Nck-associated protein 1

Overview
NameNck-associated protein 1
Smed IDSMED30008269
Length (bp)3988
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nck-associated protein 1 (SMED30008269) t-SNE clustered cells

Violin plots show distribution of expression levels for Nck-associated protein 1 (SMED30008269) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nck-associated protein 1 (SMED30008269) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nck-associated protein 1 (SMED30008269) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008269

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30008269SMESG000051120.1 dd_Smed_v4_2387_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008269SMESG000051120.1 dd_Smed_v4_2387_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008269SMESG000051120.1 dd_Smed_v4_2387_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008269SMESG000051120.1 dd_Smed_v4_2387_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nck-associated protein 1 vs. Ensembl Human
Match: NCKAP1 (NCK associated protein 1 [Source:HGNC Symbol;Acc:HGNC:7666])

HSP 1 Score: 474.937 bits (1221), Expect = 3.547e-146
Identity = 338/1193 (28.33%), Postives = 590/1193 (49.46%), Query Frame = 2
Query:  104 LKPNISKITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVP----PLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRP-LLINNRTFQPNLYLKKEL-LKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHT---PLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMED-QTNELLIAATSYLLPRIVGS--NFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQS 3625
            L+P+  K+ EKL IL++R   +L ++ ++K          S +   +  ES ++ +V+KFP ++ +NN   +  L    S+IL  L  +Y T VDV+E KD++ +L   I   Q   +I+++FD+T+ YLDLI  Y+ +MI+LS I + K+I+ LYN+A        +  Y RL + +V+       + ++  E  P+S+++ +A+ SL  +   +  S  +W   +  +LIS+  P  +LN + S  +P C+      +E+WIIFG++  +  L  + +AL LW+  L  S  + LFR E   IH          RGY K  N ++E  +   +++   HR RR +LR A++    ++ D PG + P  + +   ++ A DE+ WL+RH + +P K       DDF D+ + E I  +EELR +++++  VM++YY   L   D   L   + + +    +D+  I+  F   + ++++ Q     + D +   F+ +RLDWFRLQ Y S   A       +E  + MN+I+ H+ +VD+L   + + S +    F+     + F+  L+  +Q RY++ FP +C HF++     CP++ + I   S+ + + +L  + ++   L+TD+      L+ +L P +            AK  S   N                 PG+ES   +       D    AL++L   +N  P +++   TF P  YL   L ++F      T S V +         I +PSE+L  ++  M+++  +  +V I+  ++F +  L+Q+   +  G  T+T +Y NWY++ +L Q    H    P +K F+ LP   +    +  N EEY+DI E+R+L E++GP+GMK L E +M  I   V+ L++ V+ N   L ++        ++  L   +  VD   +    +G++  F+ L +EAL DV+   +PFL S++ D +   D  P        E D ++       + + EL    GL  ++D  L  A+           S +  NI   E+ +   LL+   +  LP +  +  + Y    E    + HC A AI ++    F  + +  ++D+++ F+AL SS+LL++G ET  ++           NR+S+Y+  D I+Q    ++ D  E CFPY L+R AYH V KQS
Sbjct:    6 LQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKN-LESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVFFDITVNFDLTKNYLDLIITYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQMIVDYE---NPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISA--PSTMLNPAQSDTMP-CEYLSLDAMEKWIIFGFILCHGILNTDATALNLWKLALQSSSCLSLFRDEVFHIHKAAEDLFVNIRGYNKRINDIRECKEAAVSHAGSMHRERRKFLRSALKELATVLSDQPGLLGPKALFVFMALSFARDEIIWLLRHADNMPKK-----SADDFIDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLSGFDAVVLNELVQN-LSVCPEDESIIMSSFVNTMTSLSVKQ-----VEDGEVFDFRGMRLDWFRLQAYTSVSKASLGLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELPSQSRYSIAFPLLCTHFMSCTHELCPEERHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTLSDQLLPKHC-----------AKTISQAVNKKSKKQTGKKGEPEREKPGVESMRKNRLVVTNLDKLHTALSELCFSINYVPNMVVWEHTFTPREYLTSHLEIRF------TKSIVGMTMYNQATQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHGEPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENE----LTFNAEEYSDISEMRSLSELLGPYGMKFLSESLMWHISSQVAELKKLVVENVDVLTQMRTSFDKPDQMAALFKRLSSVDSVLKRMTIIGVILSFRSLAQEALRDVLSYHIPFLVSSIEDFK---DHIP-------RETDMKV------AMNVYELSSAAGLPCEIDPALVVALS----------SQKSENISPEEEYKIACLLMVFVAVSLPTLASNVMSQYSPAIEGHCNNIHCLAKAINQIAAALFTIH-KGSIEDRLKEFLALASSSLLKIGQETDKTT---------TRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQS 1123          
BLAST of Nck-associated protein 1 vs. Ensembl Human
Match: NCKAP1 (NCK associated protein 1 [Source:HGNC Symbol;Acc:HGNC:7666])

HSP 1 Score: 472.626 bits (1215), Expect = 2.408e-145
Identity = 338/1198 (28.21%), Postives = 590/1198 (49.25%), Query Frame = 2
Query:  104 LKPNISKITEKLKILSERMTVVLIQIDSLKNLLQT-----ENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVP----PLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRP-LLINNRTFQPNLYLKKEL-LKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHT---PLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMED-QTNELLIAATSYLLPRIVGS--NFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQS 3625
            L+P+  K+ EKL IL++R   +L ++ ++K   Q      +         +   ES ++ +V+KFP ++ +NN   +  L    S+IL  L  +Y T VDV+E KD++ +L   I   Q   +I+++FD+T+ YLDLI  Y+ +MI+LS I + K+I+ LYN+A        +  Y RL + +V+       + ++  E  P+S+++ +A+ SL  +   +  S  +W   +  +LIS+  P  +LN + S  +P C+      +E+WIIFG++  +  L  + +AL LW+  L  S  + LFR E   IH          RGY K  N ++E  +   +++   HR RR +LR A++    ++ D PG + P  + +   ++ A DE+ WL+RH + +P K       DDF D+ + E I  +EELR +++++  VM++YY   L   D   L   + + +    +D+  I+  F   + ++++ Q     + D +   F+ +RLDWFRLQ Y S   A       +E  + MN+I+ H+ +VD+L   + + S +    F+     + F+  L+  +Q RY++ FP +C HF++     CP++ + I   S+ + + +L  + ++   L+TD+      L+ +L P +            AK  S   N                 PG+ES   +       D    AL++L   +N  P +++   TF P  YL   L ++F      T S V +         I +PSE+L  ++  M+++  +  +V I+  ++F +  L+Q+   +  G  T+T +Y NWY++ +L Q    H    P +K F+ LP   +    +  N EEY+DI E+R+L E++GP+GMK L E +M  I   V+ L++ V+ N   L ++        ++  L   +  VD   +    +G++  F+ L +EAL DV+   +PFL S++ D +   D  P        E D ++       + + EL    GL  ++D  L  A+           S +  NI   E+ +   LL+   +  LP +  +  + Y    E    + HC A AI ++    F  + +  ++D+++ F+AL SS+LL++G ET  ++           NR+S+Y+  D I+Q    ++ D  E CFPY L+R AYH V KQS
Sbjct:    6 LQPSQQKLAEKLTILNDRGVGMLTRLYNIKKQGQVWKACGDPKAKPSYLIDKNLESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVFFDITVNFDLTKNYLDLIITYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQMIVDYE---NPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISA--PSTMLNPAQSDTMP-CEYLSLDAMEKWIIFGFILCHGILNTDATALNLWKLALQSSSCLSLFRDEVFHIHKAAEDLFVNIRGYNKRINDIRECKEAAVSHAGSMHRERRKFLRSALKELATVLSDQPGLLGPKALFVFMALSFARDEIIWLLRHADNMPKK-----SADDFIDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLSGFDAVVLNELVQN-LSVCPEDESIIMSSFVNTMTSLSVKQ-----VEDGEVFDFRGMRLDWFRLQAYTSVSKASLGLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELPSQSRYSIAFPLLCTHFMSCTHELCPEERHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTLSDQLLPKHC-----------AKTISQAVNKKSKKQTGKKGEPEREKPGVESMRKNRLVVTNLDKLHTALSELCFSINYVPNMVVWEHTFTPREYLTSHLEIRF------TKSIVGMTMYNQATQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHGEPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENE----LTFNAEEYSDISEMRSLSELLGPYGMKFLSESLMWHISSQVAELKKLVVENVDVLTQMRTSFDKPDQMAALFKRLSSVDSVLKRMTIIGVILSFRSLAQEALRDVLSYHIPFLVSSIEDFK---DHIP-------RETDMKV------AMNVYELSSAAGLPCEIDPALVVALS----------SQKSENISPEEEYKIACLLMVFVAVSLPTLASNVMSQYSPAIEGHCNNIHCLAKAINQIAAALFTIH-KGSIEDRLKEFLALASSSLLKIGQETDKTT---------TRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQS 1129          
BLAST of Nck-associated protein 1 vs. Ensembl Human
Match: NCKAP1L (NCK associated protein 1 like [Source:HGNC Symbol;Acc:HGNC:4862])

HSP 1 Score: 411.379 bits (1056), Expect = 7.474e-123
Identity = 309/1182 (26.14%), Postives = 562/1182 (47.55%), Query Frame = 2
Query:  122 KITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELR-FNLQQFNVMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVPPLPGIESKPSDITKSNTFDMQLIALNQLATGLNS-RPLLINNRTFQPNLYLKKELLKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYT---LHTPLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSK---IKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMEDQTNELLIAATSYLLPRIVG--SNFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVK 3619
            K+ EKL IL++R   VLI++ ++K       +    +   S  E  L+ + KKFPNIDV+N+  ++ P+    ++I+  L  +Y + VDV+E +D++ +L   I A Q   +I+L+FD TR+YLDLI  Y++++++LS I   + ++ +YN A        +P + RL + ++E       +TE   E  P+++ +  A+ SL  L   + +   +W   +  +LIS+  P  ++N + S  +  C+      +ERWII G+L  +  L  N    +LW+  L  S  I L R + LQ+H          +GY K    +KE  +    NS  FH  RR +LRMA++    ++ D PG + P  +     ++   DE+ WL+RH E +   K      +D+ D  + E +  +E +R    +   V+++Y+   L   D   L + I + +    +++  I+  F   L ++N+ Q     + + +   F  LRLDWFRLQ Y S   A     ++ +  + MN IV HS ++D++   + + S +    FH     + F + L+ +A  RYA+ FP IC HF++     CP+++  +    +   +++L  + ++    + ++     +L+ +L P +         +KK +         +          PG ES   + +     D   + L +LA  +N      +   T  P+ YL   L   LN   V L+       +     I RPSE+L  +K  +  +  +++F+  + +++  +A L+Q+   +  G  T+T +Y NWY++ +L Q  +   + +P ++ F++LP+  ++      + EE++DI E+RAL E++GP+GMK L E +M  +   +  L++ V+ N   L++   I  ++SK   +  LL  +   +   +    +G++  F+ + +E L +V     PFL              PI+ L      D+ I    +  L I EL    G+   +D  L  AI +LK               + E +   LL+   +  LP +    S+FY +E +    + HC   AI ++    F  Y ++ ++  ++ F+ + S +LL+LG ET         + +   NR+SI +    +++    ++ D  E CFPY L+R AY  V +
Sbjct:   10 KLAEKLTILNDRGQGVLIRMYNIKKTCSDPKSKPPFLLEKS-MEPSLKYINKKFPNIDVRNSTQHLGPVHREKAEIIRFLTNYYQSFVDVMEFRDHVYELLNTIDACQCHFDINLNFDFTRSYLDLIVTYTSVILLLSRIEDRRILIGMYNCAHEMLHGHGDPSFARLGQMVLEYDHPLKKLTE---EFGPHTKAVSGALLSLHFLFVRRNQGAEQWRSAQLLSLISN--PPAMINPANSDTMA-CEYLSVEVMERWIIIGFLLCHGCLNSNSQCQKLWKLCLQGSLYITLIREDVLQVHKVTEDLFSSLKGYGKRVADIKESKEHVIANSGQFHCQRRQFLRMAVKELETVLADEPGLLGPKALFAFMALSFIRDEVTWLVRHTENVTKTK----TPEDYADSSIAELLFLLEGIRSLVRRHIKVIQQYHLQYLARFDALVLSDIIQN-LSVCPEEESIIMSSFVSILSSLNLKQ-----VDNGEKFEFSGLRLDWFRLQAYTSVAKAPLHLHENPDLAKVMNLIVFHSRMLDSVEKLLVETSDLSTFCFHLRIFEKMFAMTLEESAMLRYAIAFPLICAHFVHCTHEMCPEEYPHLKNHGLHHCNSFLEELAKQTSNCVLEICAEQRNLSEQLLPKHCATTISKAKNKKTRKQRQTPRKGEPERDK-----PGAESHRKNRSIVTNMDKLHLNLTELALTMNHVYSFSVFEHTIFPSEYLSSHLEARLNRAIVWLAGYNATTQE-----IVRPSELLAGVKAYIGFIQSLAQFLGADASRVIRNALLQQTQPLDSCGEQTITTLYTNWYLESLLRQASSGTIILSPAMQAFVSLPREGEQN----FSAEEFSDISEMRALAELLGPYGMKFLSENLMWHVTSQIVELKKLVVENMDILVQ---IRSNFSKPDLMASLLPQLTGAENVLKRMTIIGVILSFRAMAQEGLREVFSSHCPFL------------MGPIECLKEFVTPDTDI----KVTLSIFELASAAGVGCDIDPALVAAIANLKADTSS---------PEEEYKVACLLLIFLAVSLPLLATDPSSFYSIEKDGYNNNIHCLTKAIIQVSAALFTLYNKN-IETHLKEFLVVASVSLLQLGQET---------DKLKTRNRESISLLMRLVVEESSFLTLDMLESCFPYVLLRNAYREVSR 1122          
BLAST of Nck-associated protein 1 vs. Ensembl Human
Match: NCKAP1L (NCK associated protein 1 like [Source:HGNC Symbol;Acc:HGNC:4862])

HSP 1 Score: 404.06 bits (1037), Expect = 1.258e-120
Identity = 297/1139 (26.08%), Postives = 541/1139 (47.50%), Query Frame = 2
Query:  251 ESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELR-FNLQQFNVMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVPPLPGIESKPSDITKSNTFDMQLIALNQLATGLNS-RPLLINNRTFQPNLYLKKELLKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYT---LHTPLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSK---IKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMEDQTNELLIAATSYLLPRIVG--SNFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVK 3619
            E  L+ + KKFPNIDV+N+  ++ P+    ++I+  L  +Y + VDV+E +D++ +L   I A Q   +I+L+FD TR+YLDLI  Y++++++LS I   + ++ +YN A        +P + RL + ++E       +TE   E  P+++ +  A+ SL  L   + +   +W   +  +LIS+  P  ++N + S  +  C+      +ERWII G+L  +  L  N    +LW+  L  S  I L R + LQ+H          +GY K    +KE  +    NS  FH  RR +LRMA++    ++ D PG + P  +     ++   DE+ WL+RH E +   K      +D+ D  + E +  +E +R    +   V+++Y+   L   D   L + I + +    +++  I+  F   L ++N+ Q     + + +   F  LRLDWFRLQ Y S   A     ++ +  + MN IV HS ++D++   + + S +    FH     + F + L+ +A  RYA+ FP IC HF++     CP+++  +    +   +++L  + ++    + ++     +L+ +L P +         +KK +         +          PG ES   + +     D   + L +LA  +N      +   T  P+ YL   L   LN   V L+       +     I RPSE+L  +K  +  +  +++F+  + +++  +A L+Q+   +  G  T+T +Y NWY++ +L Q  +   + +P ++ F++LP+  ++      + EE++DI E+RAL E++GP+GMK L E +M  +   +  L++ V+ N   L++   I  ++SK   +  LL  +   +   +    +G++  F+ + +E L +V     PFL              PI+ L      D+ I    +  L I EL    G+   +D  L  AI +LK               + E +   LL+   +  LP +    S+FY +E +    + HC   AI ++    F  Y ++ ++  ++ F+ + S +LL+LG ET         + +   NR+SI +    +++    ++ D  E CFPY L+R AY  V +
Sbjct:    2 EPSLKYINKKFPNIDVRNSTQHLGPVHREKAEIIRFLTNYYQSFVDVMEFRDHVYELLNTIDACQCHFDINLNFDFTRSYLDLIVTYTSVILLLSRIEDRRILIGMYNCAHEMLHGHGDPSFARLGQMVLEYDHPLKKLTE---EFGPHTKAVSGALLSLHFLFVRRNQGAEQWRSAQLLSLISN--PPAMINPANSDTMA-CEYLSVEVMERWIIIGFLLCHGCLNSNSQCQKLWKLCLQGSLYITLIREDVLQVHKVTEDLFSSLKGYGKRVADIKESKEHVIANSGQFHCQRRQFLRMAVKELETVLADEPGLLGPKALFAFMALSFIRDEVTWLVRHTENVTKTK----TPEDYADSSIAELLFLLEGIRSLVRRHIKVIQQYHLQYLARFDALVLSDIIQN-LSVCPEEESIIMSSFVSILSSLNLKQ-----VDNGEKFEFSGLRLDWFRLQAYTSVAKAPLHLHENPDLAKVMNLIVFHSRMLDSVEKLLVETSDLSTFCFHLRIFEKMFAMTLEESAMLRYAIAFPLICAHFVHCTHEMCPEEYPHLKNHGLHHCNSFLEELAKQTSNCVLEICAEQRNLSEQLLPKHCATTISKAKNKKTRKQRQTPRKGEPERDK-----PGAESHRKNRSIVTNMDKLHLNLTELALTMNHVYSFSVFEHTIFPSEYLSSHLEARLNRAIVWLAGYNATTQE-----IVRPSELLAGVKAYIGFIQSLAQFLGADASRVIRNALLQQTQPLDSCGEQTITTLYTNWYLESLLRQASSGTIILSPAMQAFVSLPREGEQN----FSAEEFSDISEMRALAELLGPYGMKFLSENLMWHVTSQIVELKKLVVENMDILVQ---IRSNFSKPDLMASLLPQLTGAENVLKRMTIIGVILSFRAMAQEGLREVFSSHCPFL------------MGPIECLKEFVTPDTDI----KVTLSIFELASAAGVGCDIDPALVAAIANLKADTSS---------PEEEYKVACLLLIFLAVSLPLLATDPSSFYSIEKDGYNNNIHCLTKAIIQVSAALFTLYNKN-IETHLKEFLVVASVSLLQLGQET---------DKLKTRNRESISLLMRLVVEESSFLTLDMLESCFPYVLLRNAYREVSR 1072          
BLAST of Nck-associated protein 1 vs. Ensembl Human
Match: NCKAP1L (NCK associated protein 1 like [Source:HGNC Symbol;Acc:HGNC:4862])

HSP 1 Score: 186.808 bits (473), Expect = 2.303e-50
Identity = 131/447 (29.31%), Postives = 229/447 (51.23%), Query Frame = 2
Query:  122 KITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQ-FNVMEKYYRIVLQSIDFPKLKNYI 1441
            K+ EKL IL++R   VLI++ ++K       +    +   S  E  L+ + KKFPNIDV+N+  ++ P+    ++I+  L  +Y + VDV+E +D++ +L   I A Q   +I+L+FD TR+YLDLI  Y++++++LS I   + ++ +YN A        +P + RL + ++E       +TE   E  P+++ +  A+ SL  L   + +   +W   +  +LIS+  P  ++N + S  +  C+      +ERWII G+L  +  L  N    +LW+  L  S  I L R + LQ+H          +GY K    +KE  +    NS  FH  RR +LRMA++    ++ D PG + P  +     ++   DE+ WL+RH E +   K      +D+ D  + E +  +E +R  +++   V+++Y+   L   D   L + I
Sbjct:   10 KLAEKLTILNDRGQGVLIRMYNIKKTCSDPKSKPPFLLEKSM-EPSLKYINKKFPNIDVRNSTQHLGPVHREKAEIIRFLTNYYQSFVDVMEFRDHVYELLNTIDACQCHFDINLNFDFTRSYLDLIVTYTSVILLLSRIEDRRILIGMYNCAHEMLHGHGDPSFARLGQMVLEYDHPLKKLTE---EFGPHTKAVSGALLSLHFLFVRRNQGAEQWRSAQLLSLISN--PPAMINPANSDTMA-CEYLSVEVMERWIIIGFLLCHGCLNSNSQCQKLWKLCLQGSLYITLIREDVLQVHKVTEDLFSSLKGYGKRVADIKESKEHVIANSGQFHCQRRQFLRMAVKELETVLADEPGLLGPKALFAFMALSFIRDEVTWLVRHTENVTKTK----TPEDYADSSIAELLFLLEGIRSLVRRHIKVIQQYHLQYLARFDALVLSDII 445          
BLAST of Nck-associated protein 1 vs. Ensembl Celegans
Match: gex-3 (Membrane-associated protein gex-3 [Source:UniProtKB/Swiss-Prot;Acc:P55163])

HSP 1 Score: 345.51 bits (885), Expect = 1.000e-99
Identity = 293/1192 (24.58%), Postives = 564/1192 (47.32%), Query Frame = 2
Query:  122 KITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPS-KKYSSIKTDDFNDQLLPEFIHQIEELR-FNLQQFNVMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELN-LKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPN---NAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVPPLPGIESKPSDITKSNTFDMQLIALNQLATGLNS-RPLLINNRTFQPNLYLKKELLKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHTPLLKCFIT-LPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDV--------------DEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMEDQTNE-LLIAATSYLLPRIVGSNF--YHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAY 3604
            KI EKL IL++R   ++ +I ++K     ++    Q  S+   E  ++ +V+KFP +D ++N S  E +    ++I   L  +Y T  D+L++KD++M +   + + Q  L+++L++D+T +YL+L+ +   MMI+LS I   K++L L+N A   +  Q E  + RL + +++       + ++H +L P +R I +A++S+    + + ++   W     F+L ++  P  +L  + +  +  C+      I+RWI+F     +  LL + +   +W+  L  +  + +FR E   +H  +  +LE  +  +K    VK+     +  +   H  RR +LR ++R    ++ D PG + P ++ +   + +  DE+ WL+RH   +P+  K  S   ++  D+ LPE +  + ELR    + + V+++YY   + S D   +   I+   + L+ ++  +L  F+ ++ NIN         SD D    + LRLDWFR Q + S+  + F   + ++   +MN+ V H  ++D     + + S +    F+  K+ E   LN L+  AQ RY + F R+  HF +     CP++   I   ++   ++ +   C++L  +L  + +  F L  ++ P+     V   +       K  +  +  ++ Y       + G ES   D       D     L +++  L + R + + + TF P  YL +     L  KFV L        +   +  +RPSEMLL ++  M+++  +   ++++ +       L+Q+   +     T+  +Y  WY++ +L +  + H    +   T L   Q+++S      + Y+D +ELRALV++IGP+G+K + E+++  +   +  + + V   +  L ++   N D ++  K +LN+  V              D   Q    +G + +F+D   +AL  +V   +PFL+++   L  + D   +D                  +++I E+    G+   VD +L NA+             Q  NI   E   N  LL+ A +  +PRI  S+   Y    +A   ++HC   AI  +    F  + ++ +  +++ F+AL SS +LR   E  +S Q + D   ++ +  ++YI  + +++    +S D  E CFPY LVR AY
Sbjct:   10 KIAEKLVILNDRAAGMMTRIYNIKKS-SGDSKVKPQFLSDKKMEGAIKHIVRKFPVVDCRSNSSTFEYVQEKSTEITKSLSLYYYTFADILDLKDHIMQVLTTMESCQCQLDVTLNYDLTTSYLNLVVHLVTMMILLSRIEDRKAVLGLFNAAYDLQHGQSEASFPRLGQMILDYE---NPLKKLHEDLGPLNRLIYSALSSVTHTYQRRNKTADSWRTSNVFSLTAA--PAQILYAAQTETIA-CEYLSLDVIDRWIVFCGTVCHSTLLNDDNIRHMWQLALQMNLCLRVFRDETFIVHQEIQAFLESSKEKSKRLQDVKDAFNHASVTAVAVHADRRRFLRSSLRELSLLLRDQPGLLGPKILYVWMALGAGRDEVIWLLRHQVEVPAISKKGSRMVEELVDRQLPELLFYMLELRDLVTKYYAVIQRYYLQYVSSYDSIVVSEEINQ-ANGLTQEEAVLLTDFANEIGNIN---------SDTD---LRALRLDWFRFQAWTSAARSHFQLSRHKKLAIYMNTSVFHLKMIDLQDEMLRETSDLSLYCFY-PKLAEKHWLNCLQLPAQARYVLSFARLAAHFTSALHDMCPEEKAFITEKALAQCNSVIEETCKQLSYILEKVAEHEFGLAYQMTPSAVAVRVVAQVVQQKGSGKAAAAAAAAARDYF------IAGEESYRVDRQALTMPDKLQTTLLEISAALGAHRQIYVADHTFAPRTYLAQS----LETKFVELLHGMFWEGQPHASNPKRPSEMLLALQAYMTVLQNLDTAISVDISNTMQTTLLQQTQLVDSKNKDTIAALYTKWYLEVLLRRASSGHMVWSEHLRTMLSSGQEQLS---FMPDHYSDPQELRALVQIIGPYGVKLMTERLIWHVASQIMEMSKIVATYKDAL-QIARSNFDNAEKMKDVLNLLSVEPKDKKTPNATCAADAILQRTIIIGQICLFRDALHDALRHIVESKLPFLQASFDMLYHNLD--DVD------------------KVKIGEMSAAMGVTGPVDMSLVNAVR-----------AQNPNIHPQEHYVNSCLLMVAVAICIPRIGMSDLSSYKPSIQASLNNSHCVPMAINTIGSALFHLHEQNDIQSRMKEFLALASSGILRTIHERDNSRQISDD---VLRSHTTLYIILEQMVRKNRWLSMDVLETCFPYNLVRTAY 1132          
BLAST of Nck-associated protein 1 vs. Ensembl Celegans
Match: gex-3 (Membrane-associated protein gex-3 [Source:UniProtKB/Swiss-Prot;Acc:P55163])

HSP 1 Score: 345.51 bits (885), Expect = 1.000e-99
Identity = 293/1192 (24.58%), Postives = 564/1192 (47.32%), Query Frame = 2
Query:  122 KITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPS-KKYSSIKTDDFNDQLLPEFIHQIEELR-FNLQQFNVMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELN-LKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPN---NAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVPPLPGIESKPSDITKSNTFDMQLIALNQLATGLNS-RPLLINNRTFQPNLYLKKELLKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHTPLLKCFIT-LPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDV--------------DEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMEDQTNE-LLIAATSYLLPRIVGSNF--YHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAY 3604
            KI EKL IL++R   ++ +I ++K     ++    Q  S+   E  ++ +V+KFP +D ++N S  E +    ++I   L  +Y T  D+L++KD++M +   + + Q  L+++L++D+T +YL+L+ +   MMI+LS I   K++L L+N A   +  Q E  + RL + +++       + ++H +L P +R I +A++S+    + + ++   W     F+L ++  P  +L  + +  +  C+      I+RWI+F     +  LL + +   +W+  L  +  + +FR E   +H  +  +LE  +  +K    VK+     +  +   H  RR +LR ++R    ++ D PG + P ++ +   + +  DE+ WL+RH   +P+  K  S   ++  D+ LPE +  + ELR    + + V+++YY   + S D   +   I+   + L+ ++  +L  F+ ++ NIN         SD D    + LRLDWFR Q + S+  + F   + ++   +MN+ V H  ++D     + + S +    F+  K+ E   LN L+  AQ RY + F R+  HF +     CP++   I   ++   ++ +   C++L  +L  + +  F L  ++ P+     V   +       K  +  +  ++ Y       + G ES   D       D     L +++  L + R + + + TF P  YL +     L  KFV L        +   +  +RPSEMLL ++  M+++  +   ++++ +       L+Q+   +     T+  +Y  WY++ +L +  + H    +   T L   Q+++S      + Y+D +ELRALV++IGP+G+K + E+++  +   +  + + V   +  L ++   N D ++  K +LN+  V              D   Q    +G + +F+D   +AL  +V   +PFL+++   L  + D   +D                  +++I E+    G+   VD +L NA+             Q  NI   E   N  LL+ A +  +PRI  S+   Y    +A   ++HC   AI  +    F  + ++ +  +++ F+AL SS +LR   E  +S Q + D   ++ +  ++YI  + +++    +S D  E CFPY LVR AY
Sbjct:   10 KIAEKLVILNDRAAGMMTRIYNIKKS-SGDSKVKPQFLSDKKMEGAIKHIVRKFPVVDCRSNSSTFEYVQEKSTEITKSLSLYYYTFADILDLKDHIMQVLTTMESCQCQLDVTLNYDLTTSYLNLVVHLVTMMILLSRIEDRKAVLGLFNAAYDLQHGQSEASFPRLGQMILDYE---NPLKKLHEDLGPLNRLIYSALSSVTHTYQRRNKTADSWRTSNVFSLTAA--PAQILYAAQTETIA-CEYLSLDVIDRWIVFCGTVCHSTLLNDDNIRHMWQLALQMNLCLRVFRDETFIVHQEIQAFLESSKEKSKRLQDVKDAFNHASVTAVAVHADRRRFLRSSLRELSLLLRDQPGLLGPKILYVWMALGAGRDEVIWLLRHQVEVPAISKKGSRMVEELVDRQLPELLFYMLELRDLVTKYYAVIQRYYLQYVSSYDSIVVSEEINQ-ANGLTQEEAVLLTDFANEIGNIN---------SDTD---LRALRLDWFRFQAWTSAARSHFQLSRHKKLAIYMNTSVFHLKMIDLQDEMLRETSDLSLYCFY-PKLAEKHWLNCLQLPAQARYVLSFARLAAHFTSALHDMCPEEKAFITEKALAQCNSVIEETCKQLSYILEKVAEHEFGLAYQMTPSAVAVRVVAQVVQQKGSGKAAAAAAAAARDYF------IAGEESYRVDRQALTMPDKLQTTLLEISAALGAHRQIYVADHTFAPRTYLAQS----LETKFVELLHGMFWEGQPHASNPKRPSEMLLALQAYMTVLQNLDTAISVDISNTMQTTLLQQTQLVDSKNKDTIAALYTKWYLEVLLRRASSGHMVWSEHLRTMLSSGQEQLS---FMPDHYSDPQELRALVQIIGPYGVKLMTERLIWHVASQIMEMSKIVATYKDAL-QIARSNFDNAEKMKDVLNLLSVEPKDKKTPNATCAADAILQRTIIIGQICLFRDALHDALRHIVESKLPFLQASFDMLYHNLD--DVD------------------KVKIGEMSAAMGVTGPVDMSLVNAVR-----------AQNPNIHPQEHYVNSCLLMVAVAICIPRIGMSDLSSYKPSIQASLNNSHCVPMAINTIGSALFHLHEQNDIQSRMKEFLALASSGILRTIHERDNSRQISDD---VLRSHTTLYIILEQMVRKNRWLSMDVLETCFPYNLVRTAY 1132          
BLAST of Nck-associated protein 1 vs. Ensembl Fly
Match: Hem (gene:FBgn0011771 transcript:FBtr0078510)

HSP 1 Score: 467.233 bits (1201), Expect = 9.045e-144
Identity = 348/1190 (29.24%), Postives = 579/1190 (48.66%), Query Frame = 2
Query:  110 PNISKITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNM--SPSVLLPYCQIE---RWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVPPLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRPLL-INNRTFQPNLYLKKELLKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHTPLLKCFITLPQNQKEV------SNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMEDQTNELLIAATSYLLPRIVG--SNFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQSRLV 3634
            PN  KI EKL IL++R   +L +I ++K     +        S  + ES ++ +VK+FPNIDVK     +  +  I ++I+  L  +Y+T VD+L+ KDN+ +L   + A Q  L+I+L+F++T+ YLDL+  Y ++MI+LS +   K++L LYN A   + +Q +  + RL + +++       + ++  E  P+ R + +A+ SL S+  L+     +W + +K +L+ +  P  LL    + ++   Y  +E   RWIIFG L  +  L + P   ++W S L  S+ + LFR E LQIH ++    +  +GY+K    VKE        +   HR RR +LR A++    I+ D PG + P  + I   +  A DE+ WL+RHN+  P  K      +D  D+ LPE +  +EELR  +++++ VM++YY   L   D   L   + S +    +D+  I          + + Q     + D +   F+  RLDWFRLQTY+S   A     +  E  + ++S+V H+ +VDNL   + + S +    F+    ++ F + L+  AQ+RY + FP IC HF N     CP++ + I   S+ + + +L  + +E   ++T +      +   L P +     LS  S + K     S H     K      PG ES         T D   +AL +L   +N  P + +    F P  YL + L    +   V +  V   ++  EIA   +PSE+L  ++  M+++  V  +V+I+  ++F +  L+Q+   +  G  T+  +Y  WY + +L +    +       I    NQK          V  N +E++D+ ELRAL E++GP+G+K L E +M  I   V  L+  V  N+  LI L         +K+    ++DVD   Q    +G++  F++L  EAL DV+ K +PFL S+V D Q+       DQ+   S                 E+    GL  KVD TL   ++            +    D+ E  T  LL+   +  +P++    ++FY    +    + HC A AI  +    F   G+  ++D+++ F+AL SS+LLRLG E+   +           NR+SIY+  D I++    ++ D  E CFPY L+R AYH V KQ +++
Sbjct:    7 PNQQKIAEKLIILNDRGLGILTRIYNIKKAC-GDTKSKPGFLSEKSLESSIKFIVKRFPNIDVKG----LNAIVNIKAEIIKSLSLYYHTFVDLLDFKDNVCELLTTMDACQIHLDITLNFELTKYYLDLVVTYVSLMIVLSRVEDRKAVLGLYNAAYELQNNQADTGFPRLGQMILDYEV---PLKKLAEEFIPHQRLLTSALRSLTSIYALRNLPADKWREMQKLSLVGN--PAILLKAVRTDTMSCEYISLEAMDRWIIFGLLLNHQMLGQYPEVNKIWLSALESSWVVALFRDEVLQIHQYIQATFDGIKGYSKRIGEVKEAYNTAVQKAALMHRERRKFLRTALKELALIMTDQPGLLGPKAIFIFIGLCLARDEILWLLRHNDNPPLLKNKGKSNEDLVDRQLPELLFHMEELRALVRKYSQVMQRYYVQYLSGFDATDLNIRMQS-LQMCPEDESIIFSSLYNTAAALTVKQ-----VEDNELFYFRPFRLDWFRLQTYMSVGKAALRIAEHAELARLLDSMVFHTRVVDNLDEILVETSDLSIFCFYNKMFDDQFHMCLEFPAQNRYIIAFPLICSHFQNCTHEMCPEERHHIRERSLSVVNIFLEEMAKEAKNIITTICDEQCTMADALLPKHCAKI-LSVQSARKKKDKSKSKHFDDIRK------PGDESYRKTREDLTTMDKLHMALTELCFAINYCPTVNVWEFAFAPREYLCQNLEHRFSRDLVGM--VMFNQETMEIA---KPSELLASVRAYMNVLQTVENYVHIDITRVFNNCLLQQTQALDSHGEKTIAALYNTWYSEVLLRRVSAGN-------IVFSINQKAFVPISPEGWVPFNPQEFSDLNELRALAELVGPYGIKTLNETLMWHIANQVQELKSLVSTNKEVLITLRTSFDKPEVMKEQFKRLQDVDRVLQRMTIIGVIICFRNLVHEALVDVLDKRIPFLLSSVKDFQEHLPGG--DQIRVAS-----------------EMASAAGLLCKVDPTLATTLK-----------SKKPEFDEGEHLTACLLMVFVAVSIPKLARNENSFYRATIDGHSNNTHCMAAAINNIFGALFTICGQSDMEDRMKEFLALASSSLLRLGQESDKEA---------TRNRESIYLLLDEIVKQSPFLTMDLLESCFPYVLIRNAYHGVYKQEQIL 1122          
BLAST of Nck-associated protein 1 vs. Ensembl Zebrafish
Match: nckap1 (NCK-associated protein 1 [Source:NCBI gene;Acc:561894])

HSP 1 Score: 476.478 bits (1225), Expect = 4.624e-147
Identity = 337/1194 (28.22%), Postives = 590/1194 (49.41%), Query Frame = 2
Query:  101 GLKPNISKITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVP----PLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRP-LLINNRTFQPNLYLKKEL-LKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHT---PLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMED-QTNELLIAATSYLLPRIVGS--NFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQS 3625
             ++P+  K+ EKL IL++R   +L +I ++K          S +   +  ES ++ +V+KFP ++ +NN   +  L    S+IL  L  +Y T VDV+E KD++ +L   I A Q   +I+++FD+T+ YLDL+  Y+ +M++LS I + K+I+ LYN+A        +  Y RL + +V+       + ++  E  P+ +++ +A+ SL  +   +  S  +W   +  +LIS+  P  +LN + S  +P C+      +E+WI+FG++  +  L  +P+AL LW+  L  S  + LFR E   IH          RGY K  N ++E  +   +++   HR RR +LR A++    ++ D PG + P  + +   ++ A DE+ WL+RH + I  K      TDDF D+ + E I  +EELR +++++  VM++YY   L   D   L   + + +    +D+  I+  F   + ++++ Q     + D +   F+ +RLDWFRLQ Y S   A       +E  + MN+I+ H+ +VD+L   + + S +    F+     + F+  L+  +Q RY++ FP +C HF++     CP++ + I   S+ + + +L  + ++   L+TD+      L+ +L P +            AK  S   N                 PG+ES   +       D    AL++L   +N  P +++   TF P  YL   L ++F      T S V +         I +PSE+L  ++  M+++  +  +V I+  ++F +  L+Q+   +  G  T+T +Y NWY++ +L Q    H    P +K F+ LP   +    +  N EEY+DI E+R+L E++GP+GMK L E +M  I   V+ L++ V+ N   L ++         +  L   +  VD   +    +G++  F+ L +EAL DV+   +PFL S+V D +   D  P        E D ++       + + EL    GL  ++D  L  A+           S +  NI   E+ +   LL+   +  +P +  +  + Y    E    + HC A AI ++    F  + +  ++D+++ F+AL SS+LL++G ET  ++           NR+S+Y+  D I+Q    ++ D  E CFPY L+R AYH V KQS
Sbjct:    5 AMQPSQQKLAEKLTILNDRGIGMLTRIYNIKKACGDPKAKPSYLIDKN-LESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDACQVFFDITVNFDLTKNYLDLVVTYTTLMLLLSRIEERKAIIGLYNYAHEMTHGSSDREYPRLGQMIVDYE---NPLKKMMEEFVPHGKSLSDALVSLQMVYPRRNLSADQWRNAQLLSLISA--PSTMLNPAQSDTMP-CEYLSLDTMEKWIVFGFILCHAALNSDPAALSLWKLALQSSTCLCLFRDEVFHIHKAAEDLFVNIRGYNKRVNDIRECKESALSHAGSMHRERRKFLRSALKELATVLADQPGLLGPKALFVFMALSFARDEIIWLLRHADNIQKK-----STDDFIDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLSGFDAVVLNELVQN-LSVCPEDESIIMSSFVNTMTSLSVKQ-----VEDGEVFDFRGMRLDWFRLQAYTSVSKASLGLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELPSQSRYSISFPLLCTHFMSCTHELCPEERHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTLSDQLLPKHC-----------AKTISQAVNKKSKKQTGKKGEPEREKPGVESMRKNRLLVTNLDKLHTALSELCFSINYVPNMMVWEHTFTPREYLTSHLEIRF------TKSIVGMTMYNQTTQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHGEPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENE----LTFNAEEYSDISEMRSLSELLGPYGMKFLSESLMWHISSQVAELKKLVVDNVEVLTQMRTSFDKPDHMAALFKRLTSVDSVLKRMTIIGVILSFRSLAQEALRDVLSCHIPFLVSSVEDFK---DHIP-------RETDMKV------AMNVYELSSAAGLPCEIDPALVVALS----------SQKSENISPEEEYKIACLLMVFVAVSMPTLASNVMSQYSPAIEGHCNNIHCLAKAINQIAAALFTIH-KGSIEDRLKEFLALASSSLLKIGQETDKTT---------TRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQS 1123          
BLAST of Nck-associated protein 1 vs. Ensembl Zebrafish
Match: nckap1 (NCK-associated protein 1 [Source:NCBI gene;Acc:561894])

HSP 1 Score: 474.167 bits (1219), Expect = 4.892e-146
Identity = 337/1199 (28.11%), Postives = 590/1199 (49.21%), Query Frame = 2
Query:  101 GLKPNISKITEKLKILSERMTVVLIQIDSLKNLLQT-----ENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVP----PLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRP-LLINNRTFQPNLYLKKEL-LKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHT---PLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMED-QTNELLIAATSYLLPRIVGS--NFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQS 3625
             ++P+  K+ EKL IL++R   +L +I ++K   Q      +         +   ES ++ +V+KFP ++ +NN   +  L    S+IL  L  +Y T VDV+E KD++ +L   I A Q   +I+++FD+T+ YLDL+  Y+ +M++LS I + K+I+ LYN+A        +  Y RL + +V+       + ++  E  P+ +++ +A+ SL  +   +  S  +W   +  +LIS+  P  +LN + S  +P C+      +E+WI+FG++  +  L  +P+AL LW+  L  S  + LFR E   IH          RGY K  N ++E  +   +++   HR RR +LR A++    ++ D PG + P  + +   ++ A DE+ WL+RH + I  K      TDDF D+ + E I  +EELR +++++  VM++YY   L   D   L   + + +    +D+  I+  F   + ++++ Q     + D +   F+ +RLDWFRLQ Y S   A       +E  + MN+I+ H+ +VD+L   + + S +    F+     + F+  L+  +Q RY++ FP +C HF++     CP++ + I   S+ + + +L  + ++   L+TD+      L+ +L P +            AK  S   N                 PG+ES   +       D    AL++L   +N  P +++   TF P  YL   L ++F      T S V +         I +PSE+L  ++  M+++  +  +V I+  ++F +  L+Q+   +  G  T+T +Y NWY++ +L Q    H    P +K F+ LP   +    +  N EEY+DI E+R+L E++GP+GMK L E +M  I   V+ L++ V+ N   L ++         +  L   +  VD   +    +G++  F+ L +EAL DV+   +PFL S+V D +   D  P        E D ++       + + EL    GL  ++D  L  A+           S +  NI   E+ +   LL+   +  +P +  +  + Y    E    + HC A AI ++    F  + +  ++D+++ F+AL SS+LL++G ET  ++           NR+S+Y+  D I+Q    ++ D  E CFPY L+R AYH V KQS
Sbjct:    5 AMQPSQQKLAEKLTILNDRGIGMLTRIYNIKKQGQVWKACGDPKAKPSYLIDKNLESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDACQVFFDITVNFDLTKNYLDLVVTYTTLMLLLSRIEERKAIIGLYNYAHEMTHGSSDREYPRLGQMIVDYE---NPLKKMMEEFVPHGKSLSDALVSLQMVYPRRNLSADQWRNAQLLSLISA--PSTMLNPAQSDTMP-CEYLSLDTMEKWIVFGFILCHAALNSDPAALSLWKLALQSSTCLCLFRDEVFHIHKAAEDLFVNIRGYNKRVNDIRECKESALSHAGSMHRERRKFLRSALKELATVLADQPGLLGPKALFVFMALSFARDEIIWLLRHADNIQKK-----STDDFIDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLSGFDAVVLNELVQN-LSVCPEDESIIMSSFVNTMTSLSVKQ-----VEDGEVFDFRGMRLDWFRLQAYTSVSKASLGLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELPSQSRYSISFPLLCTHFMSCTHELCPEERHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTLSDQLLPKHC-----------AKTISQAVNKKSKKQTGKKGEPEREKPGVESMRKNRLLVTNLDKLHTALSELCFSINYVPNMMVWEHTFTPREYLTSHLEIRF------TKSIVGMTMYNQTTQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHGEPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENE----LTFNAEEYSDISEMRSLSELLGPYGMKFLSESLMWHISSQVAELKKLVVDNVEVLTQMRTSFDKPDHMAALFKRLTSVDSVLKRMTIIGVILSFRSLAQEALRDVLSCHIPFLVSSVEDFK---DHIP-------RETDMKV------AMNVYELSSAAGLPCEIDPALVVALS----------SQKSENISPEEEYKIACLLMVFVAVSMPTLASNVMSQYSPAIEGHCNNIHCLAKAINQIAAALFTIH-KGSIEDRLKEFLALASSSLLKIGQETDKTT---------TRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQS 1129          
BLAST of Nck-associated protein 1 vs. Ensembl Zebrafish
Match: nckap1 (NCK-associated protein 1 [Source:NCBI gene;Acc:561894])

HSP 1 Score: 473.396 bits (1217), Expect = 5.825e-146
Identity = 337/1193 (28.25%), Postives = 589/1193 (49.37%), Query Frame = 2
Query:  101 GLKPNISKITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVP----PLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRP-LLINNRTFQPNLYLKKEL-LKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHT---PLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMEDQTNELLIAATSYLLPRIVGS--NFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQS 3625
             ++P+  K+ EKL IL++R   +L +I ++K          S +   +  ES ++ +V+KFP ++ +NN  N+  L    S+IL  L  +Y T VDV+E KD++ +L   I A Q   +I+++FD+T+ YLDL+  Y+ +M++LS I + K+I+ LYN+A        +  Y RL + +V+       + ++  E  P+ +++ +A+ SL  +   +  S  +W   +  +LIS+  P  +LN + S  +P C+      +E+WI+FG++  +  L  +P+AL LW+  L  S  + LFR E   IH          RGY K  N ++E  +   +++   HR RR +LR A++    ++ D PG + P  + +   ++ A DE+ WL+RH + I  K      TDDF D+ + E I  +EELR +++++  VM++YY   L   D   L   + + +    +D+  I+  F   + ++++ Q     + D +   F+ +RLDWFRLQ Y S   A       +E  + MN+I+ H+ +VD+L   + + S +    F+     + F+  L+  +Q RY++ FP +C HF++     CP++ + I   S+ + + +L  + ++   L+TD+      L+ +L P +            AK  S   N                 PG+ES   +       D    AL++L   +N  P +++   TF P  YL   L ++F      T S V +         I +PSE+L  ++  M+++  +  +V I+  ++F +  L+Q+   +  G  T+T +Y NWY++ +L Q    H    P +K F+ LP   +    +  N EEY+DI E+R+L E++GP+GMK L E +M  I   V+ L++ V+ N   L ++         +  L   +  VD   +    +G++  F+ L +EAL DV+   +PFL S+V D +   D  P        E D ++       + + EL    GL  ++D  L  A+ S K               + E +   LL+   +  +P +  +  + Y    E    + HC A AI ++    F  + +  ++D+++ F+AL SS+LL++G ET  ++           NR+S+Y+  D I+Q    ++ D  E CFPY L+R AYH V KQS
Sbjct:    5 AMQPSQQKLAEKLTILNDRGIGMLTRIYNIKKACGDPKAKPSYLIDKN-LESAVKFIVRKFPAVETRNN--NLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDACQVFFDITVNFDLTKNYLDLVVTYTTLMLLLSRIEERKAIIGLYNYAHEMTHGSSDREYPRLGQMIVDYE---NPLKKMMEEFVPHGKSLSDALVSLQMVYPRRNLSADQWRNAQLLSLISA--PSTMLNPAQSDTMP-CEYLSLDTMEKWIVFGFILCHAALNSDPAALSLWKLALQSSTCLCLFRDEVFHIHKAAEDLFVNIRGYNKRVNDIRECKESALSHAGSMHRERRKFLRSALKELATVLADQPGLLGPKALFVFMALSFARDEIIWLLRHADNIQKKS-----TDDFIDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLSGFDAVVLNELVQN-LSVCPEDESIIMSSFVNTMTSLSVKQ-----VEDGEVFDFRGMRLDWFRLQAYTSVSKASLGLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELPSQSRYSISFPLLCTHFMSCTHELCPEERHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTLSDQLLPKHC-----------AKTISQAVNKKSKKQTGKKGEPEREKPGVESMRKNRLLVTNLDKLHTALSELCFSINYVPNMMVWEHTFTPREYLTSHLEIRF------TKSIVGMTMYNQTTQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHGEPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENE----LTFNAEEYSDISEMRSLSELLGPYGMKFLSESLMWHISSQVAELKKLVVDNVEVLTQMRTSFDKPDHMAALFKRLTSVDSVLKRMTIIGVILSFRSLAQEALRDVLSCHIPFLVSSVEDFK---DHIP-------RETDMKV------AMNVYELSSAAGLPCEIDPALVVALSSQKSGN-----------PEEEYKIACLLMVFVAVSMPTLASNVMSQYSPAIEGHCNNIHCLAKAINQIAAALFTIH-KGSIEDRLKEFLALASSSLLKIGQETDKTT---------TRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQS 1119          
BLAST of Nck-associated protein 1 vs. Ensembl Zebrafish
Match: NCKAP1L (zgc:172352 [Source:ZFIN;Acc:ZDB-GENE-080204-117])

HSP 1 Score: 372.474 bits (955), Expect = 3.955e-109
Identity = 291/1182 (24.62%), Postives = 546/1182 (46.19%), Query Frame = 2
Query:  122 KITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMS--PSVLLPYCQIE---RWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELR-FNLQQFNVMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVPPLPGIESKPSDITKSNTFDMQLIALNQLATGLNSR-----PLLINNRTFQPNLYLKKELLKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYT---LHTPLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMEDQTNELLIAATSYLLPRIV--GSNFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVK 3619
            K+ EKL IL +R   VL++I+ +K +        S   ++ + ES ++ + +KFPNID +     +  +    + +L  L+ +Y + +DV+E +D++ +L   I A Q    I ++FD+T+ YLDL+  Y++++ +LS I   K+I+ +YN A        +P Y RL +  +E       ++E   E  P+++ +  A+ SL  +   +  +  +W   +  +L++S  P  +L+ +   +V   Y  +E   RWI+ G+L  +  L  N ++  LW+  L     I + R E L IH    ++ +  +GY+K    +KE  +    N     R +R+YLR A++   +++ D P  + P V+ +   ++ + DE+ WL+RH E IP  K      +D+ D  + E +  +E+LR   L+   V+++Y+   L   D   L + I   +    +++  ++  F   L  +++             +  +        LQ Y S   A    +   E  + MN    HS ++D++   + + + +  L FH     + F  + +     RY + FP +C HF  +  P CP++   + + S+++  ++L  I ++   ++ ++    ++L+ KL P ++           A+  S   N      +      P  +     + K   F   L  ++Q  T L S         +      P  +L  +L   LN  FV ++       +     I RPS++   ++  +S +  +S ++NI+ ++L     L+Q+   +  G  T+T +Y NWY++ +L Q  +   +H P  +CFI   QN +   N   + EEY+DI  LR+L E+IGP+GMK L E +M  I+  V  L++ V  N   L+++     D   + +L   +   +   +    +G++  F+ + +EAL +++ +  PFL   +  L +DF    ID                +  L + E+    GL  ++D  L +A+ +++     +         + E + + LL+   +  LP +    ++FY  E+   + + HC A A+  +     F      +  Q++ F+ + SS LL+LG      +  N++    I NRDS+YI    I++    +S D  E CFPY L+R AY  V K
Sbjct:    6 KLAEKLLILRDRGQGVLVRINHIKKVFSDPKRRPSYF-TDKSMESAIKYINRKFPNIDFRGGSQQLSSIQKQKTAVLECLHSYYESFIDVMEFRDHVYELLNTIDACQCFFNIIVNFDLTKNYLDLVVTYASVIYMLSRIEDKKAIVGMYNSAYELSNGNSDPSYPRLGQMFLEYEHPWKKLSE---EFGPHTKAVTEAVLSLHLVYPRRNLTADQWRSAQLLSLLAS--PAAMLSPACCDTVACEYLSMEVMERWILIGFLLCHASLNTNANSQSLWKMALRNGLYISIIRDELLNIHKLSEEFFDSLKGYSKRIADIKECKEHVLANCGALRREKRSYLRNALKELTKVLEDEPALLGPKVLFVFMALSFSRDEVLWLVRHMENIPKTK----TPEDYADPQMAELLFYMEKLRALLLRHRYVVQRYHLQYLAQYDALVLNDTIQGMLV-CPEEESVLMSSFVSTLSALSLKHCELHT-----RTYMRACVCVCVCLQVYTSVGKAPLALKDYPELAKIMNVSQFHSRMLDSVEELLWETTDLSVLCFHARVFEKLFSQSSEDVCVQRYLMGFPLVCSHFSQSLHPLCPEETEDLEKQSLKLCVSFLEEISRQTSAVVLEICAEQWNLHEKLLPKHS-----------AQTISTARNKKLKKVQPKKGDAPREKPGAESLRKDRAFVTNLDKMHQTLTELCSSFSICTDFSVCRHVIVPAEFLLTQLEIRLNKVFVQMAGYNQSTHE-----ISRPSDLASGMQAYVSAIHTLSSYINIDVSRLVKSVLLQQTQPLDSYGAQTITTLYTNWYLEGLLRQASSALIVHCPTTQCFIN--QNTENEQN--FHAEEYSDIGGLRSLAELIGPYGMKFLSENLMWHIISQVGELKKLVSDNMDVLVQMRANYEDPEAMSELQKKLAGCENVLKRMTIIGVILSFRSMVQEALEEIMDRHCPFLMKPIRCL-KDFVCPEID---------------IKVTLGVYEMASAAGLPCEIDPALVSALANMQTDNPSM---------EEEYKISCLLLVYIAVSLPSLCLDPNSFYSREHGGHQNNIHCLATAVNHVAAA-MFTVQRKNIQTQMQEFLKVASSVLLQLG-----QNVDNRE----IKNRDSVYILLHMIVEQSPFLSQDMLEMCFPYVLLRNAYREVHK 1116          
BLAST of Nck-associated protein 1 vs. Ensembl Zebrafish
Match: nckap1 (NCK-associated protein 1 [Source:NCBI gene;Acc:561894])

HSP 1 Score: 115.161 bits (287), Expect = 5.941e-28
Identity = 75/247 (30.36%), Postives = 137/247 (55.47%), Query Frame = 2
Query:  101 GLKPNISKITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPS 841
             ++P+  K+ EKL IL++R   +L +I ++K          S +   +  ES ++ +V+KFP ++ +NN  N+  L    S+IL  L  +Y T VDV+E KD++ +L   I A Q   +I+++FD+T+ YLDL+  Y+ +M++LS I + K+I+ LYN+A        +  Y RL + +V+       + ++  E  P+ +++ +A+ SL  +   +  S  +W   +  +LIS+  P  +LN + S
Sbjct:    5 AMQPSQQKLAEKLTILNDRGIGMLTRIYNIKKACGDPKAKPSYLIDKN-LESAVKFIVRKFPAVETRNN--NLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDACQVFFDITVNFDLTKNYLDLVVTYTTLMLLLSRIEERKAIIGLYNYAHEMTHGSSDREYPRLGQMIVDYE---NPLKKMMEEFVPHGKSLSDALVSLQMVYPRRNLSADQWRNAQLLSLISA--PSTMLNPAQS 243          
BLAST of Nck-associated protein 1 vs. Ensembl Xenopus
Match: NCKAP1 (NCK-associated protein 1 [Source:NCBI gene;Acc:100379683])

HSP 1 Score: 473.396 bits (1217), Expect = 1.279e-145
Identity = 339/1197 (28.32%), Postives = 589/1197 (49.21%), Query Frame = 2
Query:  104 LKPNISKITEKLKILSERMTVVLIQIDSLKNLLQT-----ENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVP----PLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRP-LLINNRTFQPNLYLKKEL-LKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHT---PLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMEDQTNELLIAATSYLLPRIVGS--NFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQS 3625
            L+P+  K+ EKL IL++R   +L ++ ++K   Q      +         +   ES ++ +V+KFP ++ +NN   +  L    S+IL  L  +Y T VDV+E KD++ +L   I   Q   +I+++FD+T+ YLDLI  Y+ +MI+LS I + K+I+ LYN++        +  Y RL + +V+       + ++  E  P+S+++ +A+ SL  +   +  S  +W   +  +LIS+  P  +LN + S  +P C+      +E+WIIFG++  +  L  + +AL LW+  L  S  + L+R E   IH          RGY K  N ++E  +   +++   HR RR +LR A++    ++ D PG + P  + +   ++ A DE+ WL+RH + IP K       DDF D+ + E I  +EELR +++++  VM++YY   L   D   L   + + +    +D+  I+  F   + ++++ Q     + D +   F+ +RLDWFRLQ Y S   A       +E  + MN+I+ H+ +VD+L   + + S +    F+     + F+  L+  +Q RY++ FP IC HF++     CP++ + I   S+ + + +L  + ++   L+TD+      L+ +L P +            AK  S   N                 PG+ES   +       D    AL++L   +N  P +++   TF P  YL   L ++F      T S V +         I +PSE+L  ++  M+++  +  +V I+  ++F +  L+Q+   +  G  T+T +Y NWY++ +L Q    H    P +K F+ LP   +    +  N EEY+DI E+RAL E++GP+GMK L E +M  I   V+ L++ V+ N   L ++        ++  L   +  VD   +    +G++  F+ L +EAL DV+   +PFL S+V D +   D  P        E D ++       + + EL    GL  ++D  L  A+ S K +             + E +   LL+   +  LP +  +  + Y    E    + HC A AI ++    F  + +  ++D+++ F+AL SS+LL++G ET  ++           NR+S+Y+  D I+Q    ++ D  E CFPY L+R AYH V KQS
Sbjct:    6 LQPSQQKLAEKLTILNDRGVGMLTRLYNIKKQGQVWKACGDPKAKPSYLIDKNLESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVFFDITVNFDLTKNYLDLIVTYTTLMIMLSRIEERKAIIGLYNYSHEMTHGASDREYPRLGQMIVDYE---NPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSAEQWRNAQLLSLISA--PSTMLNPAQSDTMP-CEYLSLDAMEKWIIFGFILCHGILNTDATALNLWKLALQSSSCLCLYRDEVFHIHKAAEDLFVNIRGYNKRINDIRECKENAVSHAGATHRERRKFLRSALKELATVLADQPGLLGPKALFVFMALSFARDEIIWLLRHADNIPKK-----VADDFMDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLSGFDAVVLNELVQN-LSVCPEDESIIMSSFVNTMTSLSVKQ-----VEDGEVFDFRGMRLDWFRLQAYTSVSKASLSLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELPSQSRYSISFPLICTHFMSCTHELCPEERHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTLSDQLLPKHC-----------AKTISQAVNKKSKKQTGKKGEPEREKPGVESMRKNRLVVTNLDKLHTALSELCFSINYAPNMVVWEHTFTPREYLTSHLEIRF------TKSIVGMTMYNQVTQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHGEPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENE----LTFNAEEYSDISEMRALSELLGPYGMKFLSESLMWHISSQVAELKKLVVENVEVLTQMRTSFDKPEQMAALFKRLTSVDSVLKRMTIIGVILSFRSLAQEALRDVLSYHIPFLVSSVEDFK---DHIP-------RETDMKV------AMNVYELSSAAGLPCEIDPALVVALSSQKSETIS---------PEEEYKIACLLMVFVAVSLPTLASNVMSQYSPAIEGHCNNIHCLAKAINQIAAALFTIH-KGSIEDRLKEFLALASSSLLKIGQETDKTT---------TRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQS 1129          
BLAST of Nck-associated protein 1 vs. Ensembl Xenopus
Match: NCKAP1 (NCK-associated protein 1 [Source:NCBI gene;Acc:100379683])

HSP 1 Score: 466.463 bits (1199), Expect = 2.506e-143
Identity = 327/1143 (28.61%), Postives = 565/1143 (49.43%), Query Frame = 2
Query:  251 ESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVP----PLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRP-LLINNRTFQPNLYLKKEL-LKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHT---PLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMEDQTNELLIAATSYLLPRIVGS--NFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQS 3625
            ES ++ +V+KFP ++ +NN   +  L    S+IL  L  +Y T VDV+E KD++ +L   I   Q   +I+++FD+T+ YLDLI  Y+ +MI+LS I + K+I+ LYN++        +  Y RL + +V+       + ++  E  P+S+++ +A+ SL  +   +  S  +W   +  +LIS+  P  +LN + S  +P C+      +E+WIIFG++  +  L  + +AL LW+  L  S  + L+R E   IH          RGY K  N ++E  +   +++   HR RR +LR A++    ++ D PG + P  + +   ++ A DE+ WL+RH + IP K       DDF D+ + E I  +EELR +++++  VM++YY   L   D   L   + + +    +D+  I+  F   + ++++ Q     + D +   F+ +RLDWFRLQ Y S   A       +E  + MN+I+ H+ +VD+L   + + S +    F+     + F+  L+  +Q RY++ FP IC HF++     CP++ + I   S+ + + +L  + ++   L+TD+      L+ +L P +            AK  S   N                 PG+ES   +       D    AL++L   +N  P +++   TF P  YL   L ++F      T S V +         I +PSE+L  ++  M+++  +  +V I+  ++F +  L+Q+   +  G  T+T +Y NWY++ +L Q    H    P +K F+ LP   +    +  N EEY+DI E+RAL E++GP+GMK L E +M  I   V+ L++ V+ N   L ++        ++  L   +  VD   +    +G++  F+ L +EAL DV+   +PFL S+V D +   D  P        E D ++       + + EL    GL  ++D  L  A+ S K +             + E +   LL+   +  LP +  +  + Y    E    + HC A AI ++    F  + +  ++D+++ F+AL SS+LL++G ET  ++           NR+S+Y+  D I+Q    ++ D  E CFPY L+R AYH V KQS
Sbjct:   28 ESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVFFDITVNFDLTKNYLDLIVTYTTLMIMLSRIEERKAIIGLYNYSHEMTHGASDREYPRLGQMIVDYE---NPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSAEQWRNAQLLSLISA--PSTMLNPAQSDTMP-CEYLSLDAMEKWIIFGFILCHGILNTDATALNLWKLALQSSSCLCLYRDEVFHIHKAAEDLFVNIRGYNKRINDIRECKENAVSHAGATHRERRKFLRSALKELATVLADQPGLLGPKALFVFMALSFARDEIIWLLRHADNIPKK-----VADDFMDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLSGFDAVVLNELVQN-LSVCPEDESIIMSSFVNTMTSLSVKQ-----VEDGEVFDFRGMRLDWFRLQAYTSVSKASLSLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELPSQSRYSISFPLICTHFMSCTHELCPEERHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTLSDQLLPKHC-----------AKTISQAVNKKSKKQTGKKGEPEREKPGVESMRKNRLVVTNLDKLHTALSELCFSINYAPNMVVWEHTFTPREYLTSHLEIRF------TKSIVGMTMYNQVTQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHGEPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENE----LTFNAEEYSDISEMRALSELLGPYGMKFLSESLMWHISSQVAELKKLVVENVEVLTQMRTSFDKPEQMAALFKRLTSVDSVLKRMTIIGVILSFRSLAQEALRDVLSYHIPFLVSSVEDFK---DHIP-------RETDMKV------AMNVYELSSAAGLPCEIDPALVVALSSQKSETIS---------PEEEYKIACLLMVFVAVSLPTLASNVMSQYSPAIEGHCNNIHCLAKAINQIAAALFTIH-KGSIEDRLKEFLALASSSLLKIGQETDKTT---------TRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQS 1097          
BLAST of Nck-associated protein 1 vs. Ensembl Xenopus
Match: NCKAP1 (NCK-associated protein 1 [Source:NCBI gene;Acc:100379683])

HSP 1 Score: 456.062 bits (1172), Expect = 1.938e-139
Identity = 335/1192 (28.10%), Postives = 583/1192 (48.91%), Query Frame = 2
Query:  104 LKPNISKITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVP----PLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRP-LLINNRTFQPNLYLKKEL-LKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHT---PLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMEDQTNELLIAATSYLLPRIVGS--NFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQS 3625
            L+P+  K+ EKL IL++R   +L ++ ++K          S +   +  ES ++ +V+KFP ++ +NN   +  L    S+IL  L  +Y T VDV+E K         +S+       +++FD+T+ YLDLI  Y+ +MI+LS I + K+I+ LYN++        +  Y RL + +V+       + ++  E  P+S+++ +A+ SL  +   +  S  +W   +  +LIS+  P  +LN + S  +P C+      +E+WIIFG++  +  L  + +AL LW+  L  S  + L+R E   IH          RGY K  N ++E  +   +++   HR RR +LR A++    ++ D PG + P  + +   ++ A DE+ WL+RH + IP K       DDF D+ + E I  +EELR +++++  VM++YY   L   D   L   + + +    +D+  I+  F   + ++++ Q     + D +   F+ +RLDWFRLQ Y S   A       +E  + MN+I+ H+ +VD+L   + + S +    F+     + F+  L+  +Q RY++ FP IC HF++     CP++ + I   S+ + + +L  + ++   L+TD+      L+ +L P +            AK  S   N                 PG+ES   +       D    AL++L   +N  P +++   TF P  YL   L ++F      T S V +         I +PSE+L  ++  M+++  +  +V I+  ++F +  L+Q+   +  G  T+T +Y NWY++ +L Q    H    P +K F+ LP   +    +  N EEY+DI E+RAL E++GP+GMK L E +M  I   V+ L++ V+ N   L ++        ++  L   +  VD   +    +G++  F+ L +EAL DV+   +PFL S+V D +   D  P        E D ++       + + EL    GL  ++D  L  A+ S K +             + E +   LL+   +  LP +  +  + Y    E    + HC A AI ++    F  + +  ++D+++ F+AL SS+LL++G ET  ++           NR+S+Y+  D I+Q    ++ D  E CFPY L+R AYH V KQS
Sbjct:    6 LQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKN-LESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFK---------VSSLSPQ---TVNFDLTKNYLDLIVTYTTLMIMLSRIEERKAIIGLYNYSHEMTHGASDREYPRLGQMIVDYE---NPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSAEQWRNAQLLSLISA--PSTMLNPAQSDTMP-CEYLSLDAMEKWIIFGFILCHGILNTDATALNLWKLALQSSSCLCLYRDEVFHIHKAAEDLFVNIRGYNKRINDIRECKENAVSHAGATHRERRKFLRSALKELATVLADQPGLLGPKALFVFMALSFARDEIIWLLRHADNIPKKV-----ADDFMDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLSGFDAVVLNELVQN-LSVCPEDESIIMSSFVNTMTSLSVKQ-----VEDGEVFDFRGMRLDWFRLQAYTSVSKASLSLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELPSQSRYSISFPLICTHFMSCTHELCPEERHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTLSDQLLPKHC-----------AKTISQAVNKKSKKQTGKKGEPEREKPGVESMRKNRLVVTNLDKLHTALSELCFSINYAPNMVVWEHTFTPREYLTSHLEIRF------TKSIVGMTMYNQVTQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHGEPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENE----LTFNAEEYSDISEMRALSELLGPYGMKFLSESLMWHISSQVAELKKLVVENVEVLTQMRTSFDKPEQMAALFKRLTSVDSVLKRMTIIGVILSFRSLAQEALRDVLSYHIPFLVSSVEDFK---DHIP-------RETDMKV------AMNVYELSSAAGLPCEIDPALVVALSSQKSETIS---------PEEEYKIACLLMVFVAVSLPTLASNVMSQYSPAIEGHCNNIHCLAKAINQIAAALFTIH-KGSIEDRLKEFLALASSSLLKIGQETDKTT---------TRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQS 1111          
BLAST of Nck-associated protein 1 vs. Ensembl Xenopus
Match: NCKAP1 (NCK-associated protein 1 [Source:NCBI gene;Acc:100379683])

HSP 1 Score: 447.588 bits (1150), Expect = 3.430e-136
Identity = 331/1197 (27.65%), Postives = 582/1197 (48.62%), Query Frame = 2
Query:  104 LKPNISKITEKLKILSERMTVVLIQIDSLKNLLQT-----ENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVP----PLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRP-LLINNRTFQPNLYLKKEL-LKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHT---PLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMEDQTNELLIAATSYLLPRIVGS--NFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQS 3625
            L+P+  K+ EKL IL++R   +L ++ ++K   Q      +         +   ES ++ +V+KFP ++ +NN  N +   A+       ++F        L  +D++ +L   I   Q   +I+++FD+T+ YLDLI  Y+ +MI+LS I + K+I+ LYN++        +  Y RL + +V+       + ++  E  P+S+++ +A+ SL  +   +  S  +W   +  +LIS+  P  +LN + S  +P C+      +E+WIIFG++  +  L  + +AL LW+  L  S  + L+R E   IH          RGY K  N ++E  +   +++   HR RR +LR A++    ++ D PG + P  + +   ++ A DE+ WL+RH + IP K       DDF D+ + E I  +EELR +++++  VM++YY   L   D   L   + + +    +D+  I+  F   + ++++ Q     + D +   F+ +RLDWFRLQ Y S   A       +E  + MN+I+ H+ +VD+L   + + S +    F+     + F+  L+  +Q RY++ FP IC HF++     CP++ + I   S+ + + +L  + ++   L+TD+      L+ +L P +            AK  S   N                 PG+ES   +       D    AL++L   +N  P +++   TF P  YL   L ++F      T S V +         I +PSE+L  ++  M+++  +  +V I+  ++F +  L+Q+   +  G  T+T +Y NWY++ +L Q    H    P +K F+ LP   +    +  N EEY+DI E+RAL E++GP+GMK L E +M  I   V+ L++ V+ N   L ++        ++  L   +  VD   +    +G++  F+ L +EAL DV+   +PFL S+V D +   D  P        E D ++       + + EL    GL  ++D  L  A+ S K +             + E +   LL+   +  LP +  +  + Y    E    + HC A AI ++    F  + +  ++D+++ F+AL SS+LL++G ET  ++           NR+S+Y+  D I+Q    ++ D  E CFPY L+R AYH V KQS
Sbjct:    6 LQPSQQKLAEKLTILNDRGVGMLTRLYNIKKQGQVWKACGDPKAKPSYLIDKNLESAVKFIVRKFPAVETRNNNVNNQSEIAL-------MFF--------LFCQDHVCELLNTIDVCQVFFDITVNFDLTKNYLDLIVTYTTLMIMLSRIEERKAIIGLYNYSHEMTHGASDREYPRLGQMIVDYE---NPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSAEQWRNAQLLSLISA--PSTMLNPAQSDTMP-CEYLSLDAMEKWIIFGFILCHGILNTDATALNLWKLALQSSSCLCLYRDEVFHIHKAAEDLFVNIRGYNKRINDIRECKENAVSHAGATHRERRKFLRSALKELATVLADQPGLLGPKALFVFMALSFARDEIIWLLRHADNIPKKV-----ADDFMDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLSGFDAVVLNELVQN-LSVCPEDESIIMSSFVNTMTSLSVKQ-----VEDGEVFDFRGMRLDWFRLQAYTSVSKASLSLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELPSQSRYSISFPLICTHFMSCTHELCPEERHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTLSDQLLPKHC-----------AKTISQAVNKKSKKQTGKKGEPEREKPGVESMRKNRLVVTNLDKLHTALSELCFSINYAPNMVVWEHTFTPREYLTSHLEIRF------TKSIVGMTMYNQVTQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHGEPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENE----LTFNAEEYSDISEMRALSELLGPYGMKFLSESLMWHISSQVAELKKLVVENVEVLTQMRTSFDKPEQMAALFKRLTSVDSVLKRMTIIGVILSFRSLAQEALRDVLSYHIPFLVSSVEDFK---DHIP-------RETDMKV------AMNVYELSSAAGLPCEIDPALVVALSSQKSETIS---------PEEEYKIACLLMVFVAVSLPTLASNVMSQYSPAIEGHCNNIHCLAKAINQIAAALFTIH-KGSIEDRLKEFLALASSSLLKIGQETDKTT---------TRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQS 1114          
BLAST of Nck-associated protein 1 vs. Ensembl Xenopus
Match: NCKAP1 (NCK-associated protein 1 [Source:NCBI gene;Acc:100379683])

HSP 1 Score: 441.81 bits (1135), Expect = 2.204e-134
Identity = 326/1188 (27.44%), Postives = 568/1188 (47.81%), Query Frame = 2
Query:  116 ISKITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVPPL----PGIESKPSDITKSNTFDMQLIALNQLATGLNSRP-LLINNRTFQPNLYLKKEL-LKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHT---PLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMEDQTNELLIAATSYLLPRIVGSNF--YHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQS 3625
            + K+ EKL IL++R   +L ++ ++K          S +   +  ES ++ +V+KFP ++ +NN   +  L    S+IL  L  +Y T VDV+E K         +S+       +++FD+T+ YLDLI  Y+ +MI+LS I + K+I+ LYN++        +  Y RL + +V+       + ++  E  P+S+++ +A+ SL  +   +  S  +W   +  +LIS+  P  +LN + S  +P C+      +E+WIIFG++  +  L  + +AL LW+  L  S  + L+R E   IH          RGY K  N ++E  +   +++   HR RR +LR A++    ++ D PG + P  + +   ++ A DE+ WL+RH + IP K       DDF D+ + E I  +EELR +++++  VM++YY   L   D   L   + + +    +D+  I+  F   + ++++ Q       D +   F+ +RLDWFRLQ Y S   A       +E  + MN+I+ H+ +VD+L   + + S +    F+     + F+  L+  +Q RY++ FP IC HF++     CP++ + I   S+ + + +L  + ++   L+TD+      L+ +L P +            AK  S   N                 PG+ES   +       D    AL++L   +N  P +++   TF P  YL   L ++F      T S V +         I +PSE+L  ++  M+++  +  +V I+  ++F +  L+Q+   +  G  T+T +Y NWY++ +L Q    H    P +K F+ LP   +    +  N EEY+DI E+RAL E++GP+GMK L E +M  I   V+ L++ V+ N   L ++        ++  L   +  VD   +    +G++  F+ L +EAL DV+   +PFL +                                  + + EL    GL  ++D  L  A+ S K +             + E +   LL+   +  LP +  +    Y    E    + HC A AI ++    F  + +  ++D+++ F+AL SS+LL++G ET  ++           NR+S+Y+  D I+Q    ++ D  E CFPY L+R AYH V KQS
Sbjct:    2 MQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKN-LESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFK---------VSSLSPQ---TVNFDLTKNYLDLIVTYTTLMIMLSRIEERKAIIGLYNYSHEMTHGASDREYPRLGQMIVDYE---NPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSAEQWRNAQLLSLISA--PSTMLNPAQSDTMP-CEYLSLDAMEKWIIFGFILCHGILNTDATALNLWKLALQSSSCLCLYRDEVFHIHKAAEDLFVNIRGYNKRINDIRECKENAVSHAGATHRERRKFLRSALKELATVLADQPGLLGPKALFVFMALSFARDEIIWLLRHADNIPKKV-----ADDFMDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLSGFDAVVLNELVQN-LSVCPEDESIIMSSFVNTMTSLSVKQ-------DGEVFDFRGMRLDWFRLQAYTSVSKASLSLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELPSQSRYSISFPLICTHFMSCTHELCPEERHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTLSDQLLPKHC-----------AKTISQAVNKKSKKQTGKKGEPEREKPGVESMRKNRLVVTNLDKLHTALSELCFSINYAPNMVVWEHTFTPREYLTSHLEIRF------TKSIVGMTMYNQVTQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHGEPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENE----LTFNAEEYSDISEMRALSELLGPYGMKFLSESLMWHISSQVAELKKLVVENVEVLTQMRTSFDKPEQMAALFKRLTSVDSVLKRMTIIGVILSFRSLAQEALRDVLSYHIPFLVA----------------------------------MNVYELSSAAGLPCEIDPALVVALSSQKSETIS---------PEEEYKIACLLMVFVAVSLPTLASNVMSQYSPAIEGHCNNIHCLAKAINQIAAALFTIH-KGSIEDRLKEFLALASSSLLKIGQETDKTT---------TRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQS 1083          
BLAST of Nck-associated protein 1 vs. Ensembl Mouse
Match: Nckap1 (NCK-associated protein 1 [Source:MGI Symbol;Acc:MGI:1355333])

HSP 1 Score: 474.167 bits (1219), Expect = 3.909e-146
Identity = 338/1193 (28.33%), Postives = 587/1193 (49.20%), Query Frame = 2
Query:  104 LKPNISKITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVP----PLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRP-LLINNRTFQPNLYLKKEL-LKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHT---PLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMED-QTNELLIAATSYLLPRIVGS--NFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQS 3625
            L+P+  K+ EKL IL++R   +L ++ ++K          S +   +  ES ++ +V+KFP ++ +NN   +  L    S+IL  L  +Y T VDV+E KD++ DL   I   Q   +I+++FD+T+ YLDL   Y+ +MI+LS I + K+I+ LYN+A        +  Y RL + +V+       + ++  E  P+S+++ +A+ SL  +   +  S  +W   +  +LIS+  P  +LN + S  +P C+      +E+WIIFG++  +  L    +AL LW+  L  S  + LFR E   IH          RGY K  N ++E  +   +++   HR RR +LR A++    ++ D PG + P  + +   ++ A DE+ WL+RH + +P K       DDF D+ + E I  +EELR +++++  VM++YY   L   D   L   + + +    +D+  I+  F   + ++++ Q     + D +   F+ +RLDWFRLQ Y S   A       +E  + MN+I+ H+ +VD+L   + + S +    F+     + F+  L+  +Q RY++ FP +C HF++     CP++ + I   S+ + + +L  + ++   L+TD+      L+ +L P +            AK  S   N                 PG+ES   +       D    AL++L   +N  P + +   TF P  YL   L ++F      T S V +         I +PSE+L  ++  M+++  +  +V I+  ++F +  L+Q+   +  G  T+T +Y NWY++ +L Q    H    P +K F+ LP   +    +  N EEY+DI E+R+L E++GP+GMK L E +M  I   V+ L++ V+ N   L ++        ++  L   +  VD   +    +G++  F+ L +EAL DV+   +PFL S++ D +   D  P        E D ++       + + EL    GL  ++D  L  A+           S +  NI   E+ +   LL+   +  LP +  +  + Y    E    + HC A AI ++    F  + +  ++D+++ F+AL SS+LL++G ET  ++           NR+S+Y+  D I+Q    ++ D  E CFPY L+R AYH V KQS
Sbjct:    6 LQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKN-LESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCDLLNTIDVCQVFFDITVNFDLTKNYLDLTVTYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQMIVDYE---NPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISA--PSTMLNPAQSDTMP-CEYLSLDAMEKWIIFGFILCHGMLNTEATALNLWKLALQSSSCLSLFRDEVFHIHKAAEDLFVNIRGYNKRINDIRECKEAAVSHAGSMHRERRKFLRSALKELATVLSDQPGLLGPKALFVFMALSFARDEIIWLLRHADNMPKK-----SADDFIDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLSGFDAVVLNELVQN-LSVCPEDESIIMSSFVNTMTSLSVKQ-----VEDGEVFDFRGMRLDWFRLQAYTSVSKASLSLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELPSQSRYSIAFPLLCTHFMSCTHELCPEERHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTLSDQLLPKHC-----------AKTISQAVNKKSKKQTGKKGEPEREKPGVESMRKNRLVVTNLDKLHTALSELCFSINYVPNMAVWEHTFTPREYLTSHLEIRF------TKSIVGMTMYNQATQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHGEPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENE----LTFNAEEYSDISEMRSLSELLGPYGMKFLSESLMWHISSQVAELKKLVVENVDVLTQMRTSFDKPDQMAALFKRLSSVDSVLKRMTIIGVILSFRSLAQEALRDVLSYHIPFLVSSIEDFK---DHIP-------RETDMKV------AMNVYELSSAAGLPCEIDPALVVALS----------SQKSENISPEEEYKIACLLMVFVAVSLPTLASNVMSQYSPAIEGHCNNIHCLAKAINQIAAALFTIH-KGSIEDRLKEFLALASSSLLKIGQETDKTT---------TRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQS 1123          
BLAST of Nck-associated protein 1 vs. Ensembl Mouse
Match: Nckap1 (NCK-associated protein 1 [Source:MGI Symbol;Acc:MGI:1355333])

HSP 1 Score: 471.855 bits (1213), Expect = 2.880e-145
Identity = 338/1198 (28.21%), Postives = 587/1198 (49.00%), Query Frame = 2
Query:  104 LKPNISKITEKLKILSERMTVVLIQIDSLKNLLQT-----ENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVP----PLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRP-LLINNRTFQPNLYLKKEL-LKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHT---PLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMED-QTNELLIAATSYLLPRIVGS--NFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQS 3625
            L+P+  K+ EKL IL++R   +L ++ ++K   Q      +         +   ES ++ +V+KFP ++ +NN   +  L    S+IL  L  +Y T VDV+E KD++ DL   I   Q   +I+++FD+T+ YLDL   Y+ +MI+LS I + K+I+ LYN+A        +  Y RL + +V+       + ++  E  P+S+++ +A+ SL  +   +  S  +W   +  +LIS+  P  +LN + S  +P C+      +E+WIIFG++  +  L    +AL LW+  L  S  + LFR E   IH          RGY K  N ++E  +   +++   HR RR +LR A++    ++ D PG + P  + +   ++ A DE+ WL+RH + +P K       DDF D+ + E I  +EELR +++++  VM++YY   L   D   L   + + +    +D+  I+  F   + ++++ Q     + D +   F+ +RLDWFRLQ Y S   A       +E  + MN+I+ H+ +VD+L   + + S +    F+     + F+  L+  +Q RY++ FP +C HF++     CP++ + I   S+ + + +L  + ++   L+TD+      L+ +L P +            AK  S   N                 PG+ES   +       D    AL++L   +N  P + +   TF P  YL   L ++F      T S V +         I +PSE+L  ++  M+++  +  +V I+  ++F +  L+Q+   +  G  T+T +Y NWY++ +L Q    H    P +K F+ LP   +    +  N EEY+DI E+R+L E++GP+GMK L E +M  I   V+ L++ V+ N   L ++        ++  L   +  VD   +    +G++  F+ L +EAL DV+   +PFL S++ D +   D  P        E D ++       + + EL    GL  ++D  L  A+           S +  NI   E+ +   LL+   +  LP +  +  + Y    E    + HC A AI ++    F  + +  ++D+++ F+AL SS+LL++G ET  ++           NR+S+Y+  D I+Q    ++ D  E CFPY L+R AYH V KQS
Sbjct:    6 LQPSQQKLAEKLTILNDRGVGMLTRLYNIKKQGQVWKACGDPKAKPSYLIDKNLESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCDLLNTIDVCQVFFDITVNFDLTKNYLDLTVTYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQMIVDYE---NPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISA--PSTMLNPAQSDTMP-CEYLSLDAMEKWIIFGFILCHGMLNTEATALNLWKLALQSSSCLSLFRDEVFHIHKAAEDLFVNIRGYNKRINDIRECKEAAVSHAGSMHRERRKFLRSALKELATVLSDQPGLLGPKALFVFMALSFARDEIIWLLRHADNMPKK-----SADDFIDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLSGFDAVVLNELVQN-LSVCPEDESIIMSSFVNTMTSLSVKQ-----VEDGEVFDFRGMRLDWFRLQAYTSVSKASLSLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELPSQSRYSIAFPLLCTHFMSCTHELCPEERHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTLSDQLLPKHC-----------AKTISQAVNKKSKKQTGKKGEPEREKPGVESMRKNRLVVTNLDKLHTALSELCFSINYVPNMAVWEHTFTPREYLTSHLEIRF------TKSIVGMTMYNQATQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHGEPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENE----LTFNAEEYSDISEMRSLSELLGPYGMKFLSESLMWHISSQVAELKKLVVENVDVLTQMRTSFDKPDQMAALFKRLSSVDSVLKRMTIIGVILSFRSLAQEALRDVLSYHIPFLVSSIEDFK---DHIP-------RETDMKV------AMNVYELSSAAGLPCEIDPALVVALS----------SQKSENISPEEEYKIACLLMVFVAVSLPTLASNVMSQYSPAIEGHCNNIHCLAKAINQIAAALFTIH-KGSIEDRLKEFLALASSSLLKIGQETDKTT---------TRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQS 1129          
BLAST of Nck-associated protein 1 vs. Ensembl Mouse
Match: Nckap1l (NCK associated protein 1 like [Source:MGI Symbol;Acc:MGI:1926063])

HSP 1 Score: 416.387 bits (1069), Expect = 7.587e-125
Identity = 313/1192 (26.26%), Postives = 567/1192 (47.57%), Query Frame = 2
Query:  122 KITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNS----------AYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQ-FNVMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVPPLPGIESKPSDITKSNTFDMQLIALNQLATGLNS-RPLLINNRTFQPNLYLKKELLKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYT---LHTPLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSK---IKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMEDQTNELLIAATSYLLPRIVG--SNFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVK 3619
            K+ EKL IL++R   VLI++ ++K           + CS+S          + ES L+ + KKFPNIDV+N+  ++ P+    ++I+  L  +Y + VDV+E +D++ +L   I A Q   +I+L+FD TR+YLDLI  Y++++++LS I   + ++ +YN A        +P + RL + ++E       +TE   E  P+++ +  A+ SL  L   + +   +W   +  +LISS  P  ++N + S  +  C+      +ERWII G+L  +  L  N    +LW+  L  S  I L R + LQ+H          +GY+K    +KE  +    NS  FH  RR +LR A++    ++ D PG + P  +     ++   DE+ WL+RH E +   K      +D+ D  + E +  +EE+R  +++   V+++Y+   L   D   L + I + +    +++  I+  F   L ++N+ Q     + + +   F  LRLDWFRLQ Y S   A     ++ +  + MN I+ HS ++D++   + + S +    FH     + F   L+     RY + FP IC HF++     CP+++  +    +   +++L  + ++    + ++     +LN +L P +           KAK+                   PG ES   + +     D   + L +LA  +N      +   T  P+ YL   L   LN   VTL+       +     I RPSE+L  +K  +S +  +++F+  + +++  +A L+Q+   +  G  T+T +Y NWY++ +L Q  +   + +P ++ FI+LP++ ++      + EE++DI E+RAL E++GP+GMK L E +M  +   +  L++ V+ N   L++   I  ++SK   +  LL  +   +   +    +G++  F+ + +E L +V     PFL              PI+ L      D+ I    +  L + EL    G+   +D  L  AI +LK               + E +   LL+   +  LP +    S+F+ +E +    + HC   AI ++    F  Y ++ ++  ++ F+ + S +LL+LG ET         + +   NR+SI +    +++    ++ D  E CFPY L+R AY  V +
Sbjct:   10 KLAEKLTILNDRGQGVLIRMYNIK-----------KTCSDSKSKPPFLLEKSMESCLKYINKKFPNIDVRNSTQHLGPVHREKAEIIRFLTNYYQSFVDVMEFRDHVYELLNTIDACQCHFDINLNFDFTRSYLDLIVTYTSVILLLSRIEDRRILIGMYNCAHEMLHGHSDPSFARLGQMVLEYDHPLKKLTE---EFGPHTKAVSGALLSLHFLFVRRNQGAEQWRSAQLLSLISS--PPAMINPANSDTMA-CEYLSVEVMERWIIIGFLLCHGCLNSNSQCQKLWKLCLEGSLYITLIREDVLQVHKVTEDLFSSLKGYSKRVADIKESKEHAITNSGQFHCQRRQFLRTAVKELETVLNDEPGLLGPKALFAFMALSFIRDEVTWLVRHTENVTKTK----TPEDYADSSIAELLFLLEEIRALVRRHIKVIQQYHLQYLARFDVLVLSDIIQN-LSVCPEEESVIMSSFVSILSSLNLKQ-----VDNEEKFDFSGLRLDWFRLQAYTSVSKAPLHLHENPDLAKVMNLIIFHSQMLDSVEKMLVETSDLSTFCFHLRTFEKMFATTLEEPTMLRYTIAFPLICAHFVHCVHEMCPEEYPHLKNHGLHHCNSFLEDLAKQTSNCVLEICAEQRNLNEQLLPKHCATTI-----SKAKNKKSMKQRQAPRKGEPERDKPGAESHRKNRSLVTNMDKLHLNLTELALAMNHVHSFSVFEHTIFPSEYLSSHLEARLNRAIVTLAGYNATTQE-----ILRPSELLAGVKAYISFIQSLAQFLGADASRIVRNALLQQTQPLDSSGEQTVTTLYTNWYLESLLRQASSGAIVLSPAMQAFISLPRDGEQN----FSAEEFSDISEMRALAEILGPYGMKFLSENLMWHVTSQIVELKKLVVENMDILVQ---IRSNFSKPELMASLLPQLTGAENVLKRMTIIGVILSFRAMAQEGLQEVFSAHCPFL------------MGPIECLKEFVTPDTDI----KVTLSVFELACAAGVSCDIDPALVAAIANLKADNSS---------PEEEYKVACLLLIFLAVSLPLLATDPSSFFSIEKDGYNNNIHCLTKAIIQVSAALFTLYNKN-IETHLKEFLVVASVSLLQLGQET---------DKLKTRNRESISLLMRLVVEESPFLTLDMLESCFPYVLLRNAYREVSR 1122          
BLAST of Nck-associated protein 1 vs. Ensembl Mouse
Match: Nckap1l (NCK associated protein 1 like [Source:MGI Symbol;Acc:MGI:1926063])

HSP 1 Score: 120.168 bits (300), Expect = 3.406e-29
Identity = 85/284 (29.93%), Postives = 150/284 (52.82%), Query Frame = 2
Query:  122 KITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNS----------AYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPS 925
            K+ EKL IL++R   VLI++ ++K           + CS+S          + ES L+ + KKFPNIDV+N+  ++ P+    ++I+  L  +Y + VDV+E +D++ +L   I A Q   +I+L+FD TR+YLDLI  Y++++++LS I   + ++ +YN A        +P + RL + ++E       +TE   E  P+++ +  A+ SL  L   + +   +W   +  +LISS  P  ++N + S  +  C+      +ERWII    S    + + P 
Sbjct:   10 KLAEKLTILNDRGQGVLIRMYNIK-----------KTCSDSKSKPPFLLEKSMESCLKYINKKFPNIDVRNSTQHLGPVHREKAEIIRFLTNYYQSFVDVMEFRDHVYELLNTIDACQCHFDINLNFDFTRSYLDLIVTYTSVILLLSRIEDRRILIGMYNCAHEMLHGHSDPSFARLGQMVLEYDHPLKKLTE---EFGPHTKAVSGALLSLHFLFVRRNQGAEQWRSAQLLSLISS--PPAMINPANSDTMA-CEYLSVEVMERWIITSARSCGSCVWRVPC 276          
BLAST of Nck-associated protein 1 vs. UniProt/SwissProt
Match: sp|B0S6R1|NCKP1_DANRE (Nck-associated protein 1 OS=Danio rerio OX=7955 GN=nckap1 PE=3 SV=1)

HSP 1 Score: 476.478 bits (1225), Expect = 3.490e-146
Identity = 337/1194 (28.22%), Postives = 590/1194 (49.41%), Query Frame = 2
Query:  101 GLKPNISKITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVP----PLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRP-LLINNRTFQPNLYLKKEL-LKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHT---PLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMED-QTNELLIAATSYLLPRIVGS--NFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQS 3625
             ++P+  K+ EKL IL++R   +L +I ++K          S +   +  ES ++ +V+KFP ++ +NN   +  L    S+IL  L  +Y T VDV+E KD++ +L   I A Q   +I+++FD+T+ YLDL+  Y+ +M++LS I + K+I+ LYN+A        +  Y RL + +V+       + ++  E  P+ +++ +A+ SL  +   +  S  +W   +  +LIS+  P  +LN + S  +P C+      +E+WI+FG++  +  L  +P+AL LW+  L  S  + LFR E   IH          RGY K  N ++E  +   +++   HR RR +LR A++    ++ D PG + P  + +   ++ A DE+ WL+RH + I  K      TDDF D+ + E I  +EELR +++++  VM++YY   L   D   L   + + +    +D+  I+  F   + ++++ Q     + D +   F+ +RLDWFRLQ Y S   A       +E  + MN+I+ H+ +VD+L   + + S +    F+     + F+  L+  +Q RY++ FP +C HF++     CP++ + I   S+ + + +L  + ++   L+TD+      L+ +L P +            AK  S   N                 PG+ES   +       D    AL++L   +N  P +++   TF P  YL   L ++F      T S V +         I +PSE+L  ++  M+++  +  +V I+  ++F +  L+Q+   +  G  T+T +Y NWY++ +L Q    H    P +K F+ LP   +    +  N EEY+DI E+R+L E++GP+GMK L E +M  I   V+ L++ V+ N   L ++         +  L   +  VD   +    +G++  F+ L +EAL DV+   +PFL S+V D +   D  P        E D ++       + + EL    GL  ++D  L  A+           S +  NI   E+ +   LL+   +  +P +  +  + Y    E    + HC A AI ++    F  + +  ++D+++ F+AL SS+LL++G ET  ++           NR+S+Y+  D I+Q    ++ D  E CFPY L+R AYH V KQS
Sbjct:    5 AMQPSQQKLAEKLTILNDRGIGMLTRIYNIKKACGDPKAKPSYLIDKN-LESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDACQVFFDITVNFDLTKNYLDLVVTYTTLMLLLSRIEERKAIIGLYNYAHEMTHGSSDREYPRLGQMIVDYE---NPLKKMMEEFVPHGKSLSDALVSLQMVYPRRNLSADQWRNAQLLSLISA--PSTMLNPAQSDTMP-CEYLSLDTMEKWIVFGFILCHAALNSDPAALSLWKLALQSSTCLCLFRDEVFHIHKAAEDLFVNIRGYNKRVNDIRECKESALSHAGSMHRERRKFLRSALKELATVLADQPGLLGPKALFVFMALSFARDEIIWLLRHADNIQKK-----STDDFIDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLSGFDAVVLNELVQN-LSVCPEDESIIMSSFVNTMTSLSVKQ-----VEDGEVFDFRGMRLDWFRLQAYTSVSKASLGLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELPSQSRYSISFPLLCTHFMSCTHELCPEERHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTLSDQLLPKHC-----------AKTISQAVNKKSKKQTGKKGEPEREKPGVESMRKNRLLVTNLDKLHTALSELCFSINYVPNMMVWEHTFTPREYLTSHLEIRF------TKSIVGMTMYNQTTQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHGEPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENE----LTFNAEEYSDISEMRSLSELLGPYGMKFLSESLMWHISSQVAELKKLVVDNVEVLTQMRTSFDKPDHMAALFKRLTSVDSVLKRMTIIGVILSFRSLAQEALRDVLSCHIPFLVSSVEDFK---DHIP-------RETDMKV------AMNVYELSSAAGLPCEIDPALVVALS----------SQKSENISPEEEYKIACLLMVFVAVSMPTLASNVMSQYSPAIEGHCNNIHCLAKAINQIAAALFTIH-KGSIEDRLKEFLALASSSLLKIGQETDKTT---------TRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQS 1123          
BLAST of Nck-associated protein 1 vs. UniProt/SwissProt
Match: sp|P55161|NCKP1_RAT (Nck-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Nckap1 PE=2 SV=1)

HSP 1 Score: 476.478 bits (1225), Expect = 3.600e-146
Identity = 339/1193 (28.42%), Postives = 588/1193 (49.29%), Query Frame = 2
Query:  104 LKPNISKITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVP----PLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRP-LLINNRTFQPNLYLKKEL-LKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHT---PLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMED-QTNELLIAATSYLLPRIVGS--NFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQS 3625
            L+P+  K+ EKL IL++R   +L ++ ++K          S +   +  ES ++ +V+KFP ++ +NN   +  L    S+IL  L  +Y T VDV+E KD++ DL   I   Q   +I+++FD+T+ YLDL   Y+ +MI+LS I + K+I+ LYN+A        +  Y RL + +V+       + ++  E  P+S+++ +A+ SL  +   +  S  +W   +  +LIS+  P  +LN + S  +P C+      +E+WIIFG++  +  L    +AL LW+  L  S  + LFR E   IH          RGY K  N ++E  +   +++   HR RR +LR A++    ++ D PG + P  + +   ++ A DE+ WL+RH + +P K       DDF D+ + E I  +EELR +++++  VM++YY   L   D   L   + + +    +D+  I+  F   + ++++ Q     + D +   F+ +RLDWFRLQ Y S   A       +E  + MN+I+ H+ +VD+L   + + S +    F+     + F+  L+  +Q RY++ FP +C HF++     CP++ + I   S+ + + +L  + ++   L+TD+      L+ +L P +            AK  S   N                 PG+ES   +       D    AL++L   +N  P + +   TF P  YL   L ++F      T S V +         I +PSE+L  ++E M+++  +  +V I+  ++F +  L+Q+   +  G  T+T +Y NWY++ +L Q    H    P +K F+ LP   +    +  N EEY+DI E+R+L E++GP+GMK L E +M  I   V+ L++ V+ N   L ++        ++  L   +  VD   +    +G++  F+ L +EAL DV+   +PFL S++ D +   D  P        E D ++       + + EL    GL  ++D  L  A+           S +  NI   E+ +   LL+   +  LP +  +  + Y    E    + HC A AI ++    F  + +  ++D+++ F+AL SS+LL++G ET  ++           NR+S+Y+  D I+Q    ++ D  E CFPY L+R AYH V KQS
Sbjct:    6 LQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKN-LESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCDLLNTIDVCQVFFDITVNFDLTKNYLDLTVTYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQMIVDYEH---PLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISA--PSTMLNPAQSDTMP-CEYLSLDAMEKWIIFGFILCHGMLNTEATALNLWKLALQSSSCLSLFRDEVFHIHKAAEDLFVNIRGYNKRINDIRECKEAAVSHAGSMHRERRKFLRSALKELATVLSDQPGLLGPKALFVFMALSFARDEIIWLLRHADNMPKK-----SADDFIDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLSGFDAVVLNELVQN-LSVCPEDESIIMSSFVNTMTSLSVKQ-----VEDGEVFDFRGMRLDWFRLQAYTSVSKASLSLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELPSQSRYSIAFPLLCTHFMSCTHELCPEERHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTLSDQLLPKHC-----------AKTISQAVNKKSKKQTGKKGEPEREKPGVESMRKNRLVVTNLDKLHTALSELCFSINYVPNMAVWEHTFTPREYLTSHLEIRF------TKSIVGMTMYNQATQEIAKPSELLTSVREYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHGEPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENE----LTFNAEEYSDISEMRSLSELLGPYGMKFLSESLMWHISSQVAELKKLVVENVDVLTQMRTSFDKPDQMAALFKRLSSVDSVLKRMTIIGVILSFRSLAQEALRDVLSYHIPFLVSSIEDFK---DHIP-------RETDMKV------AMNVYELSSAAGLPCEIDPALVVALS----------SQKSENISPEEEYKIACLLMVFVAVSLPTLASNVMSQYSPAIEGHCNNIHCLAKAINQIAAALFTIH-KGSIEDRLKEFLALASSSLLKIGQETDKTT---------TRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQS 1123          
BLAST of Nck-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q9Y2A7|NCKP1_HUMAN (Nck-associated protein 1 OS=Homo sapiens OX=9606 GN=NCKAP1 PE=1 SV=1)

HSP 1 Score: 474.937 bits (1221), Expect = 1.703e-145
Identity = 338/1193 (28.33%), Postives = 590/1193 (49.46%), Query Frame = 2
Query:  104 LKPNISKITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVP----PLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRP-LLINNRTFQPNLYLKKEL-LKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHT---PLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMED-QTNELLIAATSYLLPRIVGS--NFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQS 3625
            L+P+  K+ EKL IL++R   +L ++ ++K          S +   +  ES ++ +V+KFP ++ +NN   +  L    S+IL  L  +Y T VDV+E KD++ +L   I   Q   +I+++FD+T+ YLDLI  Y+ +MI+LS I + K+I+ LYN+A        +  Y RL + +V+       + ++  E  P+S+++ +A+ SL  +   +  S  +W   +  +LIS+  P  +LN + S  +P C+      +E+WIIFG++  +  L  + +AL LW+  L  S  + LFR E   IH          RGY K  N ++E  +   +++   HR RR +LR A++    ++ D PG + P  + +   ++ A DE+ WL+RH + +P K       DDF D+ + E I  +EELR +++++  VM++YY   L   D   L   + + +    +D+  I+  F   + ++++ Q     + D +   F+ +RLDWFRLQ Y S   A       +E  + MN+I+ H+ +VD+L   + + S +    F+     + F+  L+  +Q RY++ FP +C HF++     CP++ + I   S+ + + +L  + ++   L+TD+      L+ +L P +            AK  S   N                 PG+ES   +       D    AL++L   +N  P +++   TF P  YL   L ++F      T S V +         I +PSE+L  ++  M+++  +  +V I+  ++F +  L+Q+   +  G  T+T +Y NWY++ +L Q    H    P +K F+ LP   +    +  N EEY+DI E+R+L E++GP+GMK L E +M  I   V+ L++ V+ N   L ++        ++  L   +  VD   +    +G++  F+ L +EAL DV+   +PFL S++ D +   D  P        E D ++       + + EL    GL  ++D  L  A+           S +  NI   E+ +   LL+   +  LP +  +  + Y    E    + HC A AI ++    F  + +  ++D+++ F+AL SS+LL++G ET  ++           NR+S+Y+  D I+Q    ++ D  E CFPY L+R AYH V KQS
Sbjct:    6 LQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKN-LESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVFFDITVNFDLTKNYLDLIITYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQMIVDYE---NPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISA--PSTMLNPAQSDTMP-CEYLSLDAMEKWIIFGFILCHGILNTDATALNLWKLALQSSSCLSLFRDEVFHIHKAAEDLFVNIRGYNKRINDIRECKEAAVSHAGSMHRERRKFLRSALKELATVLSDQPGLLGPKALFVFMALSFARDEIIWLLRHADNMPKK-----SADDFIDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLSGFDAVVLNELVQN-LSVCPEDESIIMSSFVNTMTSLSVKQ-----VEDGEVFDFRGMRLDWFRLQAYTSVSKASLGLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELPSQSRYSIAFPLLCTHFMSCTHELCPEERHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTLSDQLLPKHC-----------AKTISQAVNKKSKKQTGKKGEPEREKPGVESMRKNRLVVTNLDKLHTALSELCFSINYVPNMVVWEHTFTPREYLTSHLEIRF------TKSIVGMTMYNQATQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHGEPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENE----LTFNAEEYSDISEMRSLSELLGPYGMKFLSESLMWHISSQVAELKKLVVENVDVLTQMRTSFDKPDQMAALFKRLSSVDSVLKRMTIIGVILSFRSLAQEALRDVLSYHIPFLVSSIEDFK---DHIP-------RETDMKV------AMNVYELSSAAGLPCEIDPALVVALS----------SQKSENISPEEEYKIACLLMVFVAVSLPTLASNVMSQYSPAIEGHCNNIHCLAKAINQIAAALFTIH-KGSIEDRLKEFLALASSSLLKIGQETDKTT---------TRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQS 1123          
BLAST of Nck-associated protein 1 vs. UniProt/SwissProt
Match: sp|P28660|NCKP1_MOUSE (Nck-associated protein 1 OS=Mus musculus OX=10090 GN=Nckap1 PE=1 SV=2)

HSP 1 Score: 474.167 bits (1219), Expect = 2.734e-145
Identity = 338/1193 (28.33%), Postives = 587/1193 (49.20%), Query Frame = 2
Query:  104 LKPNISKITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVP----PLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRP-LLINNRTFQPNLYLKKEL-LKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHT---PLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMED-QTNELLIAATSYLLPRIVGS--NFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQS 3625
            L+P+  K+ EKL IL++R   +L ++ ++K          S +   +  ES ++ +V+KFP ++ +NN   +  L    S+IL  L  +Y T VDV+E KD++ DL   I   Q   +I+++FD+T+ YLDL   Y+ +MI+LS I + K+I+ LYN+A        +  Y RL + +V+       + ++  E  P+S+++ +A+ SL  +   +  S  +W   +  +LIS+  P  +LN + S  +P C+      +E+WIIFG++  +  L    +AL LW+  L  S  + LFR E   IH          RGY K  N ++E  +   +++   HR RR +LR A++    ++ D PG + P  + +   ++ A DE+ WL+RH + +P K       DDF D+ + E I  +EELR +++++  VM++YY   L   D   L   + + +    +D+  I+  F   + ++++ Q     + D +   F+ +RLDWFRLQ Y S   A       +E  + MN+I+ H+ +VD+L   + + S +    F+     + F+  L+  +Q RY++ FP +C HF++     CP++ + I   S+ + + +L  + ++   L+TD+      L+ +L P +            AK  S   N                 PG+ES   +       D    AL++L   +N  P + +   TF P  YL   L ++F      T S V +         I +PSE+L  ++  M+++  +  +V I+  ++F +  L+Q+   +  G  T+T +Y NWY++ +L Q    H    P +K F+ LP   +    +  N EEY+DI E+R+L E++GP+GMK L E +M  I   V+ L++ V+ N   L ++        ++  L   +  VD   +    +G++  F+ L +EAL DV+   +PFL S++ D +   D  P        E D ++       + + EL    GL  ++D  L  A+           S +  NI   E+ +   LL+   +  LP +  +  + Y    E    + HC A AI ++    F  + +  ++D+++ F+AL SS+LL++G ET  ++           NR+S+Y+  D I+Q    ++ D  E CFPY L+R AYH V KQS
Sbjct:    6 LQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKN-LESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCDLLNTIDVCQVFFDITVNFDLTKNYLDLTVTYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQMIVDYE---NPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISA--PSTMLNPAQSDTMP-CEYLSLDAMEKWIIFGFILCHGMLNTEATALNLWKLALQSSSCLSLFRDEVFHIHKAAEDLFVNIRGYNKRINDIRECKEAAVSHAGSMHRERRKFLRSALKELATVLSDQPGLLGPKALFVFMALSFARDEIIWLLRHADNMPKK-----SADDFIDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLSGFDAVVLNELVQN-LSVCPEDESIIMSSFVNTMTSLSVKQ-----VEDGEVFDFRGMRLDWFRLQAYTSVSKASLSLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELPSQSRYSIAFPLLCTHFMSCTHELCPEERHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTLSDQLLPKHC-----------AKTISQAVNKKSKKQTGKKGEPEREKPGVESMRKNRLVVTNLDKLHTALSELCFSINYVPNMAVWEHTFTPREYLTSHLEIRF------TKSIVGMTMYNQATQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHGEPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENE----LTFNAEEYSDISEMRSLSELLGPYGMKFLSESLMWHISSQVAELKKLVVENVDVLTQMRTSFDKPDQMAALFKRLSSVDSVLKRMTIIGVILSFRSLAQEALRDVLSYHIPFLVSSIEDFK---DHIP-------RETDMKV------AMNVYELSSAAGLPCEIDPALVVALS----------SQKSENISPEEEYKIACLLMVFVAVSLPTLASNVMSQYSPAIEGHCNNIHCLAKAINQIAAALFTIH-KGSIEDRLKEFLALASSSLLKIGQETDKTT---------TRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQS 1123          
BLAST of Nck-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q640K3|NCKP1_XENLA (Nck-associated protein 1 OS=Xenopus laevis OX=8355 GN=nckap1 PE=2 SV=1)

HSP 1 Score: 470.315 bits (1209), Expect = 6.977e-144
Identity = 337/1192 (28.27%), Postives = 588/1192 (49.33%), Query Frame = 2
Query:  104 LKPNISKITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVP----PLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRP-LLINNRTFQPNLYLKKEL-LKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHT---PLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMEDQTNELLIAATSYLLPRIVGS--NFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQS 3625
            L+P+  K+ EKL IL++R   +L ++ ++K          S +   +  ES ++ +V+KFP ++ +NN   +  L    S+IL  L  +Y T VDV+E KD++ +L   I   Q  L+I+++FD+T+ YLDLI  Y+ +MI+LS I + K+I+ LYN++        +  Y RL + +V+       + ++  E  P+S+++ +A+ SL  +   +  S  +W   +  +LIS+  P  +LN + S  +P C+      +E+WII G++  +  L  + ++L LW+  L  S  I L+R E L  H          RGY K  N ++E  +   +++   HR RR +LR A++    ++ D PG + P  + +   ++ A DE+ WL+RH + IP K       DDF D+ + E I  +EELR +++++  VM++YY   L   D   L   + + +    +D+  I+  F   + ++++ Q     + D +   F+ +RLDWFRLQ Y S   A       +E  + MN+I+ H+ +VD+L   + + S +    F+     + F+  L+  +Q RY++ FP +C HF++     CP++ + I   S+ + + +L  + ++   L+TD+      L+ +L P +            AK  S   N                 PG+ES   +       D    AL++L   +N  P +++   TF P  YL   L ++F      T S V +         I +PSE+L  ++  M+++  +  +V I+  ++F +  L+Q+   +  G  T+T +Y NWY++ +L Q    H    P +K F+ LP   +    +  N EEY+DI E+RAL E++GP+GMK L E +M  I   V+ L++ V+ N   L ++        ++      +  VD   +    +G++  F+ L +EAL DV+   +PFL S+V D +   D  P        E D ++       + + EL    GL  ++D  L  A+ S K +             + E +   LL+   +  LP +  +  + Y    E    + HC A AI ++    F  + +  ++D+++ F+AL SS+LL++G ET  ++           NR+S+Y+  D I+Q    ++ D  E CFPY L+R AYH V KQS
Sbjct:    6 LQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKN-LESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVFLDITVNFDLTKNYLDLIVTYTTLMIMLSRIEERKAIIGLYNYSHEMTHGASDREYPRLGQMIVDYE---NPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSAEQWRNAQLLSLISA--PSTMLNPAQSDTMP-CEYLSLDTMEKWIILGFILCHGILNTDATSLNLWKLALQSSSCICLYRDEVLHFHKAAEDLFVNIRGYNKRINDIRECKENAVSHAGATHRERRKFLRSALKELATVLSDQPGLLGPKALFVFMALSFARDEIIWLLRHADNIPKK-----IADDFMDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLSGFDAVVLNELVQN-LSVCPEDESIIMSSFVNTMTSLSVKQ-----VEDGEVFDFRGMRLDWFRLQAYTSVSKASLSLTDHRELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELPSQSRYSISFPLLCTHFMSCTHELCPEERHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTLSDQLLPKHC-----------AKTISQAVNKKSKKQTGKKGEPEREKPGVESMRKNRLVVTNLDKLHTALSELCFSINYAPNMVVWEHTFTPREYLTSHLEIRF------TKSIVGMTMYNQVTQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHGEPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENE----LTFNAEEYSDISEMRALSELLGPYGMKFLSESLMWHISSQVAELKKLVVENVEVLTQMRTSFDKPEQMAAFFKRLTSVDSVLKRMTIIGVILSFRSLAQEALKDVLSYHIPFLVSSVEDFK---DHIP-------RETDMKV------AMNVYELSSAAGLPCEIDPALVVALSSQKSETIS---------PEEEYKIACLLMVFVAVSLPTLASNVMSQYSPAIEGHCNNIHCLAKAINQIAAALFTIH-KGSIEDRLKEFLALASSSLLKIGQETDKTT---------TRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQS 1123          
BLAST of Nck-associated protein 1 vs. TrEMBL
Match: A0A4E0RJA0 (NCK-associated protein 1 OS=Fasciola hepatica OX=6192 GN=D915_001508 PE=4 SV=1)

HSP 1 Score: 525.013 bits (1351), Expect = 3.779e-160
Identity = 386/1292 (29.88%), Postives = 619/1292 (47.91%), Query Frame = 2
Query:  122 KITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQI-CSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDN-----LLNMSPSVLLPYCQIERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLE---LQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIK-------TDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSS--------FKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKD--------------CSDFSNHSKSYSKIV-------VPPLPGIESKPSDITKSNTFDMQLIALNQLATGLNS-RPLLINNRTFQPNLYLKKELLKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKE-FMGFTTLTEIYCNWYVDFVLNQPYTLH---TPLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQL--------SSVSEHD-----SQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXN----------IDQMEDQTNELLIAATSYLLPRIVG--SNFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSS----------------------------------SQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQS-----RLVMTKAAH 3652
            K+ E+L IL++R   VL ++  +K LL + +   + +   +  +E   + L+KKFP+I+ ++ +S+I+P       +   +  +Y  L DVLEV+DN  DL G+ SA Q  L+I+++ D+TR YL+L++NY AMM  L+ I  +K+IL L+NF       + EP Y R+ E   E       +  +H E+NP+++TI  A++SL+     +      W  G   N+++  +P       L +     L+PY  +ERW++FGYL +YPEL  +  A    ++ L  ++ +VLFR E + IH  L  +LE     +   K  N +KE      + +   H  RR YLR A+R    I+ D PG + P   ++   ++ A DE+ WL+RH    P KK S+         T++F D  LPE +  +EELR  + ++  V++++Y  +L   D P L+ Y    +  L  D+  IL   S++L    +D S+E  L D   +         F  +RLDW RLQT +S   A       +  ++ ++S + H+ LVD L   +   S M    F+  +  + F   L   AQ R+ +VFP +C H +  C   CP++   + RSS+ +AH +  +I   +C      V    +L  +L P  AV +       K K                S+    SKS S          V  +PG+ES   +  +  T D  L +L+QL   +N  R LL+ ++   P   L+ E+   L +   + S      D S+   I +PS++L  ++  M  ++ +   V I+   +F   F + +  ++ F G  T+T  Y  WYV+ ++   Y  H   +PLLK F+T+     EV  V    E++ D+ ELRAL E+IGP GMK + +++MQ +   V  +++ V++NRSTL  L     D  K +++  ++++ D      K++G+   F+ LC EALNDV++K  PFL STV +L+         QL        ++VS +        IYA+  +QL +N L    G+ + +D +L   + S +                          ++     L I   +  LPR+    S+ YH++ EA E + HC AY++  LM   F       L+ + + F+AL SS+LLRLGLET +S                                  S +N +       RDSIYI FD +I+    +S    E CFPY+L+R AYHNV K S     R  M  A+H
Sbjct:    9 KLAERLFILNDRQLGVLTRLHHMKQLLSSPDYRPTVMPGGDKVFEPAWKVLLKKFPSIEFRSGQSSIQPFITHQKGLFGVMSTYYYNLADVLEVRDNFSDLLGRFSASQIQLDITVNSDITRLYLELVSNYFAMMFFLTRIPDVKAILALFNFLYDQLNGKPEPNYPRMAELFTET--PDAMLRTLHAEINPHAKTISRALSSLSDFFVRRTVRAQNWSDGHFLNILN--EPGKIAHTVLGDQLACELIPYEMMERWVVFGYLLIYPEL-SDEDAFNRLKTALKHTYVVVLFRDEVVYIHALLQSFLESVWTNKVGAKRINEIKETLSIACSQTLEVHADRRAYLRSALRQLHLILADEPGLLGPKAFLVFWGLSYAADEVQWLLRHLSNPPVKKSSTGSSRSHQNPTEEFGDPFLPELLFYMEELRLLIVRYTPVIQRFYVQLLACYDAPGLREYAGEILPRLPGDEAIILSSISKQL----LDLSDEQVLQDTTQNCCEQFAIFDFSGIRLDWLRLQTSMSCKTAPIMLADHRRLVEHLHSTIFHTKLVDYLDELLRLVSDMSVFTFYPTQFADLFAHCLMCPAQLRFTIVFPSVCCHAVQACHDLCPEERAFLGRSSIRIAHHFCQKIADRVCADFLTRVDEFGNLADQLAPQTAVPWLFEDRPAKRKGKKVSSTGRSAINGTGSNEMAKSKSLSGKTGTVHGNDVRFVPGMESFRRNREEQTTNDRTLFSLSQLCQAVNHYRELLVYDQVINPREVLQNEIQARLIEVLASYSECTPVTDHSDELIIPKPSDLLRRVRALMDALVDLEHHVCIDVIGIFSTVFTQHTQPRDGFKGHLTMTAHYTKWYVEHLIKHAYADHFVYSPLLKSFVTM--VSPEV--VRFRAEDFADLNELRALAELIGPLGMKHMCDQLMQDVGHRVDEIKKLVLQNRSTLESLRECFDDPQKTRQVGNSLQNSDTLLVLLKEIGVALAFRKLCSEALNDVLQKRTPFLLSTVHNLRNYVTQQSGGQLLPPTPGSAAAVSANGIRDDVETIYARFDSQLVLNNLSASMGILSDLDYSLCAILNSRRSAALAASQQANAGGPMNGVGAVPFPDLDYHIACLFIVFVANALPRLARQESSAYHLDLEANENNTHCLAYSVNALMVAMFSLLRPGDLEARSKEFLALASSSLLRLGLETSTSVLSSEVCGGAIGIGGGAGGGTGIGSSGGQSFSSSSSSNPNPTHPAKQRDSIYILFDNLIRHSPCLSHSLQEACFPYSLIRSAYHNVAKASTIPAIRSNMMSASH 1287          
BLAST of Nck-associated protein 1 vs. TrEMBL
Match: A0A5J4NG41 (NCK-associated protein 1 OS=Paragonimus westermani OX=34504 GN=DEA37_0002653 PE=4 SV=1)

HSP 1 Score: 521.546 bits (1342), Expect = 5.909e-159
Identity = 380/1293 (29.39%), Postives = 625/1293 (48.34%), Query Frame = 2
Query:  122 KITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQI-CSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPS-----VLLPYCQIERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLEL----QRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIK-------TDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFF---------SEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAV----DFYLSHLSKKAKDCSD----------------FSNHSKSYSKI-------VVPPLPGIESKPSDITKSNTFDMQLIALNQLATGLNS-RPLLINNRTFQPNLYLKKELLKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKE-FMGFTTLTEIYCNWYVDFVLNQPYTLH---TPLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDL-----QQDFDA--NPIDQLSSVSEHDS-------QIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNI----------DQMEDQTNELLIAATSYLLPRIVG--SNFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLET----------GSSSQTNKDEMILIN-----NRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQSRLVMTKAAHPTDASSKAAMEAYKVD 3700
            K+ E+L IL++R   VL ++  +K +L +++   + +   + A+++  ++L+KKFP+I++K  +SNI+P      +++  +  +Y  LVDVL+V+DN+ D   +       L+I+++ D+TR YL+LI+NY AMM +L+ I  +K+IL L+NF       + EP + R+ ER  E       +  +H ++ P+SR I+ A+ SL+     +      W  G   N+++  +P  + +          L+PY  +ERW++FGYL +Y + L +  A    ++ L  ++ +VLFR E + IH  +  +LE     + G  ++  I KE      + +   H  RR YLR A+R    I+ D PG + P   ++   ++ A DE+HWL+RH    P +K            T+D+ D LLPE +  +EELR  + ++  V++++Y  +L   D P L  Y+   +  LS D+  IL             E L+N N +   + A+ D     F  +RLDW RLQ  LS+  +          +   +S + H+ LVD L   +   S +    F+  +  + F   L   AQ R+ +VFP +C H +  C   CP++   + RSS+ MAH +  +I   +C  L   V     L  +L P NAV    D  L+    K    S+                +SN S    KI         P LPG+ES         T D  L +L+QL   +N  R L++ ++   P   L+ E+   L +   + +      +      + +PSE+L  ++  M +++ +   V I+   +F   F + +  ++ F G  T+T  Y  WY+D +L   Y  H   +PLLK F+TL     EV  V    E++ D+ ELRAL E+IGP G+K L +++MQ +   V  L++ V++NRS L  L     D  K ++L   +++ D      K++G+   F+ LC EALNDV+++  PFL S+V +L     QQ       P   L++ +  +S        IYA+  +QL +N L    G+ + +D +L   + S +       S                  ++     L I   +  LPR+    ++ YH++ EA E + HC AY++  LM   F       L+ + + F+AL SSNLLRLGLET          G++ Q++   +   N     +RDSIYI FD +++    +S    E CFPY+L+R AYHNV K +   +  A  P   SS   ++    D
Sbjct:    9 KLAERLFILNDRQLGVLTRLHHMKQILNSQDYRPTVMPGGDKAFDAAWKTLLKKFPSIEIKTGQSNIQPFVTHQKELIGVMSTYYYNLVDVLDVRDNVNDTLARFGCAHIQLDITVNSDLTRLYLELISNYFAMMFLLTRIPDVKAILALFNFLYDQLHGKAEPNFPRMAERFAE--PPDAMLKLLHADIYPHSRIILRALGSLSDFFVRRTVRAQNWSDGHFLNILN--EPGKIAHTVLGDQLAYELIPYEMMERWVVFGYLLIYKD-LSDEDAFNRLKTALRHTYVVVLFRDEVIYIHALIQSFLESVWTNKVGAKRICEI-KETLTIACSQTLEVHADRRAYLRSALRQLHLILADEPGLLGPKAFLVFWGLSYATDEIHWLLRHIANPPVRKTGGSSSRPGLNPTEDYGDPLLPELLFYMEELRMLIVRYTPVIQRFYFQLLSCYDAPGLHEYVREILPRLSSDEGTILTSIMKQLSDLSAHEVLQNTNQNSCEQFAMFD-----FAGIRLDWLRLQASLSAKESSVNLADHPRLVGHFHSTIFHTKLVDYLDELLRLVSDLSVFSFYPVQFADLFNHCLLCPAQLRFTIVFPSLCCHSLQACHDLCPEERPFLGRSSIRMAHHFCQKIADRICADLLTRVDEFGKLADQLAPQNAVVWLPDEKLTKRKGKKTSVSNRPVLAGALPEDSKNRAYSNFSTITGKIGPGAQSGGTPFLPGMESIRHTREDQTTSDRTLFSLSQLCQAVNHYRELIVYDQVVNPREVLQNEIQARLIEVLASFTEPTSVNEPLGEPMVPKPSELLRRVRALMDVLVDLEHHVCIDVIGIFSTVFAQHTQPRDGFKGQPTITAHYTKWYLDSLLKHAYMDHFVYSPLLKSFVTL--VPPEV--VRFRAEDFADLNELRALAELIGPLGIKYLCDQLMQDVGNRVDELKKLVLQNRSALESLRECFDDPLKTRQLSSGLQNSDALLTLLKEIGVAIGFRKLCSEALNDVLQRHTPFLLSSVHNLRHYLIQQSGGQLLPPTPGLTAAASPNSGGRDEMEMIYARFNSQLVLNNLSSSMGILSDLDYSLCAILNSRRQAMLAAASQASAAQVGGVHVAGVYPDLDYHIACLFIVFVANALPRLARQETSLYHLDLEANENNCHCIAYSVNALMVAMFSLLRPGDLEARSKEFLALASSNLLRLGLETSSSVISSDVCGTTPQSSTSGLSSANIQPAKHRDSIYILFDNLVRHSPCLSHSLQEACFPYSLIRSAYHNVAKMTESAVAAAVRPNLMSSSTHLDTRSRD 1286          
BLAST of Nck-associated protein 1 vs. TrEMBL
Match: C3ZLE6 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_123628 PE=4 SV=1)

HSP 1 Score: 512.301 bits (1318), Expect = 6.468e-157
Identity = 346/1192 (29.03%), Postives = 616/1192 (51.68%), Query Frame = 2
Query:  104 LKPNISKITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFA---TLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVPPLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRP-LLINNRTFQPNLYLKKELLKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYT---LHTPLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLN-IEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMEDQTNELLIAATSYLLPRIV--GSNFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDR--LDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQ 3622
            L P+  K+ EKL +L++R   +L +I ++K       +      S+   E  ++ +V+KFP++D KNN S ++ +  I  +I+ +L  +Y T VDV++ KD++ +L   + A     +I+ ++D+T+ YLDLI +Y ++M++L+ I   K++L LYN+A   T  K DQ+   + RL + +++  +    + ++  E  P+S+ +  A+ SL  +   +     +W + +  +L+S+  P  +LN + S  +P C+      +E+WIIFG+L  + +L ++ SA+QLWR  LS ++ I LFR E L IH  +    E  +GY K     KE +     N+  FHR RR +LR A++  + I+ D PG + P  + +   ++ A DE+ WL+RH+E    K        D+ D+ LPE ++ +EELR  L+++N VM++YY   L   D   L N + + +    +D+  I+  F   +  +++ Q  E  + D     F+ +RLDWFRLQ Y S   A+   +++ +  + MN+I  H+ +VD+L     + S +    F+     ++F+  L+T +Q RY++ FP IC HF+N     CP++ + I   S+  A+ +L  + +E   ++T +      L  +L P NA       + +K        N +K+      P  PG ES     T   + D   + L +L + +N  P + +   TF P  YL + L        V +  V    D  EIA   +PSE+L  ++  M ++  +  +V+++  ++F +  L+Q+  ++  G  T+T +Y NWY++ +L +  T   + +P    F+ +  +  +V+   +N EE++DI ELR+L E++GP+GMK L E +M  I   V+ L++ V +N+  L  L   + D   +     N + DVD   +    +G++  FK L ++ALNDV++K +PFL S+++D Q+ F   P + +  V                +NE+    GL   VD  L  A+             +  N D+ + +   LL+   +  LP +     + +  + E    + HC A A+  +    F  YG+ R  ++++++ F+AL SS+LL+LG ET         + + + +R+S+Y+  D I++    ++ D  E CFPYAL+R +YH V++Q
Sbjct:    7 LIPSQQKLAEKLTVLNDRAMGMLTRIYNIKKACGDVKS-KPAFLSDKNLEGAIKFIVRKFPHVDSKNNYSQLQQVNNIKGEIMKQLSLYYFTFVDVMDFKDHVSELLTTMDACNVHFDITTNYDLTKGYLDLIISYVSLMLLLARIDDRKAVLGLYNYAHDLTHGKVDQN---FARLGQMILDYEQ---PLKKLQEEFTPHSKLVACALLSLHQVYPRRNLPAEQWRQAQMLSLVSA--PGQMLNPAQSETMP-CEYLSVETMEKWIIFGFLLCHGQLTQSDSAVQLWRLALSGNYVITLFRDEVLYIHKTVEGVFEGIKGYGKRVTETKECANYAVVNAGPFHRERRAFLRTALKELVMILADQPGLLGPKALFVFMGLSFARDEVLWLLRHSENPAPKLNKRPNPVDYEDRQLPELLYYMEELRGLLRKYNQVMQRYYVQYLNGFDSIVLNNLVQN-LSVCPEDESIIMSSFVNTMNGLSVKQVEEGEIFD-----FRGMRLDWFRLQAYTSVSRAQLVLRENPDLARLMNTITFHTYMVDSLDEMAKETSDLSNFCFYGRLFEQYFQWCLETPSQMRYSISFPLICSHFMNCTHEICPEERHHIGDRSLSQANFFLDEMAKEAKNIITSICDEQCKLGDQLLPKNAAKTISIAIERK-------RNQNKAKKLPQEPDKPGRESMRRSRTDVTSMDKLYLMLTELCSAINYTPSIQVWEHTFAPREYLTQHLESRFTKALVGM--VMYNPDSGEIA---KPSELLNSVEAYMGVLQTIENYVHLDITRVFNNVLLQQTQPQDSHGDKTITALYTNWYLEVLLRRVSTGQIMFSPNRHAFVNVGVDPNQVA---VNAEEFSDISELRSLAELLGPYGMKFLNESLMWHISSQVAELKKLVTQNKDVLTTLRT-HFDKPALMAEHFNRLRDVDNVLKRVTIVGVILSFKTLAQDALNDVLKKRIPFLMSSIIDFQKHFPETPENNMVRVE--------------IVNEMASAAGLPCDVDPALCAALR----------VQKSENPDE-DYKIACLLMVFIAVSLPMLSLDSQSSFRADLEGHTNNIHCLAKAVNSIAAAMFTIYGKGRVTIEERLKEFLALASSSLLKLGQET---------DKLALRSRESVYLLLDQIVRESPFLTMDLLESCFPYALLRNSYHAVLRQ 1132          
BLAST of Nck-associated protein 1 vs. TrEMBL
Match: H2KT35 (Nck-associated protein 1 OS=Clonorchis sinensis OX=79923 GN=NCKAP1 PE=4 SV=1)

HSP 1 Score: 514.998 bits (1325), Expect = 1.893e-156
Identity = 382/1282 (29.80%), Postives = 623/1282 (48.60%), Query Frame = 2
Query:  122 KITEKLKILSERMTVVLIQIDSLKNLLQT-ENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLI---SSTKPDNLLNMSPSVLLPYCQIERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLE---LQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKT------DDFNDQLLPEFIHQIEELRFNLQQF-NVMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSS--------FKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFY--LSHLSKKAKDC------SDFSNHSKS-YSKIVVPP---------------------LPGIESKPSDITKSNTFDMQLIALNQLATGLN-SRPLLINNRTFQPNLYLKKELLKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKE-FMGFTTLTEIYCNWYVDFVLNQPYTLH---TPLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQL--------SSVSEHDSQ--IYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNI---------DQMEDQTNELLIAATSYLLPRIVG--SNFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSS---------------SQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQSRLVMTKAAHPTDASSKAAMEA 3688
            K+ E+L IL++R   VL ++  +K +L T E         + A+ES  + L+K+FP+I++K+ +S+++P      ++   L  +Y   VDVLEV+DN+ D  G+       L+I+++ D+TR YL+LI+NY AMM +++ I   K+IL L+NF       + EP + R+ E   E  +    +  +H ++NP+SRT++ A+NSL+     +      W  G   N++   S      L +     L+PY  +ERW+IFGYL +Y + L +  A   +++ L  ++ +VLFR E + IH  +  +LE     +   K  + +KE      + +   H  RRNYLR A+R    ++ D PG + P   ++   ++ + DE+HWL+RH    P KK S   T      ++++D  LPE +  +EELR  + ++ +V++++Y  +L   D P L  Y    +  LS+++  I+   +++L N+    S    L +A+  S        F  +RLDW RLQ  LSS +A       +  ++  +S + H+ LVD L   +   S +    F+    +E F   ++  AQ R+ +VFP +C H I  C   CP++   +  SSV  A  +   I   +C  L   V     L  +L P NAV        L +K K        ++ +N S S  SK    P                     LPG+ES   +  +  + D  L  L+QL   +N  R L++ ++   P   L+ E+   L     + +      D+     I +PSE+L  ++  M +++ +   V I+   +F   F + +  ++ F G  T+T  Y  WY+   L   Y  H   +PLLK F+TL     EV  V    E++ D+ ELRAL E+IGP G+K + ++++Q +   V  +++ V++NRSTL  L     D  K K+L  ++++ D      K++GI   F+ LC EALNDV+++  PFL STV +L+         QL        S+    D    IYA+  +QL +  L    G+ + +D +L   + S +       S                 ++     L I   +  LPR+    ++ YH++ EA E + HC AY++  LM   F       L+ + + F+AL SSNLLRLGLET SS               S +N   ++   +RDSIYI FD +++    +S    E CFPY+L+R AYHNV K +   +  A  P   SS A +E+
Sbjct:    9 KLAERLFILNDRQLGVLTRLHHMKQILNTSECRPAFMPGGDKAFESAWKFLLKRFPSIEIKSGQSSVQPFITHQKELAGILSSYYYNFVDVLEVRDNVSDTLGRFGCAHIQLDITINSDLTRLYLELISNYFAMMFLITRIADTKAILALFNFIYDQMNGKPEPNFPRMAELFTETPE--SMLKLLHADINPHSRTLMRALNSLSDFFVRRTVRAQNWSDGHFLNILHEPSKIGHTVLGDQLACELIPYEMMERWVIFGYLLIYKD-LSDEDAFSRFKTALRQTYVVVLFRDEVVYIHSLIQSFLESVWTSKVAVKRISEIKETLSIACSQTLEVHADRRNYLRSALRQLHLLLADEPGLLGPKAFLVFWGLSYSTDEVHWLLRHIAHPPPKKSSGGGTSRVNPVEEYSDPFLPELLFYMEELRMLVIRYTSVIQRFYLQLLACYDAPGLAEYAREAMPRLSNEEGVIVSSITKQLSNL----SEHEVLQNANQYSGDQFALFDFSAIRLDWLRLQASLSSKDASINLADHRRLVEHFHSTIFHTKLVDYLDELLRLVSDLSIFSFYPVPFSELFARCIQFPAQLRFTIVFPSLCCHTIQACHDLCPEERLFLGPSSVRRAQHFCQEIADRVCANLLARVDEFGLLADQLAPQNAVSLLPDQKQLKRKGKKSVGGAGRTNLNNGSTSDLSKTKADPKGLPTISGKAGPSASDHEPRFLPGVESFRRNREEQTSNDRTLFGLSQLCQAVNHHRELVVYDQVVNPREVLQNEVQDRLIQVLASYTEPTSVNDQLGEQLITKPSELLRRVRALMDVLVDMEHHVCIDVIGIFSVVFTQHTQPRDAFRGQPTMTAHYTKWYLGSFLKHAYMDHFVYSPLLKSFVTL--VAPEV--VRFRAEDFADLNELRALAELIGPLGIKYMCDQLIQDVGNRVDEIKKLVLQNRSTLETLRECFDDPLKTKQLGNSLQNSDALLTLLKEIGIALAFRRLCSEALNDVLQRRTPFLLSTVQNLRNYVTRQSGGQLIPQSPGPVSATGPRDEMETIYARLNSQLVLINLSSSMGVLSDLDYSLCALLNSRRQAMLLAASQAAAGGGGASPAVMYPDLDYHIACLFIVFVANALPRLARQENSLYHLDLEANENNCHCIAYSVNALMVAMFSLLRPGDLEARSKEFLALVSSNLLRLGLETSSSVLAGDVCGNSLPTSTSSSNNPAVLPAKHRDSIYILFDNLVRQSPCLSHSLQEACFPYSLIRSAYHNVAKLTESAVAVAVRPNVMSSSAHLES 1279          
BLAST of Nck-associated protein 1 vs. TrEMBL
Match: A0A4S2LBK8 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008773 PE=4 SV=1)

HSP 1 Score: 513.842 bits (1322), Expect = 4.274e-156
Identity = 378/1281 (29.51%), Postives = 620/1281 (48.40%), Query Frame = 2
Query:  122 KITEKLKILSERMTVVLIQIDSLKNLLQT-ENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLI---SSTKPDNLLNMSPSVLLPYCQIERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLE---LQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKT------DDFNDQLLPEFIHQIEELRFNLQQF-NVMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSS--------FKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFY--LSHLSKKAKDC------SDFSNHSKSYSKIVVPP---------------------LPGIESKPSDITKSNTFDMQLIALNQLATGLN-SRPLLINNRTFQPNLYLKKELLKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKE-FMGFTTLTEIYCNWYVDFVLNQPYTLH---TPLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQL--------SSVSEHDSQ--IYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNI---------DQMEDQTNELLIAATSYLLPRIVG--SNFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSS---------------SQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQSRLVMTKAAHPTDASSKAAMEA 3688
            K+ E+L IL++R   VL ++  +K +L T E         +  +ES  + L+K+FP+I++K+ +S+++P      ++   L  +Y   VDVLEV+DN+ D  G+       L+I+++ D+TR YL+LI+NY AMM +++ I   K+IL L+NF       + EP + R+ E   E  +    +  +H ++NP+SRT++ A+NSL+     +      W  G   N++   S      L +     L+PY  +ERW+IFGYL +Y + L +  A   +++ L  ++ +VLFR E + IH  +  +LE     +   K  N +KE      + +   H  RRNYLR A+R    ++ D PG + P   ++   ++ + DE+HWL+RH    P KK S          ++++D  LPE +  +EELR  + ++ +V++++Y  +L   D P L  Y    +  LS+++  I+   +++L N+    S    L +A+  S        F  +RLDW RLQ  LSS +A       +  ++  +S + H+ LVD L   +   S +    F+    +E F   ++  AQ R+ +VFP +C H I  C   CP++   +  SSV  A  +   I   +C  L   V     L  +L P NAV        L +K K        ++ +  +   SK    P                     LPG+ES   +  +  + D  L  L+QL   +N  R L++ ++   P   L+ E+   L     + +      D+     I +PSE+L  ++  M +++ +   V I+   +F   F + +  ++ F G  T+T  Y  WY+   L   Y  H   +PLLK F+TL     EV  V    E++ D+ ELRAL E+IGP G+K + ++++Q +   V  +++ V++NRSTL  L     D  K K+L  ++++ D      K++GI   F+ LC EALNDV+++  PFL STV +L+         QL        S+ +  D    IYA+  +QL +  L    G+ + +D +L   + S +       S                 ++     L I   +  LPR+    ++ YH++ EA E + HC AY++  LM   F       L+ + + F+AL SSNLLRLGLET SS               S +N   ++   +RDSIYI FD +++    +S    E CFPY+L+R AYHNV K +   +  A  P   SS A +E+
Sbjct:    9 KLAERLFILNDRQLGVLTRLHHMKQILNTSECRPAFMPGGDKTFESAWKFLLKRFPSIEIKSGQSSVQPFITHQKELAGILSSYYYNFVDVLEVRDNVSDTLGRFGCAHIQLDITINSDLTRLYLELISNYFAMMFLITRIADTKAILALFNFIYDQMNGKPEPNFPRMAELFTETPE--SMLKLLHADVNPHSRTLMRALNSLSDFFVRRTVRAQNWSDGHFLNILHEPSKIGHTVLGDQLACELIPYEMMERWVIFGYLLIYKD-LSDEDAFSRFKTALRQTYVVVLFRDEVIYIHSLIQSFLESVWTSKVAVKRINEIKETLSIACSQTLEVHADRRNYLRSALRQLHLLLADEPGLLGPKAFLVFWGLSYSTDEVHWLLRHIAHAPPKKSSGGGASRVNPVEEYSDPFLPELLFYMEELRMLVIRYTSVIQRFYLQLLACYDAPGLVEYAREAMPRLSNEEGVIVSSITKQLSNL----SEHEVLQNANQYSGDQFALFDFSAIRLDWLRLQASLSSKDASINLADHRRLVEHFHSTIFHTKLVDYLDELLRLVSDLSIFSFYPVPFSELFARCIQFPAQLRFTIVFPSLCCHTIQACHDLCPEERLFLGPSSVRRAQHFCQEIADRVCANLLARVDEFGLLADQLAPQNAVSLLPDQKQLKRKGKKSVGGAGRTNLNGSTSELSKTKTDPKGLPTISGKAGPSASDHEPRFLPGVESFRRNREEQTSNDRTLFGLSQLCQAVNHHRELVVYDQVVNPREVLQNEVQDRLIQVLASYTEPTSVNDQLGEQLITKPSELLRRVRALMDVLVDMEHHVCIDVIGIFSVVFTQHTQPRDAFRGQPTMTAHYTKWYLGSFLKHAYMDHFVYSPLLKSFVTL--VSPEV--VRFRAEDFADLNELRALAELIGPLGIKYMCDQLIQDVGNRVDEIKKLVLQNRSTLETLRECFDDPLKTKQLGNSLQNSDALLTLLKEIGIALAFRRLCSEALNDVLQRRTPFLLSTVQNLRNYVTRQSGGQLIPQSPGPVSATAPRDEMETIYARLNSQLVLINLSSSMGVLSDLDYSLCALLNSRRQAMLLAASQAAAGGGGASPAVMYPDLDYHIACLFIVFVANALPRLARQENSLYHLDLEANENNCHCIAYSVNALMVAMFSLLRPGDLEARSKEFLALVSSNLLRLGLETSSSVLAGDVCGNSLPTSTSSSNNPAVLPAKHRDSIYILFDNLVRQSPCLSHSLQEACFPYSLIRSAYHNVAKLTESAVAAAVRPNVMSSSAHLES 1278          
BLAST of Nck-associated protein 1 vs. Ensembl Cavefish
Match: nckap1 (NCK-associated protein 1 [Source:NCBI gene;Acc:561894])

HSP 1 Score: 455.292 bits (1170), Expect = 2.498e-139
Identity = 333/1193 (27.91%), Postives = 580/1193 (48.62%), Query Frame = 2
Query:  104 LKPNISKITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVP----PLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRP-LLINNRTFQPNLYLKKEL-LKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHT---PLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMED-QTNELLIAATSYLLPRIVGS--NFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQS 3625
            L+P+  K+ EKL IL++R   +L +I ++K          S +   +  ES ++ +V+KFP ++ +NN   +  L    S+IL  L  +Y T VDV+E KD++ +L   I A Q   +I+++FD+T+ YLDL+  Y+ +M++LS I + K+I+ LYN+A        +  Y RL + +V+       + ++  E  P+ +++ +A+ SL  +   +  S  +W   +  +LIS+  P  +LN + S  +P C+      +E+WI+FG++  +  L  +P+AL LW+  L  S  + LFR E   IH          RGY K  N ++E  +   +++   HR RR +LR A++    ++ D PG + P  + +   ++ A DE+ WL+RH + I  K      TDDF D+ + E I  +EELR +++++  VM++YY   L   D   L   + + +    +D+  I+  F   + ++++ Q                   DWFR   Y S   A       +E  + MN+I+ H+ +VD+L   + + S +    F+     + F+  L+  +Q RY++ FP +C HF++     CP++ + I   S+ + + +L  + ++   L+TD+      L+ +L P +            AK  S   N                 PG+ES   +       D    AL++L   +N  P +++   TF P  YL   L ++F      T S V +         I +PSE+L  ++  M+++  +  +V I+  ++F +  L+Q+   +  G  T+T +Y NWY++ +L Q    H    P +K F+ LP   +    +  N EEY+DI E+R+L E++GP+GMK L E +M  I   V+ L++ V+ N   L ++         +  L   +  VD   +    +G++  F+ L +EAL DV+   +PFL S+V D +   D  P        E D ++       + + EL    GL  ++D  L  A+           S +  NI   E+ +   LL+   +  LP +  +  + Y    E    + HC A AI ++    F  + +  ++D+++ F+AL SS+LL++G ET  ++           NR+S+Y+  D I+Q    ++ D  E CFPY L+R AYH V KQS
Sbjct:    6 LQPSQQKLAEKLTILNDRGLGMLTRIYNIKKACGDPKAKPSYLIDKN-LESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDACQVFFDITVNFDLTKNYLDLVVTYTTLMMLLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQMIVDYE---NPLKKMMEEFVPHGKSLSDALVSLQMVYPRRNLSADQWRNAQLLSLISA--PSTMLNPAQSDTMP-CEYLSLDTMEKWIVFGFILCHAALNSDPAALSLWKLALQSSSCLCLFRDEVFHIHKAAEDLFVNIRGYNKRVNDIRECKESALSHAGSMHRERRKFLRSALKELATVLADQPGLLGPKALFVFMALSFARDEIIWLLRHADNIQKK-----STDDFIDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLSGFDAVVLNELVQN-LSVCPEDESIIMSSFVNTMTSLSVKQ-------------------DWFR-SAYTSVSKASLGISDHRELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELPSQSRYSICFPLLCTHFMSCTHELCPEERHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTLSDQLLPKHC-----------AKTISQAVNKKSKKQTGKKGEPEREKPGVESMRKNRLLVTNLDKLHTALSELCFSINYVPNMVVWEHTFTPREYLTSHLEIRF------TKSIVGMTMYNQATQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHGEPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENE----LTFNAEEYSDISEMRSLSELLGPYGMKFLSESLMWHISSQVAELKKLVVENVEVLTQMRTSFDKPDHMAALFKRLTSVDSVLKRMTIIGVILSFRSLAQEALRDVLSCHIPFLVSSVEDFK---DHIP-------RETDMKV------AMNVYELSSAAGLPCEIDPALVVALS----------SQKSENISPEEEYKIACLLMVFVAVSLPTLASNVMSQYSPAIEGHCNNIHCLAKAINQIAAALFTIH-KGSIEDRLKEFLALASSSLLKIGQETDKTT---------TRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQS 1108          
BLAST of Nck-associated protein 1 vs. Ensembl Cavefish
Match: zgc:172352 (NCK associated protein 1 like [Source:NCBI gene;Acc:103027489])

HSP 1 Score: 424.861 bits (1091), Expect = 4.264e-128
Identity = 313/1187 (26.37%), Postives = 570/1187 (48.02%), Query Frame = 2
Query:  122 KITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVL-------LPYCQIERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVPP-LPGIESKPSDITKSNTFDMQLIALNQLATGLNSRPLLINNRTFQ----PNLYLKKELLKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYT---LHTPLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLD----YSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMEDQTNELLIAATSYLLP--RIVGSNFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDR-LDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNV 3613
            K+ EKL +L++R   VLI+++ +K    ++        ++ A E  ++ + +KFPNID +     +  +    + +L  L  +Y++ VDV+E +D++ +L   I A Q    I+++FD T+ YLDLI  Y++++++LS I   K ++ +YN A        +P Y RL + ++E       +TE   E  P+++++  A+ SL  +   +  +  +W + +  +L+S+  P  LL  SP+         LP   +ERWII G+L  +  L  N ++ +LW+  L     + L R E + +H     + +  +GY+K    +KE  +    N   FHR +R++LR A++  ++++ D P  + P  + +   ++ + DE+ WL+RH+E IP  K      +D++D  + E ++ +E LR  L  +  V+++Y+   L   D   L + I S I    +++  ++  F  +L  +N+ Q     L   +    K +RLDW RLQ Y S   A    ++  +  + MN    H+ ++D++   + + + +  L F+     + F  + + T+  RY + FP +C HF  +    CP++  L+ + ++ +   +L  I Q+ C ++ ++     +L+ +L P         H ++      +         K  VP   PG ES   D       D   + L +L T   S  +  +   F+    P  +L  +L + L+  FV +++            I RPSE+L  I+  ++ +  +S ++ ++ A+L     L+Q+   +  G  T+T +Y NWY++ +L Q  +    H P + CF+    N    +      +E++DI ELRAL E+IGP+G+K L E +M  I   V+ L++ V  N   L++L   N D     S ++K L   E+V    +    +G++  F+ L ++AL +V++K  PFL              PI  L +    D+ I    +  + + EL    G+K  +D  L +AI +++               + E +   LL+   +  +P   I  S FY  E+   + + HC + AI  L    F    +D+ +   ++ F+ + SS LL+LG         N D+ + I NRDS+Y+  D I++    +S D  E+CFPY L+R AY  V
Sbjct:    6 KLAEKLLVLNDRGQGVLIRMNHIKKTC-SDPKRRPSFLTDKATEPAVKYINRKFPNIDFRGGSQQLSSIQKQKTAVLEGLSSYYDSFVDVMEFRDHVYELLNTIDACQCFFNIAVNFDFTKNYLDLIITYTSVILMLSRIDDRKVLVGMYNCAHELSNGSSDPSYPRLGQMIMEYEHPLKKLTE---EFGPHTKSVTEALLSLQMVYPRRNFTADQWRRAQLLSLLST--PATLL--SPAACDTMACEYLPMEMMERWIILGFLLCHNSLNSNAASQELWKMALRSGLYVTLTRDEVINVHKLSEDHFDGIKGYSKRIADIKECKENAIANCGAFHREKRHFLRGALKELIKVLEDQPALLGPKALYVFMALSFSRDEILWLVRHSENIPKTK----TPEDYSDSNMAELLYYMERLRALLSTYRYVIQRYHLQYLSQFDALLLNDTIQS-IYVCPEEESVLMTSFVSQLSALNLKQ-----LDGGEDFDLKAIRLDWLRLQAYSSVGKATLALKEYPDLAKIMNMTQFHTRMMDDVDELLIETADISILCFYPRVFEKMFSQSSEDTSMQRYLMAFPMVCAHFNQSTHTMCPEEMELMEKQTLRLCVKFLEEIAQQTCGVVLEICAEQCNLHEQLLPK--------HCAETISTARNKKLKKPMPKKGEVPKEKPGTESHRKDRAVVTNMDKMHLTLTELCT---SYSMCSDFTAFKHILVPAEFLLSQLEQRLSKIFVRMANY-----NQSTQDIARPSELLSGIQAYVTGLNTLSRYITVDVARLVKTVLLQQTQPLDSHGAQTITTLYTNWYLEGLLRQASSGAIAHCPTMHCFV----NHTSENEQNFKAQEFSDICELRALAELIGPYGLKFLGENLMWHITSQVAELKKLVFENMDVLVQLKA-NFDKPETLSNLQKRLTGCENV---LKRMTIIGVILSFRKLAQDALEEVMQKHCPFL------------MGPIKYLHNFIHADTDI----KVTMGVYELASATGMKCDIDPALVSAITNMRSDNSST---------EEEYKITCLLLVYIAVSMPTLSIDPSTFYSREHGGHQNNVHCLSTAINHLSAAMF--TAQDKNIQQHLKEFLQVASSALLQLG--------QNVDK-VEIKNRDSVYLLLDMIVEESPFLSQDMLEDCFPYVLLRNAYREV 1114          
BLAST of Nck-associated protein 1 vs. Ensembl Cavefish
Match: zgc:172352 (NCK associated protein 1 like [Source:NCBI gene;Acc:103027489])

HSP 1 Score: 397.127 bits (1019), Expect = 2.297e-118
Identity = 301/1159 (25.97%), Postives = 551/1159 (47.54%), Query Frame = 2
Query:  122 KITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVL-------LPYCQIERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVPP-LPGIESKPSDITKSNTFDMQLIALNQLATGLNSRPLLINNRTFQ----PNLYLKKELLKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYT---LHTPLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLD----YSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMEDQTNELLIAATSYLLP--RIVGSNFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDR-LDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFI 3529
            K+ EKL +L++R   VLI+++ +K          S   ++ A E  ++ + +KFPNID +     +  +    + +L  L  +Y++ VDV+E +D++ +L   I A Q    I+++FD T+ YLDLI  Y++++++LS I   K ++ +YN A        +P Y RL + ++E       +TE   E  P+++++  A+ SL  +   +  +  +W + +  +L+S+  P  LL  SP+         LP   +ERWII G+L  +  L  N ++ +LW+  L     + L R E + +H     + +  +GY+K    +KE  +    N   FHR +R++LR A++  ++++ D P  + P  + +   ++ + DE+ WL+RH+E IP  K      +D++D  + E ++ +E LR  L  +  V+++Y+   L   D   L + I S      ++ + +  F S+ L  +N+ Q     L   +    K +RLDW RLQ Y S   A    ++  +  + MN    H+ ++D++   + + + +  L F+     + F  + + T+  RY + FP +C HF  +    CP++  L+ + ++ +   +L  I Q+ C ++ ++     +L+ +L P         H ++      +         K  VP   PG ES   D       D   + L +L T   S  +  +   F+    P  +L  +L + L+  FV +++            I RPSE+L  I+  ++ +  +S ++ ++ A+L     L+Q+   +  G  T+T +Y NWY++ +L Q  +    H P + CF+    N    +      +E++DI ELRAL E+IGP+G+K L E +M  I   V+ L++ V  N   L++L   N D     S ++K L   E+V    +    +G++  F+ L ++AL +V++K  PFL              PI  L +    D+ I    +  + + EL    G+K  +D  L +AI +++               + E +   LL+   +  +P   I  S FY  E+   + + HC + AI  L    F    +D+ +   ++ F+ + SS LL+LG         N D+ + I NRDS+Y+  D +
Sbjct:    6 KLAEKLLVLNDRGQGVLIRMNHIKKTCSDPKRRPS-FLTDKATEPAVKYINRKFPNIDFRGGSQQLSSIQKQKTAVLEGLSSYYDSFVDVMEFRDHVYELLNTIDACQCFFNIAVNFDFTKNYLDLIITYTSVILMLSRIDDRKVLVGMYNCAHELSNGSSDPSYPRLGQMIMEYEHPLKKLTE---EFGPHTKSVTEALLSLQMVYPRRNFTADQWRRAQLLSLLST--PATLL--SPAACDTMACEYLPMEMMERWIILGFLLCHNSLNSNAASQELWKMALRSGLYVTLTRDEVINVHKLSEDHFDGIKGYSKRIADIKECKENAIANCGAFHREKRHFLRGALKELIKVLEDQPALLGPKALYVFMALSFSRDEILWLVRHSENIPKTK----TPEDYSDSNMAELLYYMERLRALLSTYRYVIQRYHLQYLSQFDALLLNDTIQSIYVCPEEESVLMTSFVSQ-LSALNLKQ-----LDGGEDFDLKAIRLDWLRLQAYSSVGKATLALKEYPDLAKIMNMTQFHTRMMDDVDELLIETADISILCFYPRVFEKMFSQSSEDTSMQRYLMAFPMVCAHFNQSTHTMCPEEMELMEKQTLRLCVKFLEEIAQQTCGVVLEICAEQCNLHEQLLPK--------HCAETISTARNKKLKKPMPKKGEVPKEKPGTESHRKDRAVVTNMDKMHLTLTELCT---SYSMCSDFTAFKHILVPAEFLLSQLEQRLSKIFVRMANY-----NQSTQDIARPSELLSGIQAYVTGLNTLSRYITVDVARLVKTVLLQQTQPLDSHGAQTITTLYTNWYLEGLLRQASSGAIAHCPTMHCFV----NHTSENEQNFKAQEFSDICELRALAELIGPYGLKFLGENLMWHITSQVAELKKLVFENMDVLVQLKA-NFDKPETLSNLQKRLTGCENV---LKRMTIIGVILSFRKLAQDALEEVMQKHCPFL------------MGPIKYLHNFIHADTDI----KVTMGVYELASATGMKCDIDPALVSAITNMRSDNSST---------EEEYKITCLLLVYIAVSMPTLSIDPSTFYSREHGGHQNNVHCLSTAINHLSAAMF--TAQDKNIQQHLKEFLQVASSALLQLG--------QNVDK-VEIKNRDSVYLLLDMV 1086          
BLAST of Nck-associated protein 1 vs. Ensembl Cavefish
Match: zgc:172352 (NCK associated protein 1 like [Source:NCBI gene;Acc:103027489])

HSP 1 Score: 365.155 bits (936), Expect = 4.985e-107
Identity = 290/1187 (24.43%), Postives = 534/1187 (44.99%), Query Frame = 2
Query:  122 KITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVL-------LPYCQIERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVPP-LPGIESKPSDITKSNTFDMQLIALNQLATGLNSRPLLINNRTFQ----PNLYLKKELLKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYT---LHTPLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLD----YSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMEDQTNELLIAATSYLLP--RIVGSNFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDR-LDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNV 3613
            K+ EKL +L++R   VLI+++ +K          S   ++ A E  ++ + +KFPNID +     +  +    + +L  L  +Y++ VDV+E +D++ +L   I A Q    I+++FD T+ YLDLI  Y++++++LS I   K ++ +YN A        +P Y RL + ++E       +TE   E  P+++++  A+ SL  +   +  +  +W + +  +L+S+  P  LL  SP+         LP   +ERWII G+L  +  L  N ++ +LW+  L     + L R E + +H     + +  +GY+K    +KE  +    N   FHR +R++LR A++  ++++ D P  + P  + +   ++ + DE+ WL+RH+E IP  K      +D++D  + E ++ +E LR  L  +  V+++Y+   L   D   L + I S I    +++  ++  F  +L  +N+ Q     L   +    K +RLDW RLQ Y S   A    ++  +  + MN    H+ ++D++   + + + +  L F+     + F  + + T+  RY + FP +C HF  +    CP++  L+ + ++ +   +L  I Q+ C ++ ++     +L+ +L P         H ++      +         K  VP   PG ES   D       D   + L +L T   S  +  +   F+    P  +L  +L + L+  FV +++            I RPSE+L  I+  ++ +  +S ++ ++ A+L     L+Q+   +  G  T+T +Y NWY++ +L Q  +    H P + CF+    N    +      +E++DI ELRAL E+IGP+G+K L E +M  I   V+ L++ V  N   L++L   N D     S ++K L   E+V    +    +G++  F+ L ++AL +V                                            + + EL    G+K  +D  L +AI +++               + E +   LL+   +  +P   I  S FY  E+   + + HC + AI  L    F    +D+ +   ++ F+                                        I++    +S D  E+CFPY L+R AY  V
Sbjct:   11 KLAEKLLVLNDRGQGVLIRMNHIKKTCSDPKRRPS-FLTDKATEPAVKYINRKFPNIDFRGGSQQLSSIQKQKTAVLEGLSSYYDSFVDVMEFRDHVYELLNTIDACQCFFNIAVNFDFTKNYLDLIITYTSVILMLSRIDDRKVLVGMYNCAHELSNGSSDPSYPRLGQMIMEYEHPLKKLTE---EFGPHTKSVTEALLSLQMVYPRRNFTADQWRRAQLLSLLST--PATLL--SPAACDTMACEYLPMEMMERWIILGFLLCHNSLNSNAASQELWKMALRSGLYVTLTRDEVINVHKLSEDHFDGIKGYSKRIADIKECKENAIANCGAFHREKRHFLRGALKELIKVLEDQPALLGPKALYVFMALSFSRDEILWLVRHSENIPKTK----TPEDYSDSNMAELLYYMERLRALLSTYRYVIQRYHLQYLSQFDALLLNDTIQS-IYVCPEEESVLMTSFVSQLSALNLKQ-----LDGGEDFDLKAIRLDWLRLQAYSSVGKATLALKEYPDLAKIMNMTQFHTRMMDDVDELLIETADISILCFYPRVFEKMFSQSSEDTSMQRYLMAFPMVCAHFNQSTHTMCPEEMELMEKQTLRLCVKFLEEIAQQTCGVVLEICAEQCNLHEQLLPK--------HCAETISTARNKKLKKPMPKKGEVPKEKPGTESHRKDRAVVTNMDKMHLTLTELCT---SYSMCSDFTAFKHILVPAEFLLSQLEQRLSKIFVRMANY-----NQSTQDIARPSELLSGIQAYVTGLNTLSRYITVDVARLVKTVLLQQTQPLDSHGAQTITTLYTNWYLEGLLRQASSGAIAHCPTMHCFV----NHTSENEQNFKAQEFSDICELRALAELIGPYGLKFLGENLMWHITSQVAELKKLVFENMDVLVQLKA-NFDKPETLSNLQKRLTGCENV---LKRMTIIGVILSFRKLAQDALEEVT-------------------------------------------MGVYELASATGMKCDIDPALVSAITNMRSDNSST---------EEEYKITCLLLVYIAVSMPTLSIDPSTFYSREHGGHQNNVHCLSTAINHLSAAMF--TAQDKNIQQHLKEFLQ---------------------------------------IVEESPFLSQDMLEDCFPYVLLRNAYREV 1062          
BLAST of Nck-associated protein 1 vs. Ensembl Sea Lamprey
Match: nckap1 (NCK-associated protein 1 [Source:NCBI gene;Acc:561894])

HSP 1 Score: 487.263 bits (1253), Expect = 1.011e-151
Identity = 348/1192 (29.19%), Postives = 601/1192 (50.42%), Query Frame = 2
Query:  101 GLKPNISKITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFA---TLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVPPLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRP-LLINNRTFQPNLYLKKELLKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQ---PYTLHTPLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMED-QTNELLIAATSYLLPRIVGSNF--YHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQS 3625
            G+ P+  K+ EKL IL++R   +L +I ++K     +     Q  ++   ES ++ +V+KFP++D +NN   +  L    + I+  L  +Y T VD+++ KD++ +L   I A Q   +I+++FD+T++YLDLI  Y+ +M++LS I + K+I+ LYN+A   T    D+D P   RL + +++       + E   E  P+S+++  A+ SL ++   +  S  +W   +  +LIS+  P  +LN + S  +P C+      +E+WIIFG+L  +  L     A+ LWR  L+  F + LFR E    H  + +     +GY K    ++E+      ++   HR RR +LR A+R  + ++ D PG + P  + +  +++ A DE+ WL+RH E IP  K      DD+ D+ L E +  +EELR  ++++  VM++YY   L S D   L   + + +    +D+  I+  F   + ++++ Q  E  + D     F+ +RLDWFRLQ Y S   A    +   +  + MN+IV H+ +VD+L   + + S +    FH     + F+  L+  +Q R++V FP IC HF++     CP++ + I   S+ + + +L  + ++   L+TD+      L+ +L P +        +SKK+K  +     ++          PG+ES   D   S   D    AL +L   +N  P +++ + TF P  YL   L        V ++     +   EIA   +PSE+L  +K  MS++  +  FV I+  ++F +  L+Q+   +  G TT+T +Y NWY++ +L Q    +  ++P +K FI LP   +    +  N EEY+DI E+RAL E++GP+GMK L E +M  I   V+ L++ VM N   L+ +         +  L   ++ VD   +    +G++  F+ L +EAL DV+   +PFL S++ D +   D  P        E D ++       + + EL    GL  ++D  L  A+           S +G N+   E+ +   LL+   +  +P +  +    Y    E    + HC A A+ ++    F  + +  ++D+++ F+AL SS+LL++G ET   S           NR+S+Y+  D I+Q    ++ D  E CFPY L+R AYH V KQ 
Sbjct:    4 GIMPSQQKLAEKLTILNDRGVGMLTRIYNIKKAC-GDAKAKPQCLADKNLESAVKFIVRKFPHVDTRNNSQQLTHLNTQKADIMKNLSLYYCTFVDIMDFKDHVTELLNTIDACQIYFDITVNFDITKSYLDLIVMYATIMLMLSRIEERKAIIGLYNYAHEMTNGSSDKDFP---RLGQLILDYENPMKKMME---EFGPHSKSVTEALFSLQTVYPRRNLSAEQWRAAQMLSLISA--PSAMLNPAQSETMP-CEYLSLDVMEKWIIFGFLLCHANLNTEQMAVTLWRLALNSGFCLTLFRDEVFHFHKTIEELFLNIKGYNKRATEIRELKDHALTHAGPMHRERRKFLRAALRELVMVLTDQPGLLGPKALFVFMSLSFARDEIFWLLRHAENIPKAK----NYDDYVDKHLAELMFYMEELRALVRKYGPVMQRYYVQYLFSFDAVALNELVQN-LSVCPEDESIIMSSFVNTMTSLSVKQVEEGEMFD-----FRGMRLDWFRLQAYTSVSRASLHLKDHCDLGRMMNTIVFHTRMVDSLDEMMVETSDLSTFCFHSRPFEKMFQQCLELPSQSRHSVAFPLICSHFMSCTHELCPEERHHIGDRSLSLCNFFLDEMAKQARNLITDICSEQCALSDQLLPKHCAKTISQAVSKKSKKQAQKKGETEKEK-------PGVESMRKDRLISTNLDKLHTALVELCFAINYAPSIVVWDHTFTPREYLALHLEYRFTKAIVGMT--MYNQATQEIA---KPSELLTSVKAYMSVLQSIENFVQIDITRVFNNVLLQQTQHMDSHGDTTITTLYTNWYLETLLRQVSNGFIAYSPAMKAFINLPTENE----LTFNAEEYSDITEMRALAELLGPYGMKFLNESLMWHISSQVAELKKLVMENMEVLMHMRTSFDKPEHMAALFKKLQSVDSVLKRMTIIGVILSFRSLAQEALRDVLSHHIPFLLSSIKDFK---DHIP-------RETDIKV------AMGVYELSSAAGLPCEIDPALVLAL----------TSQKGENLSPEEEYKIACLLMVFVAVAIPTLASNPLSQYSPLLEGHVNNIHCLAKAVNQIAAALFTIH-KGSIEDRLKEFLALASSSLLKIGQETDKVS---------TRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQG 1123          
BLAST of Nck-associated protein 1 vs. Ensembl Sea Lamprey
Match: nckap1 (NCK-associated protein 1 [Source:NCBI gene;Acc:561894])

HSP 1 Score: 425.246 bits (1092), Expect = 2.350e-129
Identity = 313/1146 (27.31%), Postives = 561/1146 (48.95%), Query Frame = 2
Query:  251 ESILRSLVKKFPN----IDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQF-NVMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVPPLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRPLL-INNRTFQPNLYLKKELLKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQP---YTLHTPLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMEDQTNE----LLIAATSYLLPRIVG--SNFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQS 3625
            E   + L++ FP+    I+V+     + P+    S IL  L  +Y T VD+++ +D++ +    I A Q   +I+++FD+T+ YLDL+ NY  +MI+LS I   K+I+ LYN+A        +  + RL + +V+       + ++  E  P+++ + +A+ SL ++   +     +W   +  +LIS+  P  ++N + S  +P C+      +E+WI+FG+L  +  L  + +A  LW+  LS  F + LFR E    H    +     +GY K    ++E  ++  + +   HR RR +LR +++    ++ D PG + P  + +   ++ + DE+ WL+RH E +P  K      +D+ D+   E +  +EELR  ++++  V+++Y+   L   D   L   + + +    +D+  I+  F   + ++N+ Q    A+   +   F+ LRLDWFRLQ Y S   A    +  ++  + MN+I  H+ +VD+L++ + + S +    F+       F+  L+  +Q R+++ FP  C HF++     CP++ + I   S+ + + +L  + ++   L+TD+      L+ +L P ++       ++KKAK  +   N  +          PG+ES   D     + D    AL +L   +N  P   I   TF P  YL   L     +   T S V +         I +PSE+L  +K  MS++  + +FV+I+  ++F +  L+Q+   +  G  T+T +Y NWY++ +L Q        +P +K FI LP    E  ++  N EEYTDI E+RAL +++GP+G+K L E +M  I   V+ L++ VM N   L ++        ++  L   +  VD   +    +G++  F+ L +EALNDV+   +PFL  ++ D +   D  P        E D ++       + + EL    GL  +VD  L  A+                 +D+   + +     LL+   +  LP + G  ++ Y    E    + HC A AI +L    F  + +  ++++++ F+AL SS+LL++G ET         + +   NR+S+Y+  D I+Q    ++ D  E CFPY L+R AYH V KQ 
Sbjct:    2 EEQCKYLLEIFPDLWFHIEVEQQ---LAPVQNQKSDILKNLALYYFTFVDIMDFRDHVTEQLNTIDASQIYFDITVNFDLTKNYLDLVVNYVTIMIVLSRIEDRKAIMGLYNYAHEMTHGSSDREFPRLGQMVVDYE---NPLKKLMEEFQPHTKLVTDALLSLCTVYPRRNLPADQWRAVQLLSLISA--PATMINPAQSDTMP-CEYLSLDSMEKWIVFGFLLCHSTLNTDQNAQMLWKLALSSGFCLRLFRDEIFHFHKVTEELFTNMKGYNKRVADIRECKEQALSQAGLMHRERRKFLRASLKELCTVLADQPGLLGPKALFVFMALSFSRDEILWLLRHAENLPKTK----NIEDYVDKHQAELMFYMEELRALVRKYAQVIQRYHLQYLAGFDAVVLNELVQN-LSVCPEDESVIMSSFVSTMTSLNVRQ----AVDQGEPFDFRGLRLDWFRLQAYTSVNKASLQLKDHKDLGKLMNTIAFHTKMVDSLNDLMVETSDLSNFCFYNRPFERMFQQCLEIPSQSRFSIAFPLACSHFMSCAHELCPEERHHIGDRSLSICNVFLEEMAKQAKNLITDICAEQCALSNQLLPKHSAKTISQAVTKKAKKQAAKKNEPEKEK-------PGVESMRKDRLIITSMDKLHTALAELCVAINYVPTFQIWEHTFTPKEYLTSHL-----EARFTKSIVGMTMYNQTTQDINKPSELLNSVKAYMSVLQGLEDFVHIDITRVFNNVLLQQTQPMDSHGEPTITSLYSNWYLEALLRQASNGLIAFSPSMKSFINLP---SENHDLPFNAEEYTDITEMRALADLMGPYGIKFLNENLMWHISSQVTELKKLVMENMEVLSQMRTSFDKPEQMALLFRRLTSVDSLLKRMTIIGMILSFRALAQEALNDVLSNHIPFLLGSIKDFK---DHIP-------RETDIKV------AMSVYELSSAAGLVCEVDPALVMALS------------SQKGVDKTSPEDDYKIACLLMVFVAVSLPALAGVQTSQYSPWLEGHLNNIHCLATAINQLAAALFTIH-KGSVEERLKEFLALASSSLLKIGQET---------DKLTTRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQG 1076          
BLAST of Nck-associated protein 1 vs. Ensembl Nematostella
Match: NAPA (Nck-associated protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:A7RU46])

HSP 1 Score: 450.284 bits (1157), Expect = 6.493e-138
Identity = 331/1192 (27.77%), Postives = 596/1192 (50.00%), Query Frame = 2
Query:  101 GLKPNISKITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLL----NMSPSV-LLPYCQIERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLS-KKAKDCSDFSNHSKSYSKIVVPPLPGIESKPSDITKSNTFDMQLIALNQLATGL-NSRPLLINNRTFQPNLYLKKELLKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYT---LHTPLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDY-SKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMEDQ--TNELLIAATSYLLPRIV--GSNFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQSR 3628
            GL     K+ EKL IL+ER   +L +I ++K    ++         + A E  ++ +V+KFP +D K   + ++ + +I ++++  L  +Y T VD++E KDN  +L   I A     +I+L+FD+T+ YLDLI   +A+MI++S +   +S+L L+N A   +  + E  + RL + +++       + ++  +  P+ + +  A+ SL  +   K  +  +W +G+  ++I++  P N+L    +  P+V  L    I+RWI+FGY   + +L   P    +W+  L   F I LFR E    H      L+  +GY K    +++ + +    S G H+ RRNYLR A+     I+ D PG + P ++II   ++ A DE+ WL+RH    P+ +   +  +DF D  LP  +  +EELR  +Q+++ V+++Y+   L   D   LK  +   I   S+D   I+  F ++L ++++ Q     +   +   F  LRLDW RLQ Y S   +    + +++ ++ MN++V HS LVD     + + S +    F+     E F   L+   Q RY + FP ICGHF+      CP++ + I   S+   + +L  + +E   +++ +   H   + +L   +AV       S ++ KD       +K    +   P PGIES         + D +L++L +L   + ++  + +    F P  YL  +L +F     V+++   I  D   IA   RPSE+L  +K  MS +  +  +  ++TA++F    L+Q+  ++  G  T+T++Y  WY+D  L +  T   +++P    F+  P        +    EEYTD+ EL+AL E++G +GM+ L EK+M  I   VS L++ V+ N+  L+ L   N D   +  +L+  + ++D+       +G++  F+ L ++AL+ V++  +P++ S + D++++F             +D Q+         ++E+    G +  VD  L  A+ +LK               + ED   T  LL+   +  LP +    ++ Y+ E EA + +AHC + ++  +        G D  +D++R F+A+TSS+LL+LG+E        KD    +  R+S+Y+  D ++Q    ++ D  E CFPYAL+R AYH V ++ +
Sbjct:    4 GLSVTEQKLAEKLTILNERGEGMLTRIYNIKKAC-SDPKSRPGFLMDKALEPSIKYIVRKFPQMDTK--ATQLQAVQSIQNEVMKGLSNYYFTFVDIMEFKDNASELLTAIDASFVHFDITLNFDLTKAYLDLIVTLTALMIMVSRVDDRRSVLGLFNHAFEMRNGRSEESFPRLGQMILDY---DSPLKKLAEQFVPHQQRVSTALQSLHEIYLRKSMTGEQWRQGQILSIINA--PANILVPGQSKVPAVEYLEVSVIQRWIMFGYTMCHQQL-AMPGITDIWKMALQDGFCITLFRDEIFMFHKEFHNMLDGMKGYGKRIKDIQDAANQMAA-SVGIHKERRNYLRSALTEMTLILADQPGLLGPKMLIILHGLSIAHDEILWLVRHC-CNPAPRSRKLTQEDFFDSKLPHLLFAVEELRSMVQKYSSVLQRYFIQYLSGFDVYMLKQVVQK-ISICSEDISLIMTSFIDELSSLSVKQ-----VESGELFHFSGLRLDWLRLQAYTSVRGSSPELKDNRDLVELMNNVVFHSKLVDLQDETLAEVSDLSIFCFYPGFFEESFVRCLEDITQSRYCIAFPLICGHFMTCTSDFCPEERHPIGDRSLSAVNLFLDSMAKEARNIMSQVCSEHIQQHQQLWHTHAVRMMTEMASERRTKD------KNKKNVHVEFKP-PGIESFRKSRETLTSLDTKLLSLTELCHAITHTEAIPVWEHIFAPKEYLSSQLEEFFAKAVVSMAQYDI--DNQRIA---RPSEVLSNVKAMMSSLRSLENYTGVDTARVFNHVLLQQTQPQDSQGANTITQMYTTWYLDVFLRRVMTDGIVYSPRRMAFVNRP-------GMPFRAEEYTDVNELQALAELLGAYGMRYLGEKMMLQIASQVSELKKLVIMNKDVLVALRT-NFDKPEQCIELIRRLRNMDDVMLRMIIIGVILSFRQLIQQALDSVLKTRVPYMMSCITDMRKNFPHG---------NNDRQV---------VDEMATSAGQECVVDPLLCAALRTLKE-------------KKSEDDILTWSLLLVFVAVGLPSLAYKDASEYNGELEAHDNNAHCISSSVNSITGALCSNNG-DNPEDRLREFLAITSSSLLKLGME------AEKD----LKARESVYLLLDMVVQQSPYLTMDVLESCFPYALLRNAYHEVYQKRK 1116          
BLAST of Nck-associated protein 1 vs. Ensembl Medaka
Match: nckap1 (NCK associated protein 1 [Source:NCBI gene;Acc:101168353])

HSP 1 Score: 482.256 bits (1240), Expect = 3.217e-149
Identity = 344/1194 (28.81%), Postives = 593/1194 (49.66%), Query Frame = 2
Query:  101 GLKPNISKITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQ------IERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVP----PLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRP-LLINNRTFQPNLYLKKEL-LKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHT---PLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMED-QTNELLIAATSYLLPRIVGS--NFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQS 3625
            G++P+  K+ EKL IL++R   +L ++ ++K          S +   +  ES ++ +V+KFP ++ +NN  N+  L    S+IL  L  +Y T VDV+E KD++ +L   I A Q   +I+++FD+TR YLDL+  Y+ +MIILS I + K+I+ LYN+A        +  Y RL + +V+       + ++  E  P+ +++  A+ SL  +   +  S  +W   +  +LIS+  P  +LN + S  +P C+      +E+WI+FG++  +P L  + +AL LW+  L  S  + LFR E   IH          RGY K  N ++E  ++  +++   HR RR +LR A++    ++ D PG + P  + +   ++ A DE+ WL+RH + I  K      TDDF D+ + E I  +EELR +++++  VM++YY   L   D   L   + + +    +D+  I+  F   + ++++ Q     + D +   F+ +RLDWFRLQ Y S   A       +E  + MN+I+ H+ +VD+L   + + S +    F+     + F+  L+  +Q R+++ FP +C HF++     CP++ + I   S+ + + +L  + ++   L+TD+      L+ +L P +            AK  S   N     +           PG+ES   +       D    AL++L   +N  P L++   TF P  YL   L ++F      T S V +         I +PSE+L  ++  M+++  +  +V I+  ++F +  L+Q+   +  G  T+T +Y NWY++ +L Q    H    P +K F+ LP + +    +  N EEY+DI E+RAL E++GP+GMK L E +M  I   V+ L++ V+ N   L ++         +  L   +  VD   +    +G++  F+ L +EAL DV+   +PFL S+V D +   D  P        E D ++       + + EL    GL  ++D  L  A+           S +  NI   E+ +   LL+   +  LP    S  + Y    E    + HC A AI ++    F  + +  ++D+++ F+AL SS+LL++G ET  ++           NR+S+Y+  D I+Q    ++ D  E CFPY L+R AYH V KQS
Sbjct:    5 GIQPSQQKLAEKLTILNDRGIGMLTRVYNIKKACGDPKAKPSYLVDKN-LESAVKFIVRKFPAVETRNN--NLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDACQVYFDITVNFDLTRNYLDLVVTYTTLMIILSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQMIVDYE---NPLKKMMEEFVPHGKSLSEALISLQMVYPRRNLSADQWRNAQLLSLISA--PSTMLNPAQSDTMP-CEYLSLDAMEKWIVFGFILCHPALNSDAAALSLWKLALQSSTCLCLFRDEVFHIHKAAEDLFVNIRGYNKRINDIRECKEQALSHAGSMHRERRKFLRSALKELATVLADQPGLLGPKALFVFMALSFARDEIIWLLRHADNIQKKS-----TDDFIDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLSGFDAVVLNEMVQN-LSVCPEDESIIMSSFVNTMTSLSVKQ-----VEDGEVFDFRGMRLDWFRLQAYTSVSKASLGISDHKELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELPSQSRHSICFPLLCTHFMSCTHELCPEERHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTLSDQLLPKHC-----------AKTISQAVNKKSKKAPGKKGEPEREKPGMESMRKNRLLVTNLDKLHTALSELCFSINYVPNLMVWEHTFTPREYLTSHLEIRF------TKSIVGMTMYNQATQEIAKPSELLTSVRAYMTVLQSIENYVTIDITRVFNNVLLQQTQHLDSHGEPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTDNE----LTFNAEEYSDISEMRALSELLGPYGMKFLSESLMWHISSQVAELKKLVVENMDVLTQMRTSFDKPDHMAALFKKLTSVDSVLKRMTIIGVILSFRSLAQEALRDVLSCHIPFLVSSVEDFK---DHIP-------RETDMKV------AMNVYELSSAAGLPCEIDPALVVALS----------SQKSENISPEEEYKIACLLMVFVAVSLPMFACSVMSQYSPAIEGHCNNIHCLAKAINQIAAALFTIH-KGSIEDRLKEFLALASSSLLKIGQETDKTT---------TRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQS 1121          
BLAST of Nck-associated protein 1 vs. Ensembl Medaka
Match: zgc:172352 (nck-associated protein 1-like [Source:NCBI gene;Acc:101159814])

HSP 1 Score: 417.927 bits (1073), Expect = 1.376e-125
Identity = 309/1191 (25.94%), Postives = 572/1191 (48.03%), Query Frame = 2
Query:  122 KITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYC------------QIERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKT-DDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVPPLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRPLLINNRTFQPNLYLKKELLKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQP---YTLHTPLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSK------IKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMEDQTNELLIAATSYLLPRIV--GSNFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVK 3619
            K+ EKL +L+ER   VLI+++ +K L  + +       ++ A E  ++ + KKFPNID + N  N+  +    S+IL      Y++ +DVLE+KD+  +L   I A Q S +I  +FD T+ YLDLI  +++++++LS I   K ++ ++N A        EP Y RL +  +E       + E   +  P++R++  A+ SL  +   +     +W   R+  L+S      LL++  +++ P C             +ERWII G+L  +  L  N ++L+LW+  L     + L R E   IH       +  +GY+K    +KE  +    N    HR RR +LR A++   Q++ D PG + P  + +   ++ + DE+ WL+RH+E +P      IKT +D+ND  + E +  +E LR  +++++ ++++Y+   L   D   L + I + +    +++  +L  F   L  +++ Q     + + +   F+ +RLDW RLQ Y S I A  P ++  +  + MN I  H+ +VD++   + + S +  L F+ +   + F  + +     +Y + FP +C HF +     CP++ +++ + S+ +  T+L +I ++   ++ ++     +LN +L P +  +   +   +K K         +          PG ES+  D T +   D   + L +L +  +     +N   F   +   + LL  L  +F  +  V++         I RPS++L  I+   + +  +S ++N++  +L     L+Q+   +  G  T+T +Y NWY++ +L Q      +H P   CF++   + +      +  EE++D+ EL+AL E+IGP+G+K L E +M  I   VS L++ V+ N   L+++     ++ K      +KK L   E+V    +    +G++  F+ + ++ L +V++   PFL + +  L+ +                    A  +  L I EL    GLK  +D  L  AI ++      L         + E + ++LL+   +  LP +    ++ Y+ E+     + HC A AI ++ +   F      ++ Q++ F+ L SS LL+LG            E I + NR+S+Y+    I++  + +S D  E CFPY L+R AY  V K
Sbjct:    6 KLAEKLTVLNERGQGVLIRMNYIKKLC-SHSKLRPTFLTDKAMEPAIKYINKKFPNIDFRGNNHNLTAIQRQKSEILQATKNFYDSFLDVLELKDHAYELLNTIDAGQCSFDIVFNFDFTKNYLDLIITFTSVILMLSRIEDKKVLVGMFNCAHEMTNGTSEPSYPRLGQMFLEYDHPWKKLLE---DFGPHTRSVTAALISLNMVYPRRNLPPEQW---RRAQLLS------LLSIPAAMMEPACCDTMTCEYLSMEVMERWIIIGFLLCHGSLNTNQTSLELWKMALRSGLYLTLIRDEVFNIHKVTEDIFDNFKGYSKRVADIKECREHVLINCGAMHRERRKFLRGALKELSQVLADEPGLLGPKALFVFMALSFSRDEVQWLVRHSESMP-----KIKTPEDYNDNQMAELLFHMERLRSLMRKYSKIVQRYHVQYLAQFDALVLNDTIQN-MSVCPEEESVLLSSFVSTLSALSIKQ-----VENKEEFDFRAVRLDWLRLQAYTSVIKAPLPLKEYPDLAKVMNMIQFHTKMVDSMEEMLQETSELSILCFYPHVFEKMFNQSNEEILMKQYLMAFPSVCSHFSHCGHSLCPEEMDILEKKSLRLCVTFLEQIAKQTSSVVLEICAEQRNLNDQLLPKHCAESISAARHRKQKKAVPKKGEVQKEK-------PGAESQRKDRTVTTNLDKLHLILRELCSTYSLCSDFLN---FDHIVVPTEFLLSHLEQRFSEI-IVRMANYNQTTQEITRPSDLLAAIRAYTASLHGLSSYINVDVTRLVKTVLLQQTQPLDSHGGQTITTLYTNWYLEGLLRQASNSLIVHCPTRHCFVSQTTDNEHS----LRAEEFSDVAELQALAELIGPYGLKFLSENLMWHITSQVSELKKMVIDNMDILVQMKN---NFGKPEEMVTLKKKLTGGENV---LKRMTIIGVILSFRAMTQDGLKEVLQNHCPFLIAPIESLKDNISPE----------------ADIKLTLNIFELVSAAGLKCDIDPALVAAIRNMHTDNTSL---------EEEFKLSQLLLVYIAVSLPFLALDPNSLYNQEHGGHNNNIHCLATAINQV-FAAMFTVQNKNIEQQLKEFLLLASSTLLQLGQNV---------EKIDVKNRESVYLLLHMIVEESQFLSQDMLESCFPYVLLRNAYREVHK 1116          
BLAST of Nck-associated protein 1 vs. Ensembl Medaka
Match: zgc:172352 (nck-associated protein 1-like [Source:NCBI gene;Acc:101159814])

HSP 1 Score: 373.244 bits (957), Expect = 1.235e-109
Identity = 283/1120 (25.27%), Postives = 535/1120 (47.77%), Query Frame = 2
Query:  122 KITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYC------------QIERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKT-DDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVPPLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRPLLINNRTFQPNLYLKKELLKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQP---YTLHTPLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSK------IKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMEDQTNELLIAATSYLLPRIV--GSNFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFI 3406
            K+ EKL +L+ER   VLI+++ +K L  + +       ++ A E  ++ + KKFPNID + N  N+  +    S+IL      Y++ +DVLE+KD+  +L   I A Q S +I  +FD T+ YLDLI  +++++++LS I   K ++ ++N A        EP Y RL +  +E       + E   +  P++R++  A+ SL  +   +     +W   R+  L+S      LL++  +++ P C             +ERWII G+L  +  L  N ++L+LW+  L     + L R E   IH       +  +GY+K    +KE  +    N    HR RR +LR A++   Q++ D PG + P  + +   ++ + DE+ WL+RH+E +P      IKT +D+ND  + E +  +E LR  +++++ ++++Y+   L   D   L + I + +    +++  +L  F   L  +++ Q     + + +   F+ +RLDW RLQ Y S I A  P ++  +  + MN I  H+ +VD++   + + S +  L F+ +   + F  + +     +Y + FP +C HF +     CP++ +++ + S+ +  T+L +I ++   ++ ++     +LN +L P +  +   +   +K K               V    PG ES+  D T +   D   + L +L +  +     +N   F   +   + LL  L  +F  +  V++         I RPS++L  I+   + +  +S ++N++  +L     L+Q+   +  G  T+T +Y NWY++ +L Q      +H P   CF++   + +      +  EE++D+ EL+AL E+IGP+G+K L E +M  I   VS L++ V+ N   L+++     ++ K      +KK L   E+V    +    +G++  F+ + ++ L +V++   PFL + +  L+ +                    A  +  L I EL    GLK  +D  L  AI ++      L         + E + ++LL+   +  LP +    ++ Y+ E+     + HC A AI ++ +   F      ++ Q++ F+
Sbjct:    6 KLAEKLTVLNERGQGVLIRMNYIKKLC-SHSKLRPTFLTDKAMEPAIKYINKKFPNIDFRGNNHNLTAIQRQKSEILQATKNFYDSFLDVLELKDHAYELLNTIDAGQCSFDIVFNFDFTKNYLDLIITFTSVILMLSRIEDKKVLVGMFNCAHEMTNGTSEPSYPRLGQMFLEYDHPWKKLLE---DFGPHTRSVTAALISLNMVYPRRNLPPEQW---RRAQLLS------LLSIPAAMMEPACCDTMTCEYLSMEVMERWIIIGFLLCHGSLNTNQTSLELWKMALRSGLYLTLIRDEVFNIHKVTEDIFDNFKGYSKRVADIKECREHVLINCGAMHRERRKFLRGALKELSQVLADEPGLLGPKALFVFMALSFSRDEVQWLVRHSESMP-----KIKTPEDYNDNQMAELLFHMERLRSLMRKYSKIVQRYHVQYLAQFDALVLNDTIQN-MSVCPEEESVLLSSFVSTLSALSIKQ-----VENKEEFDFRAVRLDWLRLQAYTSVIKAPLPLKEYPDLAKVMNMIQFHTKMVDSMEEMLQETSELSILCFYPHVFEKMFNQSNEEILMKQYLMAFPSVCSHFSHCGHSLCPEEMDILEKKSLRLCVTFLEQIAKQTSSVVLEICAEQRNLNDQLLPKHCAESISAARHRKQKKAVPKKGE-------VQKEKPGAESQRKDRTVTTNLDKLHLILRELCSTYSLCSDFLN---FDHIVVPTEFLLSHLEQRFSEI-IVRMANYNQTTQEITRPSDLLAAIRAYTASLHGLSSYINVDVTRLVKTVLLQQTQPLDSHGGQTITTLYTNWYLEGLLRQASNSLIVHCPTRHCFVSQTTDNEHS----LRAEEFSDVAELQALAELIGPYGLKFLSENLMWHITSQVSELKKMVIDNMDILVQMKN---NFGKPEEMVTLKKKLTGGENV---LKRMTIIGVILSFRAMTQDGLKEVLQNHCPFLIAPIESLKDNISPE----------------ADIKLTLNIFELVSAAGLKCDIDPALVAAIRNMHTDNTSL---------EEEFKLSQLLLVYIAVSLPFLALDPNSLYNQEHGGHNNNIHCLATAINQV-FAAMFTVQNKNIEQQLKEFL 1054          
BLAST of Nck-associated protein 1 vs. Ensembl Medaka
Match: zgc:172352 (nck-associated protein 1-like [Source:NCBI gene;Acc:101159814])

HSP 1 Score: 369.777 bits (948), Expect = 1.201e-108
Identity = 293/1191 (24.60%), Postives = 543/1191 (45.59%), Query Frame = 2
Query:  122 KITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYC------------QIERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKT-DDFNDQLLPEFIHQIEELRFNLQQFN-VMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVPPLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRPLLINNRTFQPNLYLKKELLKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQP---YTLHTPLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSK------IKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMEDQTNELLIAATSYLLPRIV--GSNFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVK 3619
            K+ EKL +L+ER   VLI+++ +K L  + +       ++ A E  ++ + KKFPNID + N                                D+  +L   I A Q S +I  +FD T+ YLDLI  +++++++LS I   K ++ ++N A        EP Y RL +  +E       + E   +  P++R++  A+ SL  +   +     +W   R+  L+S      LL++  +++ P C             +ERWII G+L  +  L  N ++L+LW+  L     + L R E   IH       +  +GY+K    +KE  +    N    HR RR +LR A++   Q++ D PG + P  + +   ++ + DE+ WL+RH+E +P      IKT +D+ND  + E +  +E LR  +++++ ++++Y+   L   D   L + I + +    +++  +L  F   L  +++ Q     + + +   F+ +RLDW RLQ Y S I A  P ++  +  + MN I  H+ +VD++   + + S +  L F+ +   + F  + +     +Y + FP +C HF +     CP++ +++ + S+ +  T+L +I ++   ++ ++     +LN +L P +  +   +   +K K         +          PG ES+  D T +   D   + L +L +  +     +N   F   +   + LL  L  +F  +  V++         I RPS++L  I+   + +  +S ++N++  +L     L+Q+   +  G  T+T +Y NWY++ +L Q      +H P   CF++   + +      +  EE++D+ EL+AL E+IGP+G+K L E +M  I   VS L++ V+ N   L+++     ++ K      +KK L   E+V    +    +G++  F+ + ++ L ++                                            L I EL    GLK  +D  L  AI ++      L         + E + ++LL+   +  LP +    ++ Y+ E+     + HC A AI ++ +   F      ++ Q++ F+ L SS LL+LG            E I + NR+S+Y+    I++  + +S D  E CFPY L+R AY  V K
Sbjct:    6 KLAEKLTVLNERGQGVLIRMNYIKKLC-SHSKLRPTFLTDKAMEPAIKYINKKFPNIDFRGNN-------------------------------DHAYELLNTIDAGQCSFDIVFNFDFTKNYLDLIITFTSVILMLSRIEDKKVLVGMFNCAHEMTNGTSEPSYPRLGQMFLEYDHPWKKLLE---DFGPHTRSVTAALISLNMVYPRRNLPPEQW---RRAQLLS------LLSIPAAMMEPACCDTMTCEYLSMEVMERWIIIGFLLCHGSLNTNQTSLELWKMALRSGLYLTLIRDEVFNIHKVTEDIFDNFKGYSKRVADIKECREHVLINCGAMHRERRKFLRGALKELSQVLADEPGLLGPKALFVFMALSFSRDEVQWLVRHSESMP-----KIKTPEDYNDNQMAELLFHMERLRSLMRKYSKIVQRYHVQYLAQFDALVLNDTIQN-MSVCPEEESVLLSSFVSTLSALSIKQ-----VENKEEFDFRAVRLDWLRLQAYTSVIKAPLPLKEYPDLAKVMNMIQFHTKMVDSMEEMLQETSELSILCFYPHVFEKMFNQSNEEILMKQYLMAFPSVCSHFSHCGHSLCPEEMDILEKKSLRLCVTFLEQIAKQTSSVVLEICAEQRNLNDQLLPKHCAESISAARHRKQKKAVPKKGEVQKEK-------PGAESQRKDRTVTTNLDKLHLILRELCSTYSLCSDFLN---FDHIVVPTEFLLSHLEQRFSEI-IVRMANYNQTTQEITRPSDLLAAIRAYTASLHGLSSYINVDVTRLVKTVLLQQTQPLDSHGGQTITTLYTNWYLEGLLRQASNSLIVHCPTRHCFVSQTTDNEHS----LRAEEFSDVAELQALAELIGPYGLKFLSENLMWHITSQVSELKKMVIDNMDILVQMKN---NFGKPEEMVTLKKKLTGGENV---LKRMTIIGVILSFRAMTQDGLKELT-------------------------------------------LNIFELVSAAGLKCDIDPALVAAIRNMHTDNTSL---------EEEFKLSQLLLVYIAVSLPFLALDPNSLYNQEHGGHNNNIHCLATAINQV-FAAMFTVQNKNIEQQLKEFLLLASSTLLQLGQNV---------EKIDVKNRESVYLLLHMIVEESQFLSQDMLESCFPYVLLRNAYREVHK 1058          
BLAST of Nck-associated protein 1 vs. Planmine SMEST
Match: SMESG000051120.1 (SMESG000051120.1)

HSP 1 Score: 2402.09 bits (6224), Expect = 0.000e+0
Identity = 1197/1204 (99.42%), Postives = 1201/1204 (99.75%), Query Frame = 2
Query:   95 MLGLKPNISKITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQIERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFNVMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVPPLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRPLLINNRTFQPNLYLKKELLKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHTPLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMEDQTNELLIAATSYLLPRIVGSNFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQSRLVMTKAAHPTDASSKAAMEAYKVDNK 3706
            MLGLKPNISKITEKLKILSERMTVVLIQIDSLKNLLQTENNF+SQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQIERWIIFGYLSVYPELLKNPSALQLWRSVLSFSFSIVLFRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFNVMEKYYRIVLQSIDFPKLKNYIDSFIDH SDDDLEILHFFSEKLENIN+DQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQ SCPDDFNL+LRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVPPLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRPLLINNRTFQPNLYLKKELLKFLNDKFVTLSSVKIKRDKSEIAG RRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHTPLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDV+EFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIESLKIQQQQLQSGQGINIDQMEDQTNELLIAATSYLLPRIVGSNFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQSRLVMTKAAHPTDASSKAAMEAYKVDNK
Sbjct:    1 MLGLKPNISKITEKLKILSERMTVVLIQIDSLKNLLQTENNFHSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQIERWIIFGYLSVYPELLKNPSALQLWRSVLSFSFSIVLFRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFNVMEKYYRIVLQSIDFPKLKNYIDSFIDHFSDDDLEILHFFSEKLENINIDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQSSCPDDFNLVLRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVPPLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRPLLINNRTFQPNLYLKKELLKFLNDKFVTLSSVKIKRDKSEIAGTRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHTPLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVNEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIESLKIQQQQLQSGQGINIDQMEDQTNELLIAATSYLLPRIVGSNFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQSRLVMTKAAHPTDASSKAAMEAYKVDNK 1204          
BLAST of Nck-associated protein 1 vs. Planmine SMEST
Match: SMESG000051120.1 (SMESG000051120.1)

HSP 1 Score: 2360.49 bits (6116), Expect = 0.000e+0
Identity = 1176/1183 (99.41%), Postives = 1180/1183 (99.75%), Query Frame = 2
Query:  158 MTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQIERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFNVMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVPPLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRPLLINNRTFQPNLYLKKELLKFLNDKFVTLSSVKIKRDKSEIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHTPLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXXXXXXNIDQMEDQTNELLIAATSYLLPRIVGSNFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQSRLVMTKAAHPTDASSKAAMEAYKVDNK 3706
            MTVVLIQIDSLKNLLQTENNF+SQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQIERWIIFGYLSVYPELLKNPSALQLWRSVLSFSFSIVLFRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFNVMEKYYRIVLQSIDFPKLKNYIDSFIDH SDDDLEILHFFSEKLENIN+DQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQ SCPDDFNL+LRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVPPLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRPLLINNRTFQPNLYLKKELLKFLNDKFVTLSSVKIKRDKSEIAG RRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHTPLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDV+EFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIESLKIQQQQLQSGQGINIDQMEDQTNELLIAATSYLLPRIVGSNFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQSRLVMTKAAHPTDASSKAAMEAYKVDNK
Sbjct:    1 MTVVLIQIDSLKNLLQTENNFHSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSVLLPYCQIERWIIFGYLSVYPELLKNPSALQLWRSVLSFSFSIVLFRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIKTDDFNDQLLPEFIHQIEELRFNLQQFNVMEKYYRIVLQSIDFPKLKNYIDSFIDHFSDDDLEILHFFSEKLENINIDQSNEPALSDADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQSSCPDDFNLVLRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSDFSNHSKSYSKIVVPPLPGIESKPSDITKSNTFDMQLIALNQLATGLNSRPLLINNRTFQPNLYLKKELLKFLNDKFVTLSSVKIKRDKSEIAGTRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMGFTTLTEIYCNWYVDFVLNQPYTLHTPLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVNEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIESLKIQQQQLQSGQGINIDQMEDQTNELLIAATSYLLPRIVGSNFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQSRLVMTKAAHPTDASSKAAMEAYKVDNK 1183          
BLAST of Nck-associated protein 1 vs. Planmine SMEST
Match: SMESG000030177.1 (SMESG000030177.1)

HSP 1 Score: 627.091 bits (1616), Expect = 0.000e+0
Identity = 416/1270 (32.76%), Postives = 681/1270 (53.62%), Query Frame = 2
Query:  113 NIS--KITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNSAYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVLEVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSITQIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNPYSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMS-----PSVLLPYCQIERWIIFGYLSVYPELLKNPSALQLWRXXXXXXXXXXXXRGENLQIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMRNQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKY------SSIKTDDFNDQLLPEFIHQIEEL-RFNLQQFNVMEKYYRIVLQSIDFPKLKNYIDSFIDHLSDDDLEILHFFSEKLENINMDQSNEPALS--DADSSSFKDLRLDWFRLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQFLYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLILRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHLSKKAKDCSD---FSNHSKSYSKIVVP---------PLPGIESKPSDITKSNTFDMQLIALNQLATGLN-SRPLLINNRTFQPNLYLKKELLKFLNDKFVTLSSVKIKRDKS--EIAGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQS-LTKEFMGFTTLTEIYCNWYVDFVLN---QPYTLHTPLLKCFITLPQNQKEVSNVIINVEEYTDIEELRALVEVIGPFGMKALYEKIMQLIVKYV-SLLRRFVMRNRSTLIELNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVRKTMPFLKSTVVDLQQDFDANPIDQLSSVSEHD-------SQIYAQCRNQLEINELCQGFGLKTKVDSTLFNAIEXXXXXXXXXXX---XXXXNIDQMEDQTNELLIAATSYLLPRI--VGSNFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQIRRFIALTSSNLLRLGLE-----------------TG--------------------SSSQTNKDEMI---LINNRDSIYIFFDFIIQTLENISDDFYEECFPYALVRQAYHNVVKQSRLVMTKAAHPT 3658
            NIS  K+ EK  I+++R+  +L ++  +K  L + +        +  YE  L+ L KKFP+ D K   S+ +PL  IH  IL  L  +Y TLVDV E+K  + +L   I  F   L+IS++F++T++YL++I N+S ++++L+ I ++K+I+ L+NFA   K  + E +   + E+L+E   +   I ++  + NPY+R I  A+ SL++    +      W + +  +++   +PD L + +      + LL    +ERWII     ++ EL  N     +W+S    S+ +VLFR E +  H    +Y +  +  +K    +KE  +     S  FHR RRNYLR+ +R   QII D PG + P   ++  T++ A DE+HWL+RH+E IP KK       S + TDDFND LLPE ++ +EE+ R  L+  +V+  +Y  +L   D P L+  +   +     +  +IL    + L +I+   +   A    D + S F+ LR+DWFR+Q YLS  ++      + + I  +NS + H+ ++DNLS  + + + +    F+  K  E++E N+  + QHR+A+VFP IC  ++N C   CP++   I + + + A   L  + Q + +L++  +  +F L L+L+P  +V+   +H + K K  S     +  S++   +  P         P+PG ES+          D  L+AL QL   +N S+ +++ +++F P   L +EL++ +N+K      + ++ D    EI+ +R+PSEML++++E MS+++ + +  NI   ++F + FL QS L     G  T+  IY  WY+D ++    + Y +++PLLK F+T+P   ++++      E+Y D+ ELRALVE++GP+GM+ L E I   I K V   L++ V++N++TL  L     + +K KKL   ++  D+     K++GIL  F+DLCREA  D++   +PFL +TV DLQQ++      Q+  +  H        + IY++   QL IN+LC   GLK  +DS L +AIE+ +  Q    +      +  DQ + +   LL    +Y LP++  + S+FYHVE EA   ++HC AYA+  LM V F +YG + LD + + F+ALTSSNLLRLGLE                 TG                    SS+  N ++ +      NR SIYI FD + Q    +S D  E CFPY+L+R AYH V +QSR  +   AHPT
Sbjct:    6 NISSYKVAEKFTIINDRLNGILKRVYFMKQELNSVDKPLFLPGGDKMYEPALKILCKKFPSSDYKIINSSFQPLINIHDDILNRLSSYYYTLVDVEEMKRPIFELLEIIKKFNVQLDISINFELTKSYLEMITNFSVILLLLTKIPEVKAIMALFNFAYEYKTAESEKHIQHMSEKLLETQPEK-VIKQLCFDFNPYTRFITAAVRSLSNCFTPRLVKSQNWTEVKFLDILH--EPDKLSHTALTDRMCTQLLSVESMERWIIICTFYIHHEL-SNSELFNVWKSAYRNSYVLVLFRDEIIPFHSLAVQYFDTVKSCSKRIAEIKEFYQHACCQSPVFHRDRRNYLRLTLRQLCQIISDEPGLLGPKSFLVLWTLSYATDEIHWLLRHSENIPPKKGPIINLNSKVTTDDFNDALLPELLYYLEEISRLVLRFDHVIRVFYLQILSEYDAPGLRYNLRDILQRSPQESGQILSSMVQTLASIDPSVAVAAAAGSFDREKSDFRGLRMDWFRVQFYLSIGSSSVNLWNNLKLISHINSTIFHTKMIDNLSETVRECADLSVFCFYDRKFQEFYERNITYSTQHRFAIVFPLICCQYVNACCDYCPEEAAGIAKRATQNAQKCLRNLAQHVAQLVSQTIDAYFSLGLQLEPKQSVNLMPAHKTNKKKQKSSTMPAAGKSRTGGSMRNPGLAVTVESKPVPGDESRRKTRENQTPLDKSLLALTQLCFAINHSKEIIVWDKSFVPREILFQELMEMINEKLNKSVEMPLQTDGKGEEISFVRQPSEMLIMLQEFMSVLINIDKHANIEIVRIFTEVFLSQSQLRDSHKGSPTIVAIYIKWYMDVLMRFAYKDYFVYSPLLKSFVTMPGEGQQLA---FRAEDYADLNELRALVEILGPYGMRLLTEGICSEISKIVEEKLKKLVIQNKTTLDSLRESVHEPAKTKKLTSFLQGSDDLLNALKRIGILLAFRDLCREATQDILSMRVPFLFNTVKDLQQEYRNKEDLQILQMQSHQELSADDRNMIYSKVNEQLIINDLCLSMGLKCSLDSNLCSAIENRRRIQAAQSANTPAGSVGADQ-DYKVAYLLFTFIAYTLPKLARLDSSFYHVELEAHTNNSHCIAYAVNSLMMVLFSRYGHEELDSREKEFMALTSSNLLRLGLECSNPSLSLDSSSPQPSNTGSSSNNFPNNSNKDPLITSINSSTAVNSNKAVQEPQAKNRYSIYILFDLMTQLCNCLSADLREACFPYSLIRHAYHVVAQQSRSTIAALAHPT 1267          
The following BLAST results are available for this feature:
BLAST of Nck-associated protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NCKAP13.547e-14628.33NCK associated protein 1 [Source:HGNC Symbol;Acc:H... [more]
NCKAP12.408e-14528.21NCK associated protein 1 [Source:HGNC Symbol;Acc:H... [more]
NCKAP1L7.474e-12326.14NCK associated protein 1 like [Source:HGNC Symbol;... [more]
NCKAP1L1.258e-12026.08NCK associated protein 1 like [Source:HGNC Symbol;... [more]
NCKAP1L2.303e-5029.31NCK associated protein 1 like [Source:HGNC Symbol;... [more]
back to top
BLAST of Nck-associated protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gex-31.000e-9924.58Membrane-associated protein gex-3 [Source:UniProt... [more]
gex-31.000e-9924.58Membrane-associated protein gex-3 [Source:UniProt... [more]
back to top
BLAST of Nck-associated protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Hem9.045e-14429.24gene:FBgn0011771 transcript:FBtr0078510[more]
back to top
BLAST of Nck-associated protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nckap14.624e-14728.22NCK-associated protein 1 [Source:NCBI gene;Acc:561... [more]
nckap14.892e-14628.11NCK-associated protein 1 [Source:NCBI gene;Acc:561... [more]
nckap15.825e-14628.25NCK-associated protein 1 [Source:NCBI gene;Acc:561... [more]
NCKAP1L3.955e-10924.62zgc:172352 [Source:ZFIN;Acc:ZDB-GENE-080204-117][more]
nckap15.941e-2830.36NCK-associated protein 1 [Source:NCBI gene;Acc:561... [more]
back to top
BLAST of Nck-associated protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NCKAP11.279e-14528.32NCK-associated protein 1 [Source:NCBI gene;Acc:100... [more]
NCKAP12.506e-14328.61NCK-associated protein 1 [Source:NCBI gene;Acc:100... [more]
NCKAP11.938e-13928.10NCK-associated protein 1 [Source:NCBI gene;Acc:100... [more]
NCKAP13.430e-13627.65NCK-associated protein 1 [Source:NCBI gene;Acc:100... [more]
NCKAP12.204e-13427.44NCK-associated protein 1 [Source:NCBI gene;Acc:100... [more]
back to top
BLAST of Nck-associated protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Nckap13.909e-14628.33NCK-associated protein 1 [Source:MGI Symbol;Acc:MG... [more]
Nckap12.880e-14528.21NCK-associated protein 1 [Source:MGI Symbol;Acc:MG... [more]
Nckap1l7.587e-12526.26NCK associated protein 1 like [Source:MGI Symbol;A... [more]
Nckap1l3.406e-2929.93NCK associated protein 1 like [Source:MGI Symbol;A... [more]
back to top
BLAST of Nck-associated protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B0S6R1|NCKP1_DANRE3.490e-14628.22Nck-associated protein 1 OS=Danio rerio OX=7955 GN... [more]
sp|P55161|NCKP1_RAT3.600e-14628.42Nck-associated protein 1 OS=Rattus norvegicus OX=1... [more]
sp|Q9Y2A7|NCKP1_HUMAN1.703e-14528.33Nck-associated protein 1 OS=Homo sapiens OX=9606 G... [more]
sp|P28660|NCKP1_MOUSE2.734e-14528.33Nck-associated protein 1 OS=Mus musculus OX=10090 ... [more]
sp|Q640K3|NCKP1_XENLA6.977e-14428.27Nck-associated protein 1 OS=Xenopus laevis OX=8355... [more]
back to top
BLAST of Nck-associated protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RJA03.779e-16029.88NCK-associated protein 1 OS=Fasciola hepatica OX=6... [more]
A0A5J4NG415.909e-15929.39NCK-associated protein 1 OS=Paragonimus westermani... [more]
C3ZLE66.468e-15729.03Uncharacterized protein OS=Branchiostoma floridae ... [more]
H2KT351.893e-15629.80Nck-associated protein 1 OS=Clonorchis sinensis OX... [more]
A0A4S2LBK84.274e-15629.51Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Nck-associated protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
nckap12.498e-13927.91NCK-associated protein 1 [Source:NCBI gene;Acc:561... [more]
zgc:1723524.264e-12826.37NCK associated protein 1 like [Source:NCBI gene;Ac... [more]
zgc:1723522.297e-11825.97NCK associated protein 1 like [Source:NCBI gene;Ac... [more]
zgc:1723524.985e-10724.43NCK associated protein 1 like [Source:NCBI gene;Ac... [more]
back to top
BLAST of Nck-associated protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nckap11.011e-15129.19NCK-associated protein 1 [Source:NCBI gene;Acc:561... [more]
nckap12.350e-12927.31NCK-associated protein 1 [Source:NCBI gene;Acc:561... [more]
back to top
BLAST of Nck-associated protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nck-associated protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
NAPA6.493e-13827.77Nck-associated protein 1 homolog [Source:UniProtK... [more]
back to top
BLAST of Nck-associated protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
nckap13.217e-14928.81NCK associated protein 1 [Source:NCBI gene;Acc:101... [more]
zgc:1723521.376e-12525.94nck-associated protein 1-like [Source:NCBI gene;Ac... [more]
zgc:1723521.235e-10925.27nck-associated protein 1-like [Source:NCBI gene;Ac... [more]
zgc:1723521.201e-10824.60nck-associated protein 1-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of Nck-associated protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000051120.10.000e+099.42SMESG000051120.1[more]
SMESG000051120.10.000e+099.41SMESG000051120.1[more]
SMESG000030177.10.000e+032.76SMESG000030177.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008269 ID=SMED30008269|Name=Nck-associated protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3988bp
AACTTCAAATCGCTACTTTAAATTGTAAACTTGAAATTTAATTTCCAACA
AATTTTAAATTTGATTTTCCTGAAATTTATTTTTATCATTCATCATGCTC
GGACTAAAACCTAATATTTCAAAAATCACAGAAAAATTAAAAATATTAAG
TGAAAGAATGACAGTAGTATTGATTCAAATTGATAGTTTGAAAAATCTCT
TACAAACAGAAAATAATTTTTACAGTCAAATATGCAGTAATTCGGCTTAT
GAATCAATATTGAGGTCATTAGTGAAAAAATTCCCTAATATCGACGTGAA
GAATAATAAATCGAATATAGAACCTCTCACAGCAATACACTCAAAGATAT
TAACCGAATTATATTTTCATTATAATACATTGGTTGATGTGTTAGAAGTA
AAAGATAACCTCATGGATTTATTTGGTCAAATAAGTGCTTTTCAATATTC
ATTAGAGATTTCGCTAAGTTTTGACATGACTCGAACTTATCTGGATTTAA
TAGCAAATTATTCAGCCATGATGATTATATTAAGCAGCATTACACAAATT
AAAAGCATACTGTTGCTATATAATTTTGCGACTTTATCAAAATTTGATCA
AGATGAACCGTATTATCATAGGCTTTGTGAAAGATTAGTGGAGAAACATA
AAGATGGTGGAGCAATTACAGAAATCCATAATGAATTAAATCCATATTCT
CGAACGATTATTAATGCAATTAATAGTTTGGCTAGTCTGGTTAAATTGAA
ACAAGAGTCAATTATTGAATGGGATAAAGGACGAAAATTCAATTTAATTT
CATCAACAAAACCCGACAACCTATTAAACATGAGTCCGTCAGTTTTGCTG
CCTTATTGTCAAATTGAAAGATGGATAATATTCGGCTACCTTTCCGTTTA
TCCGGAATTATTAAAAAATCCAAGCGCTCTTCAACTCTGGCGGAGTGTGC
TGTCGTTTTCATTTTCCATCGTGTTATTCCGTGGAGAAAACCTCCAAATC
CACCCGTTTCTCTCGAAATATTTGGAACTCCAAAGAGGATACACAAAATT
GACAAATATCGTCAAAGAGGTCAGCAAAGAATTCACCAACAATTCGACTG
GGTTCCATCGAAGTCGACGAAACTATTTACGAATGGCAATGAGAAATCAA
CTACAGATTATTGGCGATTTTCCCGGTTGCATGGCGCCAAATGTTATGAT
AATCTGTCAGACTATAACGAGCGCAGTCGACGAATTACACTGGCTCATCC
GACACAATGAATTAATCCCATCGAAAAAATACAGCAGTATTAAAACCGAC
GATTTTAACGATCAATTACTGCCGGAATTCATCCATCAAATCGAAGAATT
GAGATTTAATTTGCAGCAATTTAATGTAATGGAAAAATATTATCGTATCG
TGTTGCAGTCGATCGATTTTCCAAAACTGAAGAATTACATCGATTCCTTT
ATCGATCATCTTTCTGACGATGATTTGGAGATTTTGCATTTCTTTTCTGA
GAAACTAGAAAATATTAATATGGACCAATCAAATGAGCCAGCTTTGTCGG
ATGCCGATTCGAGTTCGTTTAAGGATTTACGATTGGATTGGTTTCGATTG
CAAACGTATTTGTCGAGTATCAATGCAAAATTTCCTTGGCAACAAAGCCA
GGAATTTATTCAATTCATGAATTCAATCGTGCTCCATTCGAATCTTGTTG
ATAATCTTTCAAATTTCATCGACAAGTTCAGTTCGATGCAATTTCTCTAT
TTCCATCGAAATAAAGTCAACGAATGGTTTGAGTTGAATCTAAAAACCAC
AGCTCAACATCGATATGCTGTTGTTTTCCCAAGGATTTGCGGGCATTTTA
TTAATAATTGCCAGCCGAGTTGTCCTGATGATTTCAATCTCATTTTGCGC
TCATCTGTGGAAATGGCTCATACCTATCTCAGTCGAATTTGTCAGGAGTT
GTGCAAACTGCTAACGGATATGGTCAAAATGCATTTCGATTTGAACTTGA
AATTACAGCCGAATAATGCAGTGGATTTTTACCTGTCTCATTTGTCGAAA
AAAGCTAAGGATTGCTCGGATTTTTCGAACCATAGCAAAAGTTATAGCAA
AATTGTTGTGCCACCTTTACCGGGTATCGAGAGCAAGCCTTCTGATATCA
CCAAATCCAACACATTCGACATGCAGCTGATCGCCTTGAACCAGCTGGCA
ACTGGATTGAATTCTCGACCGTTGCTCATCAATAATCGGACTTTTCAACC
GAATCTTTATTTGAAGAAAGAATTGCTGAAATTCTTGAATGACAAATTTG
TTACTTTAAGTAGCGTGAAAATCAAACGAGACAAAAGTGAAATCGCCGGA
ATTCGTCGACCTTCAGAAATGTTATTAATAATAAAAGAATGCATGAGCCT
CGTAATGAAAGTCAGTGAATTTGTTAATATCAACACCGCCAAATTGTTTA
TGGATGCCTTTCTTCGACAGTCTTTAACTAAAGAATTCATGGGTTTCACC
ACCTTGACTGAGATCTACTGCAATTGGTATGTAGATTTTGTTTTGAATCA
ACCATACACTTTGCACACGCCTTTATTAAAATGCTTCATTACACTGCCTC
AAAACCAAAAAGAAGTATCCAATGTGATTATCAACGTTGAAGAATACACC
GATATTGAAGAATTACGAGCCTTAGTGGAAGTAATTGGTCCCTTTGGAAT
GAAAGCTCTATATGAGAAAATAATGCAATTAATAGTGAAATATGTCAGTT
TATTGCGGAGATTCGTTATGCGGAATCGTTCTACCTTGATTGAATTGAAT
GTTATAAATCTTGATTATAGCAAAATAAAGAAATTGTTGCTTAATATTGA
AGATGTAGATGAATTCTGCCAGCATTGGAAGCAAATGGGAATATTGTTCG
TTTTTAAGGATTTGTGTCGGGAAGCTCTGAATGACGTTGTTAGAAAAACA
ATGCCATTTTTGAAATCTACGGTAGTTGATCTTCAGCAAGATTTCGATGC
AAACCCCATTGACCAGTTGTCAAGTGTTTCAGAGCATGACAGTCAGATTT
ATGCGCAATGCAGAAACCAACTGGAAATCAATGAACTATGTCAAGGATTT
GGGTTAAAGACGAAAGTGGATAGCACATTGTTTAACGCAATAGAATCACT
GAAAATACAGCAGCAACAATTGCAGTCAGGCCAAGGAATCAACATCGACC
AAATGGAAGATCAAACAAATGAACTGCTAATTGCAGCTACTTCTTATCTG
TTACCTCGAATAGTCGGCTCGAACTTCTATCATGTCGAATACGAAGCTCT
TGAGGAAAGCGCGCACTGCACCGCATATGCAATCAAAGAATTGATGTATG
TTTTCTTTTTCAAATACGGAGAAGACAGACTCGATGATCAAATTCGAAGA
TTTATCGCTTTGACTTCCTCGAATCTTTTGCGATTGGGCCTAGAAACGGG
CAGCTCCAGCCAAACAAACAAAGATGAAATGATTCTAATAAACAATCGAG
ATTCCATTTATATTTTCTTTGATTTCATCATTCAAACTTTGGAAAACATT
TCCGATGATTTCTATGAGGAATGCTTTCCGTATGCTCTCGTCCGACAGGC
CTATCACAACGTGGTGAAACAATCCCGACTCGTCATGACAAAGGCTGCCC
ACCCGACAGATGCCTCCTCTAAAGCCGCTATGGAAGCTTACAAAGTTGAT
AACAAATGAAAGAGAAAATTTTCCAAAAATATTTTTTCTGATATTTTCCC
CCCCATTTTTATGCTTGATTTAATTCGACTAAAAAATATAAATTTTCTGG
ATTTTTATTATTAACTAGAATAAATTTTATTGTTCCATCCAGCCCGTTTG
CGAACTGTTGCAAGCAAATGATATTTAGAGTTTATAGCTGTTAATTTCTT
GATTTTTTGATAATTGTGATTTTTTTTTAAAAACCTTTACAATGAGCATG
TGTATTTTTGTGATTTATTTTCAATATAAATATATATT
back to top

protein sequence of SMED30008269-orf-1

>SMED30008269-orf-1 ID=SMED30008269-orf-1|Name=SMED30008269-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1205bp
MLGLKPNISKITEKLKILSERMTVVLIQIDSLKNLLQTENNFYSQICSNS
AYESILRSLVKKFPNIDVKNNKSNIEPLTAIHSKILTELYFHYNTLVDVL
EVKDNLMDLFGQISAFQYSLEISLSFDMTRTYLDLIANYSAMMIILSSIT
QIKSILLLYNFATLSKFDQDEPYYHRLCERLVEKHKDGGAITEIHNELNP
YSRTIINAINSLASLVKLKQESIIEWDKGRKFNLISSTKPDNLLNMSPSV
LLPYCQIERWIIFGYLSVYPELLKNPSALQLWRSVLSFSFSIVLFRGENL
QIHPFLSKYLELQRGYTKLTNIVKEVSKEFTNNSTGFHRSRRNYLRMAMR
NQLQIIGDFPGCMAPNVMIICQTITSAVDELHWLIRHNELIPSKKYSSIK
TDDFNDQLLPEFIHQIEELRFNLQQFNVMEKYYRIVLQSIDFPKLKNYID
SFIDHLSDDDLEILHFFSEKLENINMDQSNEPALSDADSSSFKDLRLDWF
RLQTYLSSINAKFPWQQSQEFIQFMNSIVLHSNLVDNLSNFIDKFSSMQF
LYFHRNKVNEWFELNLKTTAQHRYAVVFPRICGHFINNCQPSCPDDFNLI
LRSSVEMAHTYLSRICQELCKLLTDMVKMHFDLNLKLQPNNAVDFYLSHL
SKKAKDCSDFSNHSKSYSKIVVPPLPGIESKPSDITKSNTFDMQLIALNQ
LATGLNSRPLLINNRTFQPNLYLKKELLKFLNDKFVTLSSVKIKRDKSEI
AGIRRPSEMLLIIKECMSLVMKVSEFVNINTAKLFMDAFLRQSLTKEFMG
FTTLTEIYCNWYVDFVLNQPYTLHTPLLKCFITLPQNQKEVSNVIINVEE
YTDIEELRALVEVIGPFGMKALYEKIMQLIVKYVSLLRRFVMRNRSTLIE
LNVINLDYSKIKKLLLNIEDVDEFCQHWKQMGILFVFKDLCREALNDVVR
KTMPFLKSTVVDLQQDFDANPIDQLSSVSEHDSQIYAQCRNQLEINELCQ
GFGLKTKVDSTLFNAIESLKIQQQQLQSGQGINIDQMEDQTNELLIAATS
YLLPRIVGSNFYHVEYEALEESAHCTAYAIKELMYVFFFKYGEDRLDDQI
RRFIALTSSNLLRLGLETGSSSQTNKDEMILINNRDSIYIFFDFIIQTLE
NISDDFYEECFPYALVRQAYHNVVKQSRLVMTKAAHPTDASSKAAMEAYK
VDNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0031258lamellipodium membrane
GO:0042995cell projection
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0031209SCAR complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR019137Nck-associated_protein-1
Vocabulary: biological process
TermDefinition
GO:0000902cell morphogenesis
GO:0001764neuron migration
GO:0006909phagocytosis
GO:0007010cytoskeleton organization
GO:0007409axonogenesis
GO:0007417central nervous system development
GO:0007520myoblast fusion
GO:0007528neuromuscular junction development
GO:0008360regulation of cell shape
GO:0008407chaeta morphogenesis
GO:0030031cell projection assembly
GO:0030036actin cytoskeleton organization
GO:0030866cortical actin cytoskeleton organization
GO:0033627cell adhesion mediated by integrin
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019137Nck-associated protein 1PFAMPF09735Nckap1coord: 9..1175
e-value: 4.8E-220
score: 733.6
IPR019137Nck-associated protein 1PANTHERPTHR12093Nck-associated protein 1coord: 7..1175