIIVLNVHSKERMPDLLQIKKTQAVSELKEIISKIIQRKNFVIFQESKELI---DSELINESKLVDFDWIKVIIKNHEEIFLRSIFDERENLVVEFESSDMVSTLKSNLANNVNSSPDNYALFYYNEYLDDTKLLFDYGINQHSEVKFVCIRNLHDVEVIE-EIDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKP---EQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETD----AIQRIIQDRTIKYNTTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFLN 2221
            N   KF +     PIEL+++  +N++QIKR+I +K P  +   YK+M+L YN + LDDNQY    VS  +V + CE+N  ++ + IIVL V+  +R+P+++Q+ K Q ++E+K+II+KI+    FVIF++ + LI   D+  I E  L D DWI++I K   ++ ++S+F+E E  V+++ + D VS LK   A  +   P+++ LF+ N+YLD+    FDY I+  S VKF C+  L    + + ++D G +S L KAK  +K +D+++KKY E    +L  N  +L EL  +Q  KS  RF++L  I K+E + Y  +ENM+GGSI T +K N PL    I  WS QIL+GLK+LH  + ++R+L TSNIL+D   +VKL S S SKYLH Y  +    E MG Q     RY+APE++ +  YG +AD+WSFG I+VE++ G  PY     TD     I + I++   K+ +  I   LK F+ +CL  +P+ER++ ++L  + FLN
Sbjct:  211 NSKLKFLISGLEKPIELHVNEKDNVIQIKRQICAKWPKAKPHYYKLMRLRYNERYLDDNQYLLLSVSSINVTVVCEMNHKINHSNIIVLKVNGNKRLPEMIQLHKDQKINEIKQIIAKIVYSAEFVIFKDGQNLIELKDNLTIKECNLKDDDWIRIIAKEKGKLVIKSVFEENEPCVIDYSNLDHVSDLKKKAAMKMICDPEDFVLFHNNKYLDEDNYFFDYEIDNESTVKFCCLTKLGQSTLFDGKLDEGDFSELFKAKWGAKFEDVLIKKY-EKSSKNLGDNQDILNELITYQITKSQPRFVQLIRICKDERFLYGILENMEGGSITTFLKDNWPLTNDDIKKWSFQILQGLKFLHYNKIIHRNLSTSNILVDGNRNVKLLSFSTSKYLHGYETQSFDKEFMG-QTEKSSRYLAPEVVNRKQYGAQADIWSFGMILVEIINGKPPY--FKSTDEEAIEIIKEIKESGYKFLSEKICSQLKHFVEICLHPDPKERATIEELFENKFLN 715          

HSP 2 Score: 65.0846 bits (157), Expect = 1.510e-10
Identity = 31/76 (40.79%), Postives = 47/76 (61.84%), Query Frame = 2
Query:   86 ILLFLIF-VTHQEQPLSICHIDRPFKTMDNTCMNFNELCVKKEDPECNNFKSVCTQCPPVNYTFIMFQKLNRLIED 310
            + +F+I  VT+ E P S C   +P+K M  TC +++E+C KK+D +C N ++VC QCP V    + F  LN+  ED
Sbjct:    3 LFIFIIATVTYGEVPRSFCQNPKPYKVMVGTCASYSEVCYKKDDKDCENLQNVCAQCPSVTEKLLNF--LNKNKED 76          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP3K156.027e-3133.84mitogen-activated protein kinase kinase kinase 15 ... [more]
MAP3K51.237e-2934.10mitogen-activated protein kinase kinase kinase 5 [... [more]
STK47.274e-2930.92serine/threonine kinase 4 [Source:HGNC Symbol;Acc:... [more]
STK42.459e-2830.92serine/threonine kinase 4 [Source:HGNC Symbol;Acc:... [more]
STK36.472e-2830.88serine/threonine kinase 3 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nsy-19.182e-2831.82Mitogen-activated protein kinase kinase kinase nsy... [more]
cst-29.269e-2831.42Caenorhabditis STE20-like kinase [Source:UniProtK... [more]
nsy-11.133e-2731.82Mitogen-activated protein kinase kinase kinase nsy... [more]
cst-12.329e-2731.42Serine/threonine-protein kinase cst-1 Serine/threo... [more]
cst-12.347e-2731.42Serine/threonine-protein kinase cst-1 Serine/threo... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ask13.464e-2933.96gene:FBgn0014006 transcript:FBtr0300256[more]
Ask14.050e-2933.96gene:FBgn0014006 transcript:FBtr0083819[more]
mbt5.805e-2427.72gene:FBgn0025743 transcript:FBtr0074285[more]
aPKC2.106e-2225.53gene:FBgn0261854 transcript:FBtr0303429[more]
aPKC2.172e-2225.53gene:FBgn0261854 transcript:FBtr0303433[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-1i11.31.021e-3131.80si:ch211-1i11.3 [Source:ZFIN;Acc:ZDB-GENE-030131-8... [more]
si:ch211-1i11.31.119e-3131.80si:ch211-1i11.3 [Source:ZFIN;Acc:ZDB-GENE-030131-8... [more]
si:ch211-1i11.31.237e-3131.80si:ch211-1i11.3 [Source:ZFIN;Acc:ZDB-GENE-030131-8... [more]
map3k51.280e-2933.21mitogen-activated protein kinase kinase kinase 5 [... [more]
map3k51.489e-2933.21mitogen-activated protein kinase kinase kinase 5 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP3K151.128e-3134.22mitogen-activated protein kinase kinase kinase 5 [... [more]
MAP3K151.465e-3134.22mitogen-activated protein kinase kinase kinase 5 [... [more]
MAP3K151.532e-3134.22mitogen-activated protein kinase kinase kinase 5 [... [more]
MAP3K151.717e-3134.22mitogen-activated protein kinase kinase kinase 5 [... [more]
MAP3K151.721e-3134.22mitogen-activated protein kinase kinase kinase 5 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Map3k154.286e-3133.84mitogen-activated protein kinase kinase kinase 15 ... [more]
Map3k58.631e-3034.10mitogen-activated protein kinase kinase kinase 5 [... [more]
Map3k58.661e-3034.10mitogen-activated protein kinase kinase kinase 5 [... [more]
Stk42.027e-2830.92serine/threonine kinase 4 [Source:MGI Symbol;Acc:M... [more]
Stk34.539e-2830.51serine/threonine kinase 3 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6ZN16|M3K15_HUMAN2.894e-3033.84Mitogen-activated protein kinase kinase kinase 15 ... [more]
sp|A2AQW0|M3K15_MOUSE2.998e-3033.84Mitogen-activated protein kinase kinase kinase 15 ... [more]
sp|Q99683|M3K5_HUMAN5.939e-2934.10Mitogen-activated protein kinase kinase kinase 5 O... [more]
sp|O35099|M3K5_MOUSE6.058e-2934.10Mitogen-activated protein kinase kinase kinase 5 O... [more]
sp|Q6PA14|STK4_XENLA6.731e-2932.44Serine/threonine-protein kinase 4 OS=Xenopus laevi... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K0KR262.098e-3236.23Protein kinase domain-containing protein OS=Wicker... [more]
A8I1H82.425e-3228.25Predicted protein (Fragment) OS=Chlamydomonas rein... [more]
A0BC868.776e-3235.94Protein kinase domain-containing protein OS=Parame... [more]
Q233Z31.505e-3132.35Cyclin-dependent kinase-like Serine/Threonine kina... [more]
T1EDA51.545e-3134.25Protein kinase domain-containing protein OS=Helobd... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-1i11.31.068e-3134.10mitogen-activated protein kinase kinase kinase 5-l... [more]
map3k56.775e-3031.86mitogen-activated protein kinase kinase kinase 5 [... [more]
map3k57.077e-3031.86mitogen-activated protein kinase kinase kinase 5 [... [more]
map3k51.139e-2933.21mitogen-activated protein kinase kinase kinase 5 [... [more]
map3k151.648e-2932.82mitogen-activated protein kinase kinase kinase 15 ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plk31.049e-2529.03polo-like kinase 3 (Drosophila) [Source:ZFIN;Acc:Z... [more]
map3k24.284e-2531.36mitogen-activated protein kinase kinase kinase 2 [... [more]
stk25a2.597e-2431.42serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-G... [more]
phkg1b6.695e-2425.33phosphorylase kinase, gamma 1b (muscle) [Source:ZF... [more]
ENSPMAT00000009481.11.867e-2326.22pep scaffold:Pmarinus_7.0:GL477866:614:5163:1 gene... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC156.535e-2729.96Protein kinase of the Mitotic Exit Network; locali... [more]
KIC11.834e-2630.37Protein kinase of the PAK/Ste20 family, required f... [more]
STE116.792e-2629.57Signal transducing MEK kinase; involved in pheromo... [more]
CLA45.463e-2532.82Cdc42p-activated signal transducing kinase; member... [more]
STE202.800e-2431.56Cdc42p-activated signal transducing kinase; involv... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO414102.828e-3233.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428452.563e-3130.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458462.229e-2827.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491382.925e-2627.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279765.844e-2632.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000044704.11.454e-3131.30serine/threonine-protein kinase 4 [Source:NCBI gen... [more]
ENSORLT00000024938.23.496e-3131.30serine/threonine-protein kinase 4 [Source:NCBI gen... [more]
si:ch211-1i11.33.123e-3033.72mitogen-activated protein kinase kinase kinase 5 [... [more]
si:ch211-1i11.33.385e-3033.72mitogen-activated protein kinase kinase kinase 5 [... [more]
map3k159.555e-2932.82mitogen-activated protein kinase kinase kinase 15 ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074938.10.000e+097.04SMESG000074938.1[more]
SMESG000074921.16.193e-11430.84SMESG000074921.1[more]
SMESG000074921.19.116e-11430.91SMESG000074921.1[more]
SMESG000074914.11.472e-11240.08SMESG000074914.1[more]
SMESG000074914.12.908e-11240.08SMESG000074914.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008292 ID=SMED30008292|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2303bp
CATTGATCGATATTCACAGATTGTTTTTAAGTCAATATAATATTTGTTTG
AAACGATGGGTGTAATTTCGTGGATAAGGTTAGACATTTTGCTTTTCCTT
ATATTCGTGACCCATCAAGAGCAACCTTTATCAATTTGCCATATTGACCG
GCCATTCAAAACGATGGACAATACTTGCATGAATTTTAATGAACTCTGTG
TAAAAAAAGAGGATCCGGAATGTAACAATTTTAAAAGCGTTTGTACACAG
TGTCCGCCGGTCAACTATACATTTATCATGTTTCAAAAGCTGAACAGATT
GATAGAAGATCAGAAAAGAGTTGAAATAAAGACAAAGGAAATTAATGAAG
CAGTTGAGAAGCTCTCGTTGAAAAAAGAAATAAAATCTGTATTAAACTCC
ATTCTTGCTTTTGTAATCATTCTGCCAGTGCTGCTGTTTATTGGACTTCT
ATATTTAATACGAAAAAATAAACTATCAATTAAAGTAAGATCGAGAAAAG
TAAAAATATCAGAAAATGAAGAACAGGGGGATATGTTGAAACCATTAATC
ATAAGCCAACAAGTATCAGAAAATGAAGAACAGGGGGATATGTTGAAACC
ATTAATCATAAGCCAACAAGATTTGAAAATTGATGAAAGGTTCAAAGAAT
TTAAACTCTTCCTTGATTTGAAACTTGAAGAAAACTTTCAAAAATTACAA
GCCTTCCAAGGAATATTTGCAAATCAAAATAAAGATACGAAATTCCAACT
GAAGGCAGCAGCACATCCAATCGAACTTAACATTCACATAGATGAGAATA
TTGTGCAGATAAAGCGGAAAATAGTTAGCAAGTGCCCGACATTAAGGAAG
GGCTGCTATAAAATAATGAAACTGCATTATAATGGAAAAGTCCTAGATGA
CAACCAATATTTCTTTTCCTGTGTAAGTTGCCGAGACGTGATCATTTCCT
GTGAAGTCAATCAGTCGCTCGATCCCAACGAAATCATAGTTCTAAACGTC
CATAGTAAAGAACGGATGCCAGACTTATTGCAAATTAAGAAAACCCAAGC
CGTATCAGAATTAAAAGAAATAATTTCTAAAATAATTCAACGTAAAAATT
TTGTCATTTTCCAAGAATCAAAGGAATTAATTGACAGCGAATTAATTAAT
GAATCAAAATTAGTTGATTTTGATTGGATAAAAGTGATTATCAAGAATCA
TGAAGAAATATTCCTCAGGTCGATCTTTGATGAAAGAGAGAATTTAGTTG
TAGAATTCGAAAGTTCCGATATGGTTTCGACTCTCAAATCGAATCTTGCT
AATAACGTTAACTCTTCTCCCGACAATTATGCTTTGTTTTACTATAATGA
GTATCTGGATGACACAAAATTACTTTTTGATTACGGCATTAATCAACATT
CAGAGGTCAAATTCGTCTGCATTCGAAACCTCCACGACGTTGAAGTCATT
GAAGAAATAGATAGAGGATATTATTCGATTTTGTTGAAAGCAAAAATTAA
ATCCAAAGATAAAGACATCGTTCTAAAGAAGTACACAGAAATTGATCTGC
CAGATTTAAACAAAAATAATGTTCTCCTAAAAGAATTGTCAATATTTCAG
ACTTTGAAATCGCATCATAGGTTTCTGAAACTGTTTGGAATATATAAAGA
GGAAAATTATTTCTATATTGCAATGGAGAATATGAAAGGAGGGTCAATAA
AGACACATATTAAGAAAAATAAGCCCTTAGATGAAAAACAGATAGCTTTT
TGGTCAAAGCAGATTTTAGAGGGACTGAAATATCTCCACGATCAAGAATT
TGTCTATCGAGATTTGAAGACTTCTAATATTTTAATCGACGACAAAAACG
ATGTAAAACTACCAAGTGTGAGTCTGTCGAAGTATCTTCATGATTATAAC
AGAAAACCCGAACAAATGGGATATCAGGACAATTTACCCTTACGCTACAT
GGCACCAGAAATTTTACAACAACACCCATACGGAATAAAGGCAGATGTTT
GGTCTTTCGGAGCAATAATCGTGGAAATGGTTACAGGAATTCAGCCGTAT
AGCGAATTGAATGAAACAGATGCAATTCAAAGAATCATACAAGACCGAAC
AATTAAATATAATACAACCGCCATATCTCATAATTTAAAAGAATTTATTG
GTTTATGTCTAATATTCAACCCTGAAGAAAGGTCATCAGATGATAAATTA
ATGAATCATTCGTTTTTAAATGAATGAAATGTAAAAGAATTCAATATATG
CAGCTGTTTATTCTATTAATATTTCTGTAGCTATGTAATTCAAAATAATT
TAT
back to top

protein sequence of SMED30008292-orf-1

>SMED30008292-orf-1 ID=SMED30008292-orf-1|Name=SMED30008292-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=724bp
MGVISWIRLDILLFLIFVTHQEQPLSICHIDRPFKTMDNTCMNFNELCVK
KEDPECNNFKSVCTQCPPVNYTFIMFQKLNRLIEDQKRVEIKTKEINEAV
EKLSLKKEIKSVLNSILAFVIILPVLLFIGLLYLIRKNKLSIKVRSRKVK
ISENEEQGDMLKPLIISQQVSENEEQGDMLKPLIISQQDLKIDERFKEFK
LFLDLKLEENFQKLQAFQGIFANQNKDTKFQLKAAAHPIELNIHIDENIV
QIKRKIVSKCPTLRKGCYKIMKLHYNGKVLDDNQYFFSCVSCRDVIISCE
VNQSLDPNEIIVLNVHSKERMPDLLQIKKTQAVSELKEIISKIIQRKNFV
IFQESKELIDSELINESKLVDFDWIKVIIKNHEEIFLRSIFDERENLVVE
FESSDMVSTLKSNLANNVNSSPDNYALFYYNEYLDDTKLLFDYGINQHSE
VKFVCIRNLHDVEVIEEIDRGYYSILLKAKIKSKDKDIVLKKYTEIDLPD
LNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKT
HIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDV
KLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWS
FGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTTAISHNLKEFIGL
CLIFNPEERSSDDKLMNHSFLNE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR000719Prot_kinase_dom
IPR000626Ubiquitin-like_dom
IPR008271Ser/Thr_kinase_AS
IPR029071Ubiquitin-like_domsf
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0023014signal transduction by protein phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0005515protein binding
GO:0004674protein serine/threonine kinase activity
GO:0004702signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0016301kinase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPRINTSPR00109TYRKINASEcoord: 646..668
score: 32.75
coord: 576..594
score: 42.56
coord: 627..637
score: 47.52
coord: 540..553
score: 26.83
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 462..721
e-value: 4.0E-47
score: 172.6
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 463..721
e-value: 3.3E-52
score: 177.5
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 462..721
score: 38.351
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 450..723
e-value: 5.3E-61
score: 208.0
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 385..449
e-value: 3.7E-7
score: 31.8
NoneNo IPR availablePANTHERPTHR11584SERINE/THREONINE PROTEIN KINASEcoord: 452..721
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.731
NoneNo IPR availableTMHMMTMhelixcoord: 112..134
IPR000626Ubiquitin-like domainPFAMPF00240ubiquitincoord: 385..455
e-value: 4.0E-7
score: 29.7
IPR000626Ubiquitin-like domainPROSITEPS50053UBIQUITIN_2coord: 375..454
score: 11.987
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 582..594
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 460..722
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 394..452