slc2a-1

Overview
Nameslc2a-1 (AKN21396.1)
Smed IDSMED30008266
Length (bp)1653
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc2a-1 (SMED30008266) t-SNE clustered cells

Violin plots show distribution of expression levels for slc2a-1 (SMED30008266) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc2a-1 (SMED30008266) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc2a-1 (SMED30008266) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008266

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30008266SMESG000072446.1 SmedASXL_000771SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
cephalic gangliaSMED30008266SMESG000072446.1 dd_Smed_v4_5447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008266SMESG000072446.1 dd_Smed_v4_5447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008266SMESG000072446.1 Contig39940newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008266SMESG000072446.1 Contig39940uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008266SMESG000072446.1 Contig18041newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008266SMESG000072446.1 Contig18041uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30008266SMESG000072446.1 dd_Smed_v6_5447_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
glial cellSMED30008266SMESG000072446.1 dd_Smed_v6_5447_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30008266SMESG000072446.1 dd_Smed_v6_5447_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc2a-1 vs. Ensembl Human
Match: SLC2A1 (solute carrier family 2 member 1 [Source:HGNC Symbol;Acc:HGNC:11005])

HSP 1 Score: 352.443 bits (903), Expect = 2.246e-115
Identity = 181/472 (38.35%), Postives = 292/472 (61.86%), Query Frame = 2
Query:   89 QMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYT--QLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRG 1498
            ++T  L+L+     LGS   +GYN   +N P ++I++F+N+++  RYG  +  + L  LWS +V IF   G +GSF  G   ++ GR+ S+++ N LA V  +L   SK     E++++GRFIIG+ CGLT G   +++ E+SP ++RGA+   HQ+G+V GIL AQV GLDS++G +  W  LL    IP +L C +LPFCPESPR+L++++N+E  A+  ++K   + + ++   + +M++E   S   + + + T  +LFR+   R  +L+ + L + QQ SGINA+F YS S+F +AGV++    Y  +G+G+VN   T V+L ++++AGRR+L L     M  C +LM  ++    + PW+S+LSIV +  ++  F +G GPIP  + +E F QGPR AA+ +    +W  N IV   F+++E+  G Y+FIIF ++  L  IF    +PET GR+ D+I   F++G
Sbjct:    7 KLTGRLMLAVGGAVLGS-LQFGYNTGVINAPQKVIEEFYNQTWVHRYGESILPTTLTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIMGNKDLWPLLLSIIFIPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKL--RGTADVTHDLQEMKEE---SRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEKAGVQQP--VYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAILMTIALALLEQLPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQG 470          
BLAST of slc2a-1 vs. Ensembl Human
Match: SLC2A3 (solute carrier family 2 member 3 [Source:HGNC Symbol;Acc:HGNC:11007])

HSP 1 Score: 317.39 bits (812), Expect = 1.070e-101
Identity = 171/462 (37.01%), Postives = 269/462 (58.23%), Query Frame = 2
Query:  107 LLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFK 1492
            L+ +ITVA   SF +GYN   +N P ++I++F N++ T +  +P S+  L  LWS +V IF   G +GSF  G   ++ GR+ S+++ N LA+ GG      K     E++++GR +IGL CGL  G   +++ EISP ++RGA    +Q+G+V GIL AQ+ GL+ +LG+E+ W  LLGFTI+P IL    LPFCPESPR+L++++ +E+ A+  +++     + ++ + I +M+ E  A      +    +LFR    R  +++ I L + QQ SGINA+F YS  +F  AGV++    Y  +G G+VN + T V+L L+++AGRR+L +     M  C  LM  S+  +  +  +S + I  +L ++  F +G GPIP  + +E F QGPR AA+ +    +W  N +V   F      +G Y+FIIF       L F    +PET GR+ +DI   F+
Sbjct:   10 LIFAITVATIGSFQFGYNTGVINAPEKIIKEFINKTLTDKGNAPPSEVLLTSLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAVTGGCFMGLCKVAKSVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVVGILVAQIFGLEFILGSEELWPLLLGFTILPAILQSAALPFCPESPRFLLINRKEEENAKQILQRLW--GTQDVSQDIQEMKDES-ARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQEP--IYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKDNYNGMSFVCIGAILVFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAHYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFE 466          
BLAST of slc2a-1 vs. Ensembl Human
Match: SLC2A14 (solute carrier family 2 member 14 [Source:HGNC Symbol;Acc:HGNC:18301])

HSP 1 Score: 307.375 bits (786), Expect = 6.073e-98
Identity = 169/462 (36.58%), Postives = 265/462 (57.36%), Query Frame = 2
Query:  107 LLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFK 1492
            L+ +ITVA   SF +GYN   +N P  +I++F N++ T +  +P S+  L  LWS +V IF   G +GSF  G   ++ GR+ S+++ N LA  GG L    K     E++++GR +IGL CGL  G   +++ EISP ++RGA    +Q+G+V GIL AQ+ GL+ +LG+E+ W  LLGFTI+P IL    LP CPESPR+L++++  E+ A   +++     + ++ + I +M+ E  A      +    +LFR    R  +++ I L + QQ SGINA+F YS  +F  AGV++    Y  +  G+VN + T ++L L+++AGRR+L +     M  C  LM  S+  ++ +  +S + I  +L ++  F +G GPIP  + +E F QGPR AA+ +    +W  N +V   F      +G Y+FIIF       L F    +PET GR+ +DI   F+
Sbjct:   11 LIFAITVATIGSFQFGYNTGVINAPETIIKEFINKTLTDKANAPPSEVLLTNLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAATGGCLMGLCKIAESVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVIGILVAQIFGLELILGSEELWPVLLGFTILPAILQSAALPCCPESPRFLLINRKKEENATRILQRLW--GTQDVSQDIQEMKDES-ARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQQP--IYATISAGVVNTIFTLLSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKNHYNGMSFVCIGAILVFVACFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAYYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFE 467          
BLAST of slc2a-1 vs. Ensembl Human
Match: SLC2A14 (solute carrier family 2 member 14 [Source:HGNC Symbol;Acc:HGNC:18301])

HSP 1 Score: 307.375 bits (786), Expect = 6.073e-98
Identity = 169/462 (36.58%), Postives = 265/462 (57.36%), Query Frame = 2
Query:  107 LLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFK 1492
            L+ +ITVA   SF +GYN   +N P  +I++F N++ T +  +P S+  L  LWS +V IF   G +GSF  G   ++ GR+ S+++ N LA  GG L    K     E++++GR +IGL CGL  G   +++ EISP ++RGA    +Q+G+V GIL AQ+ GL+ +LG+E+ W  LLGFTI+P IL    LP CPESPR+L++++  E+ A   +++     + ++ + I +M+ E  A      +    +LFR    R  +++ I L + QQ SGINA+F YS  +F  AGV++    Y  +  G+VN + T ++L L+++AGRR+L +     M  C  LM  S+  ++ +  +S + I  +L ++  F +G GPIP  + +E F QGPR AA+ +    +W  N +V   F      +G Y+FIIF       L F    +PET GR+ +DI   F+
Sbjct:   11 LIFAITVATIGSFQFGYNTGVINAPETIIKEFINKTLTDKANAPPSEVLLTNLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAATGGCLMGLCKIAESVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVIGILVAQIFGLELILGSEELWPVLLGFTILPAILQSAALPCCPESPRFLLINRKKEENATRILQRLW--GTQDVSQDIQEMKDES-ARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQQP--IYATISAGVVNTIFTLLSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKNHYNGMSFVCIGAILVFVACFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAYYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFE 467          
BLAST of slc2a-1 vs. Ensembl Human
Match: SLC2A14 (solute carrier family 2 member 14 [Source:HGNC Symbol;Acc:HGNC:18301])

HSP 1 Score: 306.99 bits (785), Expect = 1.663e-97
Identity = 169/462 (36.58%), Postives = 265/462 (57.36%), Query Frame = 2
Query:  107 LLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFK 1492
            L+ +ITVA   SF +GYN   +N P  +I++F N++ T +  +P S+  L  LWS +V IF   G +GSF  G   ++ GR+ S+++ N LA  GG L    K     E++++GR +IGL CGL  G   +++ EISP ++RGA    +Q+G+V GIL AQ+ GL+ +LG+E+ W  LLGFTI+P IL    LP CPESPR+L++++  E+ A   +++     + ++ + I +M+ E  A      +    +LFR    R  +++ I L + QQ SGINA+F YS  +F  AGV++    Y  +  G+VN + T ++L L+++AGRR+L +     M  C  LM  S+  ++ +  +S + I  +L ++  F +G GPIP  + +E F QGPR AA+ +    +W  N +V   F      +G Y+FIIF       L F    +PET GR+ +DI   F+
Sbjct:   34 LIFAITVATIGSFQFGYNTGVINAPETIIKEFINKTLTDKANAPPSEVLLTNLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAATGGCLMGLCKIAESVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVIGILVAQIFGLELILGSEELWPVLLGFTILPAILQSAALPCCPESPRFLLINRKKEENATRILQRLW--GTQDVSQDIQEMKDES-ARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQQP--IYATISAGVVNTIFTLLSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKNHYNGMSFVCIGAILVFVACFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAYYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFE 490          
BLAST of slc2a-1 vs. Ensembl Celegans
Match: fgt-1 (Facilitated glucose transporter protein 1 [Source:UniProtKB/Swiss-Prot;Acc:O44827])

HSP 1 Score: 267.314 bits (682), Expect = 6.613e-83
Identity = 156/473 (32.98%), Postives = 259/473 (54.76%), Query Frame = 2
Query:   89 QMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMD--KAGRRSLLLYPSMVMIICMLLMIPSIGYQHKF--PWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKR 1495
            ++T+ L  S+  + L +SF +GY++  +N P  +I ++   S+   +   LS+   ++ WS  V++F   G +G    GW+ADK+GR+ +L  NN LA+    L   +K +    ++++GR IIGLNCG +  L  +FLTEISP ++RG + + HQ+ V   IL +Q+ GL  LLGT   W  +  FT++P +L   +L  CPESP+Y M  +     A   ++K   +++ ++   I  MQ+E  A+     K +   +F+   L   + + I +M+ QQ SGIN    YS  +F  AG+  +   Y  +G G VNV++T +++ L+D  K GRRSLLL     M +  LL++ ++  Q+     W S+ +I  +L +++ FA G G IP    SE F    RG A  I    +WA N++V  +F  +   + +Y F IF+      + +   F+PET G+S++ I  +F++
Sbjct:   23 KLTKCLAFSAFVITL-ASFQFGYHIGCVNAPGGLITEWIIGSHKDLFDKELSRENADLAWSVAVSVFAVGGMIGGLSSGWLADKVGRRGALFYNNLLALAAAALMGLAKSVGAYPMVILGRLIIGLNCGFSSALVPMFLTEISPNNLRGMLGSLHQLLVTIAILVSQIFGLPHLLGTGDRWPLIFAFTVVPAVLQLALLMLCPESPKYTMAVRGQRNEAESALKKL--RDTEDVSTEIEAMQEEATAA-GVQEKPKMGDMFKG-ALLWPMSIAIMMMLAQQLSGINVAMFYSTVIFRGAGLTGNEPFYATIGMGAVNVIMTLISVWLVDHPKFGRRSLLLAGLTGMFVSTLLLVGALTIQNSGGDKWASYSAIGFVLLFVISFATGPGAIPWFFVSEIFDSSARGNANSIAVMVNWAANLLVGLTFLPINNLMQQYSFFIFSGFLAFFIFYTWKFVPETKGKSIEQIQAEFEK 490          
BLAST of slc2a-1 vs. Ensembl Celegans
Match: fgt-1 (Facilitated glucose transporter protein 1 [Source:UniProtKB/Swiss-Prot;Acc:O44827])

HSP 1 Score: 267.314 bits (682), Expect = 9.794e-83
Identity = 156/473 (32.98%), Postives = 259/473 (54.76%), Query Frame = 2
Query:   89 QMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMD--KAGRRSLLLYPSMVMIICMLLMIPSIGYQHKF--PWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKR 1495
            ++T+ L  S+  + L +SF +GY++  +N P  +I ++   S+   +   LS+   ++ WS  V++F   G +G    GW+ADK+GR+ +L  NN LA+    L   +K +    ++++GR IIGLNCG +  L  +FLTEISP ++RG + + HQ+ V   IL +Q+ GL  LLGT   W  +  FT++P +L   +L  CPESP+Y M  +     A   ++K   +++ ++   I  MQ+E  A+     K +   +F+   L   + + I +M+ QQ SGIN    YS  +F  AG+  +   Y  +G G VNV++T +++ L+D  K GRRSLLL     M +  LL++ ++  Q+     W S+ +I  +L +++ FA G G IP    SE F    RG A  I    +WA N++V  +F  +   + +Y F IF+      + +   F+PET G+S++ I  +F++
Sbjct:   41 KLTKCLAFSAFVITL-ASFQFGYHIGCVNAPGGLITEWIIGSHKDLFDKELSRENADLAWSVAVSVFAVGGMIGGLSSGWLADKVGRRGALFYNNLLALAAAALMGLAKSVGAYPMVILGRLIIGLNCGFSSALVPMFLTEISPNNLRGMLGSLHQLLVTIAILVSQIFGLPHLLGTGDRWPLIFAFTVVPAVLQLALLMLCPESPKYTMAVRGQRNEAESALKKL--RDTEDVSTEIEAMQEEATAA-GVQEKPKMGDMFKG-ALLWPMSIAIMMMLAQQLSGINVAMFYSTVIFRGAGLTGNEPFYATIGMGAVNVIMTLISVWLVDHPKFGRRSLLLAGLTGMFVSTLLLVGALTIQNSGGDKWASYSAIGFVLLFVISFATGPGAIPWFFVSEIFDSSARGNANSIAVMVNWAANLLVGLTFLPINNLMQQYSFFIFSGFLAFFIFYTWKFVPETKGKSIEQIQAEFEK 508          
BLAST of slc2a-1 vs. Ensembl Celegans
Match: R09B5.11 (Facilitated glucose transporter homolog [Source:UniProtKB/Swiss-Prot;Acc:O44616])

HSP 1 Score: 258.07 bits (658), Expect = 4.367e-79
Identity = 152/459 (33.12%), Postives = 254/459 (55.34%), Query Frame = 2
Query:  110 LSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMD--KAGRRSLLLYPSMVMIICMLLMIPSIGYQHK-FPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDI 1477
            +SSI +A   SF  G+ +  +N P  +I D+  + + + +G  LS+ + + +WS  V++F   G  GSF  G++ADK GRK +L+ NN LA++  +  + SK      +I+ GRF++GLNCG+T GL  +FLTE++P ++RG   +FHQ+ +   I+ +Q +GL  + GT+  W Y+     IP  L    +PFC ESP+YL+   ND + AR  +EK   +   +++E +  M +E   + + + +  Y  LF+    +  ++V I +M  QQ+SGI+A+  YS  +F + G+  +   Y  VG G + ++ TF  L L+D  K GR+ L +     M I  +L++ ++   +  + W S+++++ +L ++V FA G GPIP    SE F    RG A  +    +W  N +V  +F  +   I +Y F++F        IF   F+PET G+S   I
Sbjct:   51 ISSIALA---SFQDGFQIGCINAPGPLIIDWIKKCHFELFGEVLSQYQADFIWSVAVSMFSVGGMFGSFCSGFLADKFGRKSTLLYNNILALLAAVCLSTSKLFNFYPMIVFGRFLVGLNCGITSGLVPMFLTELAPANLRGKCGSFHQLNISVAIVLSQALGLPQIFGTQVGWPYIFACVAIPTFLQLATIPFCVESPKYLISKLNDREEARRILEKL--RGHTKVDEELEHMVQETMVTVEPLHQPGYVSLFKGDN-QWPMIVSILMMFSQQFSGISAVTFYSTLIFKRNGLSGNEPMYATVGFGCIKLIATFGCLFLIDHPKFGRKRLHIAGLSGMCISSILIVITLTLSNAGYHWASYMNVLFILSFVVTFAFGPGPIPWFFTSELFDSATRGRAAAVSATSNWVANWMVGLTFLPINNIIHQYAFLMFTFFTFTFAIFTWKFVPETKGKSPSAI 503          
BLAST of slc2a-1 vs. Ensembl Celegans
Match: R09B5.11 (Facilitated glucose transporter homolog [Source:UniProtKB/Swiss-Prot;Acc:O44616])

HSP 1 Score: 258.07 bits (658), Expect = 4.367e-79
Identity = 152/459 (33.12%), Postives = 254/459 (55.34%), Query Frame = 2
Query:  110 LSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMD--KAGRRSLLLYPSMVMIICMLLMIPSIGYQHK-FPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDI 1477
            +SSI +A   SF  G+ +  +N P  +I D+  + + + +G  LS+ + + +WS  V++F   G  GSF  G++ADK GRK +L+ NN LA++  +  + SK      +I+ GRF++GLNCG+T GL  +FLTE++P ++RG   +FHQ+ +   I+ +Q +GL  + GT+  W Y+     IP  L    +PFC ESP+YL+   ND + AR  +EK   +   +++E +  M +E   + + + +  Y  LF+    +  ++V I +M  QQ+SGI+A+  YS  +F + G+  +   Y  VG G + ++ TF  L L+D  K GR+ L +     M I  +L++ ++   +  + W S+++++ +L ++V FA G GPIP    SE F    RG A  +    +W  N +V  +F  +   I +Y F++F        IF   F+PET G+S   I
Sbjct:   51 ISSIALA---SFQDGFQIGCINAPGPLIIDWIKKCHFELFGEVLSQYQADFIWSVAVSMFSVGGMFGSFCSGFLADKFGRKSTLLYNNILALLAAVCLSTSKLFNFYPMIVFGRFLVGLNCGITSGLVPMFLTELAPANLRGKCGSFHQLNISVAIVLSQALGLPQIFGTQVGWPYIFACVAIPTFLQLATIPFCVESPKYLISKLNDREEARRILEKL--RGHTKVDEELEHMVQETMVTVEPLHQPGYVSLFKGDN-QWPMIVSILMMFSQQFSGISAVTFYSTLIFKRNGLSGNEPMYATVGFGCIKLIATFGCLFLIDHPKFGRKRLHIAGLSGMCISSILIVITLTLSNAGYHWASYMNVLFILSFVVTFAFGPGPIPWFFTSELFDSATRGRAAAVSATSNWVANWMVGLTFLPINNIIHQYAFLMFTFFTFTFAIFTWKFVPETKGKSPSAI 503          
BLAST of slc2a-1 vs. Ensembl Celegans
Match: F53H8.3 (pep chromosome:WBcel235:X:938516:942608:1 gene:WBGene00018779.1 transcript:F53H8.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53H8.3)

HSP 1 Score: 196.823 bits (499), Expect = 1.259e-55
Identity = 148/523 (28.30%), Postives = 244/523 (46.65%), Query Frame = 2
Query:   95 TRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKY-HQKNSPELEEAIT-----DMQKEY----------------FASTDAIGKF-----------------------------QYTQLFRARKLRMALLVGISLMI----CQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYP-SMVMIICMLLMIPSIGYQHK-FPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSL--IFVLLFLPETNGRSLDDIVMD 1486
            +R+L+  +  V  GS+  Y Y V  +N    +I D+ N++Y  RY +PLS +  N++WSF V+       +G+     I +K GR+  +  N  L +   L E  +K    PEL++ GRF+ G+N GL+ GL  ++L EI+P   RG     HQ+ V F    + ++GL  +LG + NW        +P +    ILPFCPESP+Y + +K+D   A  ++E    ++ +P + E+I      D    +                FA+  A  KF                             Q    FR    R  L + +++ I     QQ++G  A+FA+S  +F  AG+     ++  +  G+V  L    +  L+ K GRR L L+  +  M+  MLL + +    ++   W  + +I  ++FY+  + +G  PIP ++ SE F Q  R  AV +     W    IV+ S+   ++ +G   F  F  I  L++  IF+ + LPET  R + +IV +
Sbjct:    4 SRYLITVTTVVLGGSAQFYSYGV--VNPAQVVITDWINQTYIDRYKAPLSLTVSNVIWSFVVSSIAIGAILGASFTRIIGEKYGRRNGMFFNGILNVFAALFELVAKRFSSPELLIFGRFVYGINMGLSSGLVPMYLMEITPYKYRGPAGTLHQIAVAFSDWFSLLIGLPEVLGDQNNWPLAFALPGLPALALVCILPFCPESPKYTLGTKHDRDKALKDVELLIGKEQAPHMFESIVREVALDEVSFFCVYLYTRISLLGLYLNFANHLATTKFWKKNVIHTALKLKLLSSKLRGNAKLHGYFQGDGTFRELFTRPDLRIPLAVSIIVMIAQQFTGCTAVFAFSTDMFLNAGLTPVIARFSTLAIGIVYFLFACTSPFLIHKVGRRWLSLFQLASCMVALMLLSLFTFLQNYENIEWARYGTIFSLVFYMCVYGVG-SPIPWIIASELFTQQFRATAVTVSVFVAWTFAFIVSTSYLPFQQLVG-ITFSYFPFIIGLAVFGIFIYVLLPETRDRPMVEIVTE 522          
BLAST of slc2a-1 vs. Ensembl Fly
Match: Glut1 (gene:FBgn0264574 transcript:FBtr0333493)

HSP 1 Score: 310.457 bits (794), Expect = 1.395e-99
Identity = 166/449 (36.97%), Postives = 265/449 (59.02%), Query Frame = 2
Query:  149 YGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKR 1495
            +GYN   +N P + I++F  + Y  RYG  +S+  +  L+S  V+IF   G +G F  GW+A++ GRK  L+LNN L I G  L   +K     E++ +GRFIIG+NCGL   L  ++++EI+P ++RG +   +Q+ V  G+L +QV+G++ +LGT + W  LLG  I P IL   +LP CPESPRYL+++K  E+ AR  + +     S  +EE I +M+ E  A           +L  +  LR  L++GI + + QQ+SGINA+F YS SLF  +G+ + + ++  +G G + V++T V++PLMD+ GRR+L LY    M I  + +  S   +    W+S+LS+V  L ++V FA+G G IP M+ +E F QGPR +A+ I    +W  N +V   F  M+ ++  Y F+ F++   +  IF    +PET  ++ ++I+  F+ 
Sbjct:   27 FGYNTGVINAPEKNIENFMKDVYKDRYGEDISEEFIQQLYSVAVSIFAIGGMLGGFSGGWMANRFGRKGGLLLNNVLGIAGACLMGFTKVSHSYEMLFLGRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLLSQVLGIEQILGTNEGWPILLGLAICPAILQLILLPVCPESPRYLLITKQWEEEARKALRRLRASGS--VEEDIEEMRAEERAQQSE-SHISTMELICSPTLRPPLIIGIVMQLSQQFSGINAVFYYSTSLFMSSGLTEESAKFATIGIGAIMVVMTLVSIPLMDRTGRRTLHLYGLGGMFIFSIFITISFLIKEMIDWMSYLSVVATLGFVVFFAVGPGSIPWMITAELFSQGPRPSAMAIAVLVNWMANFVVGIGFPSMKTALENYTFLPFSVFLAIFWIFTYKKVPETKNKTFEEILALFRH 472          
BLAST of slc2a-1 vs. Ensembl Fly
Match: Glut1 (gene:FBgn0264574 transcript:FBtr0333496)

HSP 1 Score: 310.457 bits (794), Expect = 1.413e-99
Identity = 166/449 (36.97%), Postives = 265/449 (59.02%), Query Frame = 2
Query:  149 YGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKR 1495
            +GYN   +N P + I++F  + Y  RYG  +S+  +  L+S  V+IF   G +G F  GW+A++ GRK  L+LNN L I G  L   +K     E++ +GRFIIG+NCGL   L  ++++EI+P ++RG +   +Q+ V  G+L +QV+G++ +LGT + W  LLG  I P IL   +LP CPESPRYL+++K  E+ AR  + +     S  +EE I +M+ E  A           +L  +  LR  L++GI + + QQ+SGINA+F YS SLF  +G+ + + ++  +G G + V++T V++PLMD+ GRR+L LY    M I  + +  S   +    W+S+LS+V  L ++V FA+G G IP M+ +E F QGPR +A+ I    +W  N +V   F  M+ ++  Y F+ F++   +  IF    +PET  ++ ++I+  F+ 
Sbjct:   27 FGYNTGVINAPEKNIENFMKDVYKDRYGEDISEEFIQQLYSVAVSIFAIGGMLGGFSGGWMANRFGRKGGLLLNNVLGIAGACLMGFTKVSHSYEMLFLGRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLLSQVLGIEQILGTNEGWPILLGLAICPAILQLILLPVCPESPRYLLITKQWEEEARKALRRLRASGS--VEEDIEEMRAEERAQQSE-SHISTMELICSPTLRPPLIIGIVMQLSQQFSGINAVFYYSTSLFMSSGLTEESAKFATIGIGAIMVVMTLVSIPLMDRTGRRTLHLYGLGGMFIFSIFITISFLIKEMIDWMSYLSVVATLGFVVFFAVGPGSIPWMITAELFSQGPRPSAMAIAVLVNWMANFVVGIGFPSMKTALENYTFLPFSVFLAIFWIFTYKKVPETKNKTFEEILALFRH 472          
BLAST of slc2a-1 vs. Ensembl Fly
Match: Glut1 (gene:FBgn0264574 transcript:FBtr0333497)

HSP 1 Score: 310.457 bits (794), Expect = 1.413e-99
Identity = 166/449 (36.97%), Postives = 265/449 (59.02%), Query Frame = 2
Query:  149 YGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKR 1495
            +GYN   +N P + I++F  + Y  RYG  +S+  +  L+S  V+IF   G +G F  GW+A++ GRK  L+LNN L I G  L   +K     E++ +GRFIIG+NCGL   L  ++++EI+P ++RG +   +Q+ V  G+L +QV+G++ +LGT + W  LLG  I P IL   +LP CPESPRYL+++K  E+ AR  + +     S  +EE I +M+ E  A           +L  +  LR  L++GI + + QQ+SGINA+F YS SLF  +G+ + + ++  +G G + V++T V++PLMD+ GRR+L LY    M I  + +  S   +    W+S+LS+V  L ++V FA+G G IP M+ +E F QGPR +A+ I    +W  N +V   F  M+ ++  Y F+ F++   +  IF    +PET  ++ ++I+  F+ 
Sbjct:   27 FGYNTGVINAPEKNIENFMKDVYKDRYGEDISEEFIQQLYSVAVSIFAIGGMLGGFSGGWMANRFGRKGGLLLNNVLGIAGACLMGFTKVSHSYEMLFLGRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLLSQVLGIEQILGTNEGWPILLGLAICPAILQLILLPVCPESPRYLLITKQWEEEARKALRRLRASGS--VEEDIEEMRAEERAQQSE-SHISTMELICSPTLRPPLIIGIVMQLSQQFSGINAVFYYSTSLFMSSGLTEESAKFATIGIGAIMVVMTLVSIPLMDRTGRRTLHLYGLGGMFIFSIFITISFLIKEMIDWMSYLSVVATLGFVVFFAVGPGSIPWMITAELFSQGPRPSAMAIAVLVNWMANFVVGIGFPSMKTALENYTFLPFSVFLAIFWIFTYKKVPETKNKTFEEILALFRH 472          
BLAST of slc2a-1 vs. Ensembl Fly
Match: Glut1 (gene:FBgn0264574 transcript:FBtr0333498)

HSP 1 Score: 310.071 bits (793), Expect = 3.586e-99
Identity = 166/449 (36.97%), Postives = 265/449 (59.02%), Query Frame = 2
Query:  149 YGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKR 1495
            +GYN   +N P + I++F  + Y  RYG  +S+  +  L+S  V+IF   G +G F  GW+A++ GRK  L+LNN L I G  L   +K     E++ +GRFIIG+NCGL   L  ++++EI+P ++RG +   +Q+ V  G+L +QV+G++ +LGT + W  LLG  I P IL   +LP CPESPRYL+++K  E+ AR  + +     S  +EE I +M+ E  A           +L  +  LR  L++GI + + QQ+SGINA+F YS SLF  +G+ + + ++  +G G + V++T V++PLMD+ GRR+L LY    M I  + +  S   +    W+S+LS+V  L ++V FA+G G IP M+ +E F QGPR +A+ I    +W  N +V   F  M+ ++  Y F+ F++   +  IF    +PET  ++ ++I+  F+ 
Sbjct:   27 FGYNTGVINAPEKNIENFMKDVYKDRYGEDISEEFIQQLYSVAVSIFAIGGMLGGFSGGWMANRFGRKGGLLLNNVLGIAGACLMGFTKVSHSYEMLFLGRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLLSQVLGIEQILGTNEGWPILLGLAICPAILQLILLPVCPESPRYLLITKQWEEEARKALRRLRASGS--VEEDIEEMRAEERAQQSE-SHISTMELICSPTLRPPLIIGIVMQLSQQFSGINAVFYYSTSLFMSSGLTEESAKFATIGIGAIMVVMTLVSIPLMDRTGRRTLHLYGLGGMFIFSIFITISFLIKEMIDWMSYLSVVATLGFVVFFAVGPGSIPWMITAELFSQGPRPSAMAIAVLVNWMANFVVGIGFPSMKTALENYTFLPFSVFLAIFWIFTYKKVPETKNKTFEEILALFRH 472          
BLAST of slc2a-1 vs. Ensembl Fly
Match: Glut1 (gene:FBgn0264574 transcript:FBtr0333499)

HSP 1 Score: 308.145 bits (788), Expect = 1.400e-98
Identity = 169/456 (37.06%), Postives = 267/456 (58.55%), Query Frame = 2
Query:  149 YGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPS------IGY-QHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKR 1495
            +GYN   +N P + I++F  + Y  RYG  +S+  +  L+S  V+IF   G +G F  GW+A++ GRK  L+LNN L I G  L   +K     E++ +GRFIIG+NCGL   L  ++++EI+P ++RG +   +Q+ V  G+L +QV+G++ +LGT + W  LLG  I P IL   +LP CPESPRYL+++K  E+ AR  + +     S  +EE I +M+ E  A           +L  +  LR  L++GI + + QQ+SGINA+F YS SLF  +G+ + + ++  +G G + V++T V++PLMD+ GRR+L LY    M I  + +  S       GY Q    W+S+LS+V  L ++V FA+G G IP M+ +E F QGPR +A+ I    +W  N +V   F  M+ ++  Y F+ F++   +  IF    +PET  ++ ++I+  F+ 
Sbjct:   27 FGYNTGVINAPEKNIENFMKDVYKDRYGEDISEEFIQQLYSVAVSIFAIGGMLGGFSGGWMANRFGRKGGLLLNNVLGIAGACLMGFTKVSHSYEMLFLGRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLLSQVLGIEQILGTNEGWPILLGLAICPAILQLILLPVCPESPRYLLITKQWEEEARKALRRLRASGS--VEEDIEEMRAEERAQQSE-SHISTMELICSPTLRPPLIIGIVMQLSQQFSGINAVFYYSTSLFMSSGLTEESAKFATIGIGAIMVVMTLVSIPLMDRTGRRTLHLYGLGGMFIFSIFITISFLIKEFFGYVQEMIDWMSYLSVVATLGFVVFFAVGPGSIPWMITAELFSQGPRPSAMAIAVLVNWMANFVVGIGFPSMKTALENYTFLPFSVFLAIFWIFTYKKVPETKNKTFEEILALFRH 479          
BLAST of slc2a-1 vs. Ensembl Zebrafish
Match: slc2a1b (solute carrier family 2 member 1b [Source:ZFIN;Acc:ZDB-GENE-090915-1])

HSP 1 Score: 342.043 bits (876), Expect = 1.145e-111
Identity = 176/474 (37.13%), Postives = 283/474 (59.70%), Query Frame = 2
Query:   89 QMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYH-----QKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKR 1495
            Q+T  L+L+  T  +GS   +GYN   +N P ++I+ F+NE++T R+G  +SK+ +  LWS +V IF   G VGSF  G   ++ GR+ S+++ N LA +   L   SK     E++++GRF++GL  GL+ G   +++ E++P ++RGA+   HQ+G+V GIL AQV G+++++G    W +LLGFT IP ++ C +LP CPESPR+L++++N+E  A+  ++K         +  E++E    M +E         K    +LFR+   R  +++ I L + QQ SGINAIF YS  +F +AGV++    Y  +G G+VN   T V+L ++++AGRRSL L   + M    +LM  +I    K+ W+S++SIV +  ++  F +G GPIP  + +E F QGPR +A  +    +W  N IV   F+++EE  G Y+F+IF +      IF    +PET GR+ D+I   F++
Sbjct:    6 QLTLPLMLAVGTAVIGS-LQFGYNTGVINAPQKIIEAFYNETWTARHGDMISKTTMTTLWSLSVAIFSVGGIVGSFSVGLFVNRFGRRNSMLMANVLAFIAAALMGFSKMAASWEMLIIGRFVVGLYSGLSTGFVPMYVGEVAPTALRGALGTLHQLGIVVGILMAQVFGMEAIMGNATMWPFLLGFTFIPALVQCCLLPICPESPRFLLINRNEESKAKSVLKKLRGTTDVSADMQEMKEESRQMMREK--------KVTIPELFRSPLYRQPIVIAIMLQLSQQLSGINAIFYYSTKIFEKAGVQQP--VYATIGAGVVNTAFTVVSLFVVERAGRRSLHLLGLLGMAGSAILMTIAIALLEKYDWMSYMSIVAIFAFVAFFEIGPGPIPWFIVAELFSQGPRPSAFAVAGFSNWTANFIVGMCFQYVEEVCGAYVFVIFTVFLLCFFIFTYFKVPETKGRTFDEISAGFRQ 468          
BLAST of slc2a-1 vs. Ensembl Zebrafish
Match: slc2a1a (solute carrier family 2 member 1a [Source:ZFIN;Acc:ZDB-GENE-030131-3158])

HSP 1 Score: 332.028 bits (850), Expect = 1.040e-107
Identity = 173/472 (36.65%), Postives = 278/472 (58.90%), Query Frame = 2
Query:   89 QMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYT--QLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRG 1498
            ++T  L+++  T  +GS   +GYN   +N P ++I+ F+NE++  RY   +  + L  LWS +V IF   G +GSF  G   ++ GR+ S+++ N LA +       SK     E++++GRFI+GL  GL+ G   +++ EI+P S+RGA+   HQ+G+V GIL AQ+ G+  ++G+   W ++LGFT IP +L C +LPFCPESPRYL++++N+E  A+  ++K         ++   DMQ+    S   + +   T  +LFR+   R  + + I L + QQ+SGINA+F YS  +F +AGV  S   Y  +G G VN   T V+L ++++ GRRSL L   M M +  +LM  ++    K  W+S++SIV +  ++  F +G GPIP  + +E F QGPR +A  +    +W  N +V   F+++EE  G Y+FIIF ++  +  +F    +PET GRS ++I   F+ G
Sbjct:    7 EVTPQLMMAVGTAVIGS-LQFGYNTGVINAPQKIIEGFYNETWHNRYSEYIPPTTLTTLWSVSVAIFSVGGILGSFSVGLFVNRFGRRNSMLIANILAFIAAAFMGFSKLAESWEMLIIGRFIVGLYSGLSTGFVPMYVGEIAPTSLRGALGTLHQLGIVIGILMAQIFGIKEIMGSPTLWPFMLGFTFIPAVLQCALLPFCPESPRYLLINQNEEAKAKSVLKKLRGT-----DDVGADMQEMRDESRQMMREKTVTIPELFRSSLYRQPIFIAIMLQLSQQFSGINAVFYYSTGIFEKAGV--SEPVYATIGAGAVNTAFTVVSLFIVERVGRRSLHLVGLMGMAVSSVLMTIAMALLTKVEWMSYVSIVAIFSFVAFFEIGPGPIPWFIVAELFSQGPRPSAFAVAGFSNWFANFLVGMCFQYVEELTGPYVFIIFTVLLLIFFVFTYFKVPETKGRSFEEITASFRTG 470          
BLAST of slc2a-1 vs. Ensembl Zebrafish
Match: slc2a1a (solute carrier family 2 member 1a [Source:ZFIN;Acc:ZDB-GENE-030131-3158])

HSP 1 Score: 332.028 bits (850), Expect = 1.040e-107
Identity = 173/472 (36.65%), Postives = 278/472 (58.90%), Query Frame = 2
Query:   89 QMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYT--QLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRG 1498
            ++T  L+++  T  +GS   +GYN   +N P ++I+ F+NE++  RY   +  + L  LWS +V IF   G +GSF  G   ++ GR+ S+++ N LA +       SK     E++++GRFI+GL  GL+ G   +++ EI+P S+RGA+   HQ+G+V GIL AQ+ G+  ++G+   W ++LGFT IP +L C +LPFCPESPRYL++++N+E  A+  ++K         ++   DMQ+    S   + +   T  +LFR+   R  + + I L + QQ+SGINA+F YS  +F +AGV  S   Y  +G G VN   T V+L ++++ GRRSL L   M M +  +LM  ++    K  W+S++SIV +  ++  F +G GPIP  + +E F QGPR +A  +    +W  N +V   F+++EE  G Y+FIIF ++  +  +F    +PET GRS ++I   F+ G
Sbjct:    7 EVTPQLMMAVGTAVIGS-LQFGYNTGVINAPQKIIEGFYNETWHNRYSEYIPPTTLTTLWSVSVAIFSVGGILGSFSVGLFVNRFGRRNSMLIANILAFIAAAFMGFSKLAESWEMLIIGRFIVGLYSGLSTGFVPMYVGEIAPTSLRGALGTLHQLGIVIGILMAQIFGIKEIMGSPTLWPFMLGFTFIPAVLQCALLPFCPESPRYLLINQNEEAKAKSVLKKLRGT-----DDVGADMQEMRDESRQMMREKTVTIPELFRSSLYRQPIFIAIMLQLSQQFSGINAVFYYSTGIFEKAGV--SEPVYATIGAGAVNTAFTVVSLFIVERVGRRSLHLVGLMGMAVSSVLMTIAMALLTKVEWMSYVSIVAIFSFVAFFEIGPGPIPWFIVAELFSQGPRPSAFAVAGFSNWFANFLVGMCFQYVEELTGPYVFIIFTVLLLIFFVFTYFKVPETKGRSFEEITASFRTG 470          
BLAST of slc2a-1 vs. Ensembl Zebrafish
Match: slc2a3a (solute carrier family 2 member 3a [Source:ZFIN;Acc:ZDB-GENE-040718-390])

HSP 1 Score: 331.257 bits (848), Expect = 1.309e-106
Identity = 196/469 (41.79%), Postives = 273/469 (58.21%), Query Frame = 2
Query:   89 QMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQ--KEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDF 1489
            Q+T +LL S  T  +GS   +GYN   +N P Q ++ FFN ++ +RYG P+S     I+WSF V IF   G  GSF  G +A+K GR++S++L N LA++GG L          E+I+ GR +IGL CGL  GL  +++ E+SP  +RGA    HQ+GVV GIL AQ+ GL+SLLG++K W  LL  TI+P IL CF+LPFCPESPRYL+++ N+E+ AR  + +         E+   DMQ  KE  A      K    +LFR+   R  L + I L + QQ SGINA+F YS  +F  AGV +    Y  +G G+VN + T V+L L+++AGRR+L L     M I  L M  ++        L +LSI  +  ++  F +G GPIP  + +E F QGPR AA+ +    +W  N IV  +F  +EE  G Y+FIIF I   +  IF    +PET GR+ D+I   F
Sbjct:    7 QVTCYLLFSLSTAVIGS-LQFGYNTGVINAPEQKLRAFFNATWMERYGEPISPGVCTIVWSFAVAIFSVGGMAGSFSVGVVANKFGRRKSMILVNVLALIGGGLMGLCTLCSSFEMIIAGRLMIGLFCGLFTGLTPMYVGEVSPTPLRGAFGTLHQLGVVVGILIAQIFGLESLLGSDKLWPILLALTILPAILQCFLLPFCPESPRYLLINLNEEEQARKALVRLRG-----YEDVGKDMQEMKEESAKMAMEKKVTIPELFRSAAYRQPLFIAIMLQLSQQLSGINAVFYYSTGIFKSAGVTQPI--YATIGAGVVNTVFTVVSLFLVERAGRRTLHLIGLGGMAISALAMTIAL-LLKDIEALQYLSIAAIFAFVAMFEMGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTANFIVGITFPKLEELCGPYVFIIFMIFLIIFFIFTYFKVPETKGRTFDEIARGF 466          
BLAST of slc2a-1 vs. Ensembl Zebrafish
Match: slc2a3a (solute carrier family 2 member 3a [Source:ZFIN;Acc:ZDB-GENE-040718-390])

HSP 1 Score: 330.487 bits (846), Expect = 1.640e-106
Identity = 196/469 (41.79%), Postives = 273/469 (58.21%), Query Frame = 2
Query:   89 QMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQ--KEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDF 1489
            Q+T +LL S  T  +GS   +GYN   +N P Q ++ FFN ++ +RYG P+S     I+WSF V IF   G  GSF  G +A+K GR++S++L N LA++GG L          E+I+ GR +IGL CGL  GL  +++ E+SP  +RGA    HQ+GVV GIL AQ+ GL+SLLG++K W  LL  TI+P IL CF+LPFCPESPRYL+++ N+E+ AR  + +         E+   DMQ  KE  A      K    +LFR+   R  L + I L + QQ SGINA+F YS  +F  AGV +    Y  +G G+VN + T V+L L+++AGRR+L L     M I  L M  ++        L +LSI  +  ++  F +G GPIP  + +E F QGPR AA+ +    +W  N IV  +F  +EE  G Y+FIIF I   +  IF    +PET GR+ D+I   F
Sbjct:    7 QVTCYLLFSLSTAVIGS-LQFGYNTGVINAPEQKLRAFFNATWMERYGEPISPGVCTIVWSFAVAIFSVGGMAGSFSVGVVANKFGRRKSMILVNVLALIGGGLMGLCTLCSSFEMIIAGRLMIGLFCGLFTGLTPMYVGEVSPTPLRGAFGTLHQLGVVVGILIAQIFGLESLLGSDKLWPILLALTILPAILQCFLLPFCPESPRYLLINLNEEEQARKALVRLRG-----YEDVGKDMQEMKEESAKMAMEKKVTIPELFRSAAYRQPLFIAIMLQLSQQLSGINAVFYYSTGIFKSAGVTQPI--YATIGAGVVNTVFTVVSLFLVERAGRRTLHLIGLGGMAISALAMTIAL-LLKDIEALQYLSIAAIFAFVAMFEMGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTANFIVGITFPKLEELCGPYVFIIFMIFLIIFFIFTYFKVPETKGRTFDEIARGF 466          
BLAST of slc2a-1 vs. Ensembl Xenopus
Match: slc2a5 (solute carrier family 2 member 5 [Source:NCBI gene;Acc:493549])

HSP 1 Score: 323.553 bits (828), Expect = 6.617e-104
Identity = 176/478 (36.82%), Postives = 280/478 (58.58%), Query Frame = 2
Query:   47 SSAEYMKFSDIKMFQMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYP-SMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDI 1477
            +S E  +  D +  ++T  L+L ++    GSSF YGYNVA +N+P+  ++DF+N +  +R GSPL  + L +LWS TV+++   G  GS + G +  K+GRK +L+ NN  +I+  +L   S      E+I+  R  +G+  GL+  +  +++ E+SP+++RGA+    Q+ +  GIL AQ+ G+  +LG  + W  LL  T IP +L    LPF PESPRY +L K +E  A+  +++   +   +++  I +M +E   S  A G+     L   R LR  L+  I + + QQ SGINA++ Y++S++  AGVK+  IQYV V TG VNVL+T   + ++D  GRR LLL       I C++L I ++ YQ    W+ +LSI  ++ Y++G A+G  PIP ++ +E FRQ  R AA  I  + HW  N I+   F F+   +G Y FI+FA IC  + IF+ + +PET G++  ++
Sbjct:    2 ASQEKKEEPDERKGRLTATLILVTLVATFGSSFQYGYNVASVNSPSPFMKDFYNSTNIERVGSPLEDAFLTLLWSLTVSLYPLGGFFGSLLVGPLVSKLGRKGTLLFNNIFSIIPAILMGTSVVAKTFEVIIASRLFVGVCAGLSSNVVPMYVGEMSPKNLRGAIGIMPQLMITVGILMAQIFGIRYILGNTEGWPILLALTGIPAVLELAFLPFFPESPRYTLLHKGNEDKAKKALQRL--RGWEDVDSEIKEMYQED-QSEKAEGQLSVRNLCTFRPLRWQLISIIVMNMGQQLSGINAVYYYADSIYKSAGVKEETIQYVTVATGSVNVLMTLAAVFIVDSWGRRVLLLSGFGTCCISCVVLTI-ALVYQTTVSWMPYLSIACIIIYVIGHAIGPSPIPYVITTEMFRQASRPAAFMIAGSVHWLSNFIIGLIFEFLMNGLGAYCFILFAAICLATFIFIYIVVPETKGKTFLEV 475          
BLAST of slc2a-1 vs. Ensembl Xenopus
Match: slc2a5 (solute carrier family 2 member 5 [Source:NCBI gene;Acc:493549])

HSP 1 Score: 322.013 bits (824), Expect = 2.727e-103
Identity = 173/468 (36.97%), Postives = 277/468 (59.19%), Query Frame = 2
Query:   77 IKMFQMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYP-SMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDI 1477
            +++ ++T  L+L ++    GSSF YGYNVA +N+P+  ++DF+N +  +R GSPL  + L +LWS TV+++   G  GS + G +  K+GRK +L+ NN  +I+  +L   S      E+I+  R  +G+  GL+  +  +++ E+SP+++RGA+    Q+ +  GIL AQ+ G+  +LG  + W  LL  T IP +L    LPF PESPRY +L K +E  A+  +++   +   +++  I +M +E   S  A G+     L   R LR  L+  I + + QQ SGINA++ Y++S++  AGVK+  IQYV V TG VNVL+T   + ++D  GRR LLL       I C++L I ++ YQ    W+ +LSI  ++ Y++G A+G  PIP ++ +E FRQ  R AA  I  + HW  N I+   F F+   +G Y FI+FA IC  + IF+ + +PET G++  ++
Sbjct:   15 LRILRLTATLILVTLVATFGSSFQYGYNVASVNSPSPFMKDFYNSTNIERVGSPLEDAFLTLLWSLTVSLYPLGGFFGSLLVGPLVSKLGRKGTLLFNNIFSIIPAILMGTSVVAKTFEVIIASRLFVGVCAGLSSNVVPMYVGEMSPKNLRGAIGIMPQLMITVGILMAQIFGIRYILGNTEGWPILLALTGIPAVLELAFLPFFPESPRYTLLHKGNEDKAKKALQRL--RGWEDVDSEIKEMYQED-QSEKAEGQLSVRNLCTFRPLRWQLISIIVMNMGQQLSGINAVYYYADSIYKSAGVKEETIQYVTVATGSVNVLMTLAAVFIVDSWGRRVLLLSGFGTCCISCVVLTI-ALVYQTTVSWMPYLSIACIIIYVIGHAIGPSPIPYVITTEMFRQASRPAAFMIAGSVHWLSNFIIGLIFEFLMNGLGAYCFILFAAICLATFIFIYIVVPETKGKTFLEV 478          
BLAST of slc2a-1 vs. Ensembl Xenopus
Match: dnajc28 (DnaJ heat shock protein family (Hsp40) member C28 [Source:Xenbase;Acc:XB-GENE-975324])

HSP 1 Score: 316.62 bits (810), Expect = 1.650e-101
Identity = 173/471 (36.73%), Postives = 281/471 (59.66%), Query Frame = 2
Query:  107 LLSSITVALGSSFLYGYNVAKLNTPTQMIQDF-FNESY----TKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRGYL 1504
            L+ ++  A+ +S  +GY +  +N P ++I+   +N+S      + Y +P+ +S + + WS +V++F   G V SF  GWIADK+GR +++++ N LA++G LL   +       L++ GR I GL CGL  GL  +++ EISP ++RGA+   HQ+ +V GIL +QV+GL+ +LG+E  W  LLG + +P ++   +L FCPESPR+L++     +AA+ N+ K   +  P  +      +KE   S   +      QLF++   R  L+V + L I QQ+SGIN IF YS S+FT+AG+  S   Y  +G G VN + T V++ L++KAGRRSL L     M IC ++M  ++    +  W+S+LS+V +  ++V F +G GPIP  + +E F QGPR AA+ +    +W  N I+   F ++ ++ G Y+FIIFA++  +  +F    +PET G+S D+I  +F++  L
Sbjct:   10 LVFAVFTAVLASLQFGYGIGVINAPQKVIKRIPYNKSLKVKNARNYTTPV-QSSVKMYWSLSVSVFSLGGMVSSFFVGWIADKLGRIKAMMVVNILAVIGALLMGLAPLGQAHALVIAGRLITGLYCGLASGLVPMYVGEISPTALRGALGTLHQLAIVTGILISQVVGLEFILGSEHLWPVLLGLSGVPAVVQTILLFFCPESPRFLLIKLGKTEAAKRNLIKLRGEYDPTKDIEEMKKEKEEAESEKKV---SIIQLFKSSNYRQPLVVSLVLHISQQFSGINGIFYYSTSIFTRAGI--SQPVYATIGVGAVNTVFTVVSVFLVEKAGRRSLYLVGLGGMCICAIVMTIALALLTQHAWMSYLSLVAIFLFVVFFEVGPGPIPWFIVAELFSQGPRPAAMAVSGCCNWTCNFIIGMCFEYIADACGPYIFIIFAVLLLIFTVFTYFKVPETKGKSFDEIAAEFRKKKL 474          
BLAST of slc2a-1 vs. Ensembl Xenopus
Match: dnajc28 (DnaJ heat shock protein family (Hsp40) member C28 [Source:Xenbase;Acc:XB-GENE-975324])

HSP 1 Score: 316.235 bits (809), Expect = 2.719e-101
Identity = 176/484 (36.36%), Postives = 282/484 (58.26%), Query Frame = 2
Query:   74 DIKMFQ---MTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFN----ESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRGYL 1504
            D KM Q   +T  L+ +  T  L +S  +GY +  +N P ++I++ +     E    +  +   +S + + WS +V++F   G V SF  GWIADK+GR +++++ N LA++G LL   +       L++ GR I GL CGL  GL  +++ EISP ++RGA+   HQ+ +V GIL +QV+GL+ +LG+E  W  LLG + +P ++   +L FCPESPR+L++     +AA+ N+ K   +  P  +      +KE   S   +      QLF++   R  L+V + L I QQ+SGIN IF YS S+FT+AG+  S   Y  +G G VN + T V++ L++KAGRRSL L     M IC ++M  ++    +  W+S+LS+V +  ++V F +G GPIP  + +E F QGPR AA+ +    +W  N I+   F ++ ++ G Y+FIIFA++  +  +F    +PET G+S D+I  +F++  L
Sbjct:    2 DGKMKQQKNLTGTLVFAVFTAVL-ASLQFGYGIGVINAPQKIIENHYTRVLLEGSENQTDTTPVQSSVKMYWSLSVSVFSLGGMVSSFFVGWIADKLGRIKAMMVVNILAVIGALLMGLAPLGQAHALVIAGRLITGLYCGLASGLVPMYVGEISPTALRGALGTLHQLAIVTGILISQVVGLEFILGSEHLWPVLLGLSGVPAVVQTILLFFCPESPRFLLIKLGKTEAAKRNLIKLRGEYDPTKDIEEMKKEKEEAESEKKV---SIIQLFKSSNYRQPLVVSLVLHISQQFSGINGIFYYSTSIFTRAGI--SQPVYATIGVGAVNTVFTVVSVFLVEKAGRRSLYLVGLGGMCICAIVMTIALALLTQHAWMSYLSLVAIFLFVVFFEVGPGPIPWFIVAELFSQGPRPAAMAVSGCCNWTCNFIIGMCFEYIADACGPYIFIIFAVLLLIFTVFTYFKVPETKGKSFDEIAAEFRKKKL 479          
BLAST of slc2a-1 vs. Ensembl Xenopus
Match: dnajc28 (DnaJ heat shock protein family (Hsp40) member C28 [Source:Xenbase;Acc:XB-GENE-975324])

HSP 1 Score: 316.235 bits (809), Expect = 5.088e-101
Identity = 174/480 (36.25%), Postives = 281/480 (58.54%), Query Frame = 2
Query:   74 DIKMF--QMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFN----ESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKR 1495
            D KM+   +T  L+ +  T  L +S  +GY +  +N P ++I++ +     E    +  +   +S + + WS +V++F   G V SF  GWIADK+GR +++++ N LA++G LL   +       L++ GR I GL CGL  GL  +++ EISP ++RGA+   HQ+ +V GIL +QV+GL+ +LG+E  W  LLG + +P ++   +L FCPESPR+L++     +AA+ N+ K   +  P  +      +KE   S   +      QLF++   R  L+V + L I QQ+SGIN IF YS S+FT+AG+  S   Y  +G G VN + T V++ L++KAGRRSL L     M IC ++M  ++    +  W+S+LS+V +  ++V F +G GPIP  + +E F QGPR AA+ +    +W  N I+   F ++ ++ G Y+FIIFA++  +  +F    +PET G+S D+I  +F++
Sbjct:   21 DNKMYYINLTGTLVFAVFTAVL-ASLQFGYGIGVINAPQKIIENHYTRVLLEGSENQTDTTPVQSSVKMYWSLSVSVFSLGGMVSSFFVGWIADKLGRIKAMMVVNILAVIGALLMGLAPLGQAHALVIAGRLITGLYCGLASGLVPMYVGEISPTALRGALGTLHQLAIVTGILISQVVGLEFILGSEHLWPVLLGLSGVPAVVQTILLFFCPESPRFLLIKLGKTEAAKRNLIKLRGEYDPTKDIEEMKKEKEEAESEKKV---SIIQLFKSSNYRQPLVVSLVLHISQQFSGINGIFYYSTSIFTRAGI--SQPVYATIGVGAVNTVFTVVSVFLVEKAGRRSLYLVGLGGMCICAIVMTIALALLTQHAWMSYLSLVAIFLFVVFFEVGPGPIPWFIVAELFSQGPRPAAMAVSGCCNWTCNFIIGMCFEYIADACGPYIFIIFAVLLLIFTVFTYFKVPETKGKSFDEIAAEFRK 494          
BLAST of slc2a-1 vs. Ensembl Mouse
Match: Slc2a1 (solute carrier family 2 (facilitated glucose transporter), member 1 [Source:MGI Symbol;Acc:MGI:95755])

HSP 1 Score: 355.91 bits (912), Expect = 5.455e-117
Identity = 183/475 (38.53%), Postives = 287/475 (60.42%), Query Frame = 2
Query:   89 QMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYH-----QKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRG 1498
            ++T  L+L+     LGS   +GYN   +N P ++I++F+N+++  RYG P+  + L  LWS +V IF   G +GSF  G   ++ GR+ S+++ N LA V  +L   SK     E++++GRFIIG+ CGLT G   +++ E+SP ++RGA+   HQ+G+V GIL AQV GLDS++G    W  LL    IP +L C +LPFCPESPR+L++++N+E  A+  ++K        ++  E++E    M +E         K    +LFR+   R  +L+ + L + QQ SGINA+F YS S+F +AGV++    Y  +G+G+VN   T V+L ++++AGRR+L L     M  C +LM  ++    + PW+S+LSIV +  ++  F +G GPIP  + +E F QGPR AA+ +    +W  N IV   F+++E+  G Y+FIIF ++  L  IF    +PET GR+ D+I   F++G
Sbjct:    7 KVTGRLMLAVGGAVLGS-LQFGYNTGVINAPQKVIEEFYNQTWNHRYGEPIPSTTLTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVAAVLMGFSKLGKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIMGNADLWPLLLSVIFIPALLQCILLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTRDLQEMKEEGRQMMREK--------KVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEKAGVQQP--VYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAVLMTIALALLERLPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQG 470          
BLAST of slc2a-1 vs. Ensembl Mouse
Match: Slc2a5 (solute carrier family 2 (facilitated glucose transporter), member 5 [Source:MGI Symbol;Acc:MGI:1928369])

HSP 1 Score: 317.39 bits (812), Expect = 7.390e-102
Identity = 174/450 (38.67%), Postives = 269/450 (59.78%), Query Frame = 2
Query:  128 ALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDI 1477
            A GSSF YGYNVA +N+P++ +Q F+N++Y  R    +    L +LWS TV++F   G +GS + G + +K+GRK +L+ NN  +I+  +L   S+     ELI++ R ++G+  G++  +  ++L E++P+++RGA+    Q+ +  GIL AQ+ GL SLL  E  W  LLG T +P  L   +LPF PESPRYL++ K DE AA   ++         LE  + +++KE  A   A G     +LF  + LR  L+  I LM  QQ SG+NAI+ Y++ ++  AGVK  ++QYV  GTG VNV +T + + +++  GRR LLL      +I  L++  ++  Q+   W+ ++SIV ++ Y++G ALG  PIP +L +E F Q  R AA  I  + HW  N  V   F F++  +G Y FIIFA IC L+ I++ + +PET GR+  +I
Sbjct:   24 AFGSSFQYGYNVAAVNSPSEFMQQFYNDTYYDRNEENIESFTLTLLWSLTVSMFPFGGFIGSLMVGTLVNKLGRKGALLFNNIFSILPAILMGCSQIAQSFELIIISRLLVGICAGISSNVVPMYLGELAPKNLRGALGVVPQLFITVGILVAQLFGLRSLLANEDGWPVLLGLTGVPAGLQLLLLPFFPESPRYLLIQKKDEAAAERALQTLRGWKDVHLE--MEEIRKEDEAE-KAAGFISVWKLFTMQSLRWQLISMIVLMAGQQLSGVNAIYYYADQIYLSAGVKSDDVQYVTAGTGAVNVFMTILTIFVVELWGRRFLLLVGFSTCLIACLVLTAALALQNTISWMPYISIVCVIVYVIGHALGPSPIPALLITEIFLQSSRPAAYMIGGSVHWLSNFTVGLIFPFIQMGLGPYSFIIFATICFLTTIYIFMVVPETKGRTFIEI 470          
BLAST of slc2a-1 vs. Ensembl Mouse
Match: Slc2a3 (solute carrier family 2 (facilitated glucose transporter), member 3 [Source:MGI Symbol;Acc:MGI:95757])

HSP 1 Score: 310.842 bits (795), Expect = 2.343e-99
Identity = 174/462 (37.66%), Postives = 267/462 (57.79%), Query Frame = 2
Query:  107 LLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFK 1492
            L+ ++TVA   SF +GYN   +N P  +++DF N +  +R     S+  L  LWS  V IF   G +GSF  G   ++ GR+ S++L N LAI+ G L   +K     E++++GR +IG+ CGL  G   +++ E+SP ++RGA    +Q+G+V GIL AQ+ GLD +LG+E+ W  LLG TIIP IL    LPFCPESPR+L+++K +E  A   +++     + ++ + I +M+ E    +    +    +LFR+      LL+ I L + QQ SGINA+F YS  +F  AGV++    Y  +G G+VN + T V+L L+++AGRR+L +     M +C + M  S+  +  +  +S + IV +L Y+  F +G GPIP  + +E F QGPR AA+ +    +W  N +V   F      +G Y+FIIFA      LIF    +PET GR+ +DI   F+
Sbjct:   10 LVFAVTVATIGSFQFGYNTGVINAPETILKDFLNYTLEERLEDLPSEGLLTALWSLCVAIFSVGGMIGSFSVGLFVNRFGRRNSMLLVNLLAIIAGCLMGFAKIAESVEMLILGRLLIGIFCGLCTGFVPMYIGEVSPTALRGAFGTLNQLGIVVGILVAQIFGLDFILGSEELWPGLLGLTIIPAILQSAALPFCPESPRFLLINKKEEDQATEILQRLW--GTSDVVQEIQEMKDESVRMSQE-KQVTVLELFRSPNYVQPLLISIVLQLSQQLSGINAVFYYSTGIFKDAGVQEP--IYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAVCSVFMTISLLLKDDYEAMSFVCIVAILIYVAFFEIGPGPIPWFIVAELFSQGPRPAAIAVAGCCNWTSNFLVGMLFPSAAAYLGAYVFIIFAAFLIFFLIFTFFKVPETKGRTFEDIARAFE 466          
BLAST of slc2a-1 vs. Ensembl Mouse
Match: Slc2a7 (solute carrier family 2 (facilitated glucose transporter), member 7 [Source:MGI Symbol;Acc:MGI:3650865])

HSP 1 Score: 307.375 bits (786), Expect = 1.219e-97
Identity = 170/487 (34.91%), Postives = 282/487 (57.91%), Query Frame = 2
Query:  104 LLLSSITVALGSSFLYGYNVAKLNTPT------------QMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDF-KRGYLWIPFRKK 1525
            L+L++++ A GS F YGYN+A +NTP             Q+++ F+N+++ +R+G+ + +S L +LWS TV++F   G +GS + G + +K GRK +L++NN  AI   +L   SK     ELI++ R ++G+  G+      ++L E++PQ++RGA+    +V V+ G+L AQ+  L ++LG    W  LL  T +P ++    LPF PESPRY ++ K DE+ AR  + +   +N     EA  +  +    +  A G+     LF  R LR  L+  + LM  QQ SGINA+  Y++ ++T AGV  +  QYV +G+G++N+++T V+  ++++ GRR LLL    +     L++  ++  Q   P LS+LSIV +  YIVG ++G  P+P ++ +E   Q  R AA  +  A HW  N IV  +F  ++ +IG Y F++FA +C L+  ++ + +PET GR+  +I   F KR  +  P  K+
Sbjct:   23 LVLTTLSAAFGSVFQYGYNIAVINTPHKVGTSNRWGPVFQVLKSFYNDTHFERHGTFMDESTLLLLWSCTVSMFPLGGLLGSLVVGLMVNKWGRKGTLLINNVFAITSAVLMGVSKVARAFELIILSRVLVGICAGIAYSTLPMYLGELAPQNLRGALGTMTEVFVIIGVLLAQIFSLQAILGNATGWPILLALTGVPAVIQLLSLPFFPESPRYTLIEKGDEETARQALRRLRGQNYN--VEAEMEEMRTEERTEQAEGRLSVLNLFTFRPLRWQLISIVVLMAGQQLSGINAVNYYADVIYTSAGVDPTQSQYVTLGSGVINLVMTLVSAVIIERLGRRILLLSGYAICCSACLVLTVALLLQSTAPELSYLSIVCVFSYIVGHSIGPSPVPSVVRTEIVLQSSRTAAFTVDGAVHWLTNFIVGLTFPSIQVAIGAYSFLVFAGVCILTAAYIYVVIPETKGRTFVEINCAFAKRNGVEFPEEKE 507          
BLAST of slc2a-1 vs. Ensembl Mouse
Match: Slc2a4 (solute carrier family 2 (facilitated glucose transporter), member 4 [Source:MGI Symbol;Acc:MGI:95758])

HSP 1 Score: 296.975 bits (759), Expect = 6.707e-94
Identity = 171/473 (36.15%), Postives = 281/473 (59.41%), Query Frame = 2
Query:   89 QMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYG----SPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKR 1495
            ++T  L+L+  +  LGS   +GYN+  +N P ++I+  +N ++  R G      + +  L  LW+ +V IF   G + SF+ G I+  +GRKR+++ NN LA++GG L   +      E++++GRF+IG   GLT GL  +++ EI+P  +RGA+   +Q+ +V GIL AQV+GL+S+LGT   W  LL  T++P +L   +LPFCPESPRYL + +N E  AR ++++       ++ +A+ +++ E     +        QL  +R  R  L++ + L + QQ SGINA+F YS S+F  AGV +    Y  +G G+VN + T V++ L+++AGRR+L L     M  C +LM  ++    + P +S++SIV +  ++  F +G GPIP  + +E F QGPR AA+ +    +W  N IV   F+++ +++G Y+F++FA++     IF  L +PET GR+ D I   F+R
Sbjct:   19 RVTGTLVLAVFSAVLGS-LQFGYNIGVINAPQKVIEQSYNATWLGRQGPGGPDSIPQGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLANNVLAVLGGALMGLANAAASYEILILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAIVIGILVAQVLGLESMLGTATLWPLLLALTVLPALLQLILLPFCPESPRYLYIIRNLEGPARKSLKRL--TGWADVSDALAELKDEK-RKLERERPMSLLQLLGSRTHRQPLIIAVVLQLSQQLSGINAVFYYSTSIFESAGVGQP--AYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGMCGCAILMTVALLLLERVPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGFSNWTCNFIVGMGFQYVADAMGPYVFLLFAVLLLGFFIFTFLKVPETRGRTFDQISAAFRR 485          
BLAST of slc2a-1 vs. UniProt/SwissProt
Match: sp|P27674|GTR1_BOVIN (Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus OX=9913 GN=SLC2A1 PE=1 SV=1)

HSP 1 Score: 358.221 bits (918), Expect = 6.235e-117
Identity = 183/475 (38.53%), Postives = 289/475 (60.84%), Query Frame = 2
Query:   89 QMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYH-----QKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRG 1498
            ++T  L+L+     LGS   +GYN   +N P ++I++F+N+++ +RYG P+  + L  LWS +V IF   G +GSF  G   ++ GR+ S+++ N LA V  +L   SK     E++++GRFIIG+ CGLT G   +++ E+SP  +RGA+   HQ+G+V GIL AQV GLDS++G ++ W  LL    IP +L C +LPFCPESPR+L++++N+E  A+  ++K        ++  E++E    M +E         K    +LFR+   R  +L+ + L + QQ SGINA+F YS S+F +AGV++    Y  +G+G+VN   T V+L ++++AGRR+L L     M  C +LM  ++    + PW+S+LSIV +  ++  F +G GPIP  + +E F QGPR AA+ +    +W  N IV   F+++E+  G Y+FIIF ++  L  IF    +PET GR+ D+I   F++G
Sbjct:    7 KLTGRLMLAVGGAVLGS-LQFGYNTGVINAPQKVIEEFYNQTWVQRYGEPIPPATLTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTELRGALGTLHQLGIVVGILIAQVFGLDSIMGNQELWPLLLSVIFIPALLQCILLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTRDLQEMKEESRQMMREK--------KVTILELFRSAAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEKAGVQQP--VYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAVLMTIALALLERLPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQG 470          
BLAST of slc2a-1 vs. UniProt/SwissProt
Match: sp|P79365|GTR1_SHEEP (Solute carrier family 2, facilitated glucose transporter member 1 OS=Ovis aries OX=9940 GN=SLC2A1 PE=2 SV=2)

HSP 1 Score: 357.451 bits (916), Expect = 1.104e-116
Identity = 183/475 (38.53%), Postives = 289/475 (60.84%), Query Frame = 2
Query:   89 QMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYH-----QKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRG 1498
            ++T  L+L+     LGS   +GYN   +N P ++I++F+N+++ +RYG P+  + L  LWS +V IF   G +GSF  G   ++ GR+ S+++ N LA V  +L   SK     E++++GRFIIG+ CGLT G   +++ E+SP  +RGA+   HQ+G+V GIL AQV GLDS++G ++ W  LL    IP +L C +LPFCPESPR+L++++N+E  A+  ++K        ++  E++E    M +E         K    +LFR+   R  +L+ + L + QQ SGINA+F YS S+F +AGV++    Y  +G+G+VN   T V+L ++++AGRR+L L     M  C +LM  ++    + PW+S+LSIV +  ++  F +G GPIP  + +E F QGPR AA+ +    +W  N IV   F+++E+  G Y+FIIF ++  L  IF    +PET GR+ D+I   F++G
Sbjct:    7 KLTGRLMLAVGGAVLGS-LQFGYNTGVINAPQKVIEEFYNQTWMQRYGEPIPPATLTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTELRGALGTLHQLGIVVGILIAQVFGLDSIMGNQELWPLLLSVIFIPALLQCILLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTRDLQEMKEESRQMMREK--------KVTILELFRSAAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEKAGVQQP--VYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAVLMTIALALLEQLPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQG 470          
BLAST of slc2a-1 vs. UniProt/SwissProt
Match: sp|P20303|GTR1_PIG (Solute carrier family 2, facilitated glucose transporter member 1 OS=Sus scrofa OX=9823 GN=SLC2A1 PE=2 SV=2)

HSP 1 Score: 356.295 bits (913), Expect = 3.463e-116
Identity = 183/475 (38.53%), Postives = 289/475 (60.84%), Query Frame = 2
Query:   89 QMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYH-----QKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRG 1498
            ++T  L+L+     LGS   +GYN   +N P ++I++F+N+++  RYG  +S + L  LWS +V IF   G +GSF  G   ++ GR+ S+++ N LA +  +L   SK     E++++GRFIIG+ CGLT G   +++ E+SP ++RGA+   HQ+G+V GIL AQV GLDS++G E+ W  LL    IP +L C +LPFCPESPR+L++++N+E  A+  ++K        ++  E++E    M +E         K    +LFR+   R  +L+ + L + QQ SGINA+F YS S+F +AGV++    Y  +G+G+VN   T V+L ++++AGRR+L L     M  C +LM  ++    + PW+S+LSIV +  ++  F +G GPIP  + +E F QGPR AA+ +    +W  N IV   F+++E+  G Y+FIIF ++  L  IF    +PET GR+ D+I   F++G
Sbjct:    7 KLTGRLMLAVGGAVLGS-LQFGYNTGVINAPQKVIEEFYNQTWLHRYGESISPATLTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFISAVLMGFSKLGKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIMGNEELWPLLLSVIFIPALLQCVLLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTRDLQEMKEESRQMMREK--------KVTILELFRSAAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEKAGVQQP--VYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAVLMTIALALLEQLPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQG 470          
BLAST of slc2a-1 vs. UniProt/SwissProt
Match: sp|P17809|GTR1_MOUSE (Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus OX=10090 GN=Slc2a1 PE=1 SV=4)

HSP 1 Score: 355.91 bits (912), Expect = 3.816e-116
Identity = 183/475 (38.53%), Postives = 287/475 (60.42%), Query Frame = 2
Query:   89 QMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYH-----QKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRG 1498
            ++T  L+L+     LGS   +GYN   +N P ++I++F+N+++  RYG P+  + L  LWS +V IF   G +GSF  G   ++ GR+ S+++ N LA V  +L   SK     E++++GRFIIG+ CGLT G   +++ E+SP ++RGA+   HQ+G+V GIL AQV GLDS++G    W  LL    IP +L C +LPFCPESPR+L++++N+E  A+  ++K        ++  E++E    M +E         K    +LFR+   R  +L+ + L + QQ SGINA+F YS S+F +AGV++    Y  +G+G+VN   T V+L ++++AGRR+L L     M  C +LM  ++    + PW+S+LSIV +  ++  F +G GPIP  + +E F QGPR AA+ +    +W  N IV   F+++E+  G Y+FIIF ++  L  IF    +PET GR+ D+I   F++G
Sbjct:    7 KVTGRLMLAVGGAVLGS-LQFGYNTGVINAPQKVIEEFYNQTWNHRYGEPIPSTTLTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVAAVLMGFSKLGKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIMGNADLWPLLLSVIFIPALLQCILLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTRDLQEMKEEGRQMMREK--------KVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEKAGVQQP--VYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAVLMTIALALLERLPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQG 470          
BLAST of slc2a-1 vs. UniProt/SwissProt
Match: sp|P46896|GTR1_CHICK (Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus OX=9031 GN=SLC2A1 PE=2 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 2.937e-115
Identity = 184/475 (38.74%), Postives = 286/475 (60.21%), Query Frame = 2
Query:   89 QMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYH-----QKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRG 1498
            +MT  L+L+     LGS   +GYN   +N P ++I+DF+N ++  RY  P+S + L  LWS +V IF   G +GSF  G   ++ GR+ S++++N LA +  +L   SK  +  E++++GRFIIGL  GLT G   +++ E+SP ++RGA+  FHQ+G+V GIL AQV GLD ++G +  W  LLGF  +P +L C ILPF PESPR+L++++N+E  A+  ++K         +  E++E    M +E         K    +LFR+   R  +L+ I L + QQ SGINA+F YS S+F ++GV++    Y  +G+G+VN   T V+L ++++AGRR+L L     M  C +LM  ++    + PW+S+LSIV +  ++  F +G GPIP  + +E F QGPR AA  +    +W  N IV   F+++ +  G Y+FIIF ++  L  IF    +PET GR+ D+I   F++G
Sbjct:    6 KMTARLMLAVGGAVLGS-LQFGYNTGVINRPQKVIEDFYNHTWLYRYEEPISPATLTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMSNILAFLAAVLMGFSKMALSFEMLILGRFIIGLYSGLTTGFVPMYVGEVSPTALRGALGTFHQLGIVLGILIAQVFGLDLIMGNDSLWPLLLGFIFVPALLQCIILPFAPESPRFLLINRNEENKAKSVLKKLRGTTDVSSDLQEMKEESRQMMREK--------KVTIMELFRSPMYRQPILIAIVLQLSQQLSGINAVFYYSTSIFEKSGVEQP--VYATIGSGVVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAILMTIALTLLDQMPWMSYLSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAFAVAGLSNWTSNFIVGMGFQYIAQLCGSYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIAYRFRQG 469          
BLAST of slc2a-1 vs. TrEMBL
Match: A0A0H3YIQ8 (Slc2a-1 OS=Schmidtea mediterranea OX=79327 GN=slc2a-1 PE=2 SV=1)

HSP 1 Score: 1058.13 bits (2735), Expect = 0.000e+0
Identity = 517/517 (100.00%), Postives = 517/517 (100.00%), Query Frame = 2
Query:   62 MKFSDIKMFQMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRGYLWIPFRKKPYYIYANEVIAANKALYQTGGANVTLEIE 1612
            MKFSDIKMFQMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRGYLWIPFRKKPYYIYANEVIAANKALYQTGGANVTLEIE
Sbjct:    1 MKFSDIKMFQMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRGYLWIPFRKKPYYIYANEVIAANKALYQTGGANVTLEIE 517          
BLAST of slc2a-1 vs. TrEMBL
Match: A0A1S3JNR3 (solute carrier family 2, facilitated glucose transporter member 1 OS=Lingula unguis OX=7574 GN=LOC106174851 PE=3 SV=1)

HSP 1 Score: 414.461 bits (1064), Expect = 1.789e-136
Identity = 189/467 (40.47%), Postives = 303/467 (64.88%), Query Frame = 2
Query:   92 MTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFK 1492
            +T WL+ S++    G+S L+GYN+A LNTP  +IQ F+N +Y +R G  + K  L +LW+ TV I+V  G +G+F   ++ADK GRK  L+ N+  A++G LLE   K    PEL+++GR  +G NCG+T+G+ ++++TE++P+ +RGA+   HQ+    GI  AQ++GL  ++G E+ W  L+ F  IP ++S   LPFCPESPR+L+L+K DE+AA   +++   +N  ++   I +M+ E  A      KF Y  LFR  +LRM +L+ + + + QQWSGINA+F Y+  +F  AGV    + Y I+GTG++NVL T V++PL+++ GRR LL++P  +M I  + +  S+  Q  + W++++SI+ +L Y++GFALGLGPIP  + +E FRQ PR A +G+ Q  +W  N I+  +F F++E + EY F++F +I    ++F+  FLPET  ++ ++I    +
Sbjct:    5 LTFWLMFSTLAAVFGTSLLFGYNIAVLNTPDTIIQAFYNRTYYERGGEYMDKKALELLWAVTVAIYVGIGMIGAFTTSFVADKFGRKGGLMFNHTFALIGTLLEGLCKVTAAPELLIVGRGFVGFNCGMTVGMVSLYITELAPKELRGAIGACHQMATTIGISLAQILGLREMIGGEELWPLLVAFCGIPALISLLCLPFCPESPRFLLLNKKDEEAATKALQRL--RNHDDVSADINEMKVEA-ADAAKRAKFAYIDLFRHPELRMPVLISVIIQVAQQWSGINAVFFYAAKIFRNAGVDDDKVPYAIIGTGIINVLATIVSMPLIERLGRRPLLIWPMGLMGISCIAITISLSLQDTYAWMAYISIIFVLVYVIGFALGLGPIPQFVVAELFRQEPRAAVIGLAQFVNWTCNFILALTFPFLQEGLQEYTFLLFLVIIVACIVFLAFFLPETKNKTFEEIATHMR 468          
BLAST of slc2a-1 vs. TrEMBL
Match: A0A267F3K8 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005404g1 PE=3 SV=1)

HSP 1 Score: 374.015 bits (959), Expect = 1.520e-119
Identity = 205/496 (41.33%), Postives = 319/496 (64.31%), Query Frame = 2
Query:   32 NPNLASSAEYMKFSDIKMFQMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKN--SPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRGYLWIP 1513
            +P +AS     K +  +  Q+T  +LL+ IT AL SS +YGYN++KLNTP +++  F N +YT+R G   + + L ++WS  ++ FV  GA+GSF  G  A+K GR+R L +N+ LA      E A+    + EL+++GR IIG N G++ GL ++++ E+SP+ +RGA  +FHQ+G+V GIL  QV+ L+ +LG    W +L GF+++P +LSC +LP CPESPRYL+  + DE AA+  + +  +    + EL   I + +K   +  D    FQY  LF   +LR +L++   L + QQWSGINAIFAYS S+F  AGV    IQY I+GTG++NV++TF++L L++K GRR LLL P+ +++  +L++   I  Q  F WL++L+I +ML YIVGF LG GP+  M+  ETF Q  R  A+ ++Q  H+    ++  +F+FME ++ E++F++FA I  ++  F++ +LPE+  RS+ ++V D K G+ W P
Sbjct:   22 DPTMASITSLAKKTLRR--QVTPIMLLTVITAAL-SSTMYGYNMSKLNTPYEILLSFINATYTERNGVEPAPTFLTLIWSVIISAFVGAGALGSFSSGVFAEKFGRRRGLFINHLLAFASAAAEMAAYYCKVYELLIVGRAIIGFNSGISQGLVSLYIAEVSPKQVRGAFLSFHQIGIVIGILLGQVLSLEFVLGGVNTWPFLCGFSVMPCLLSCCLLPLCPESPRYLLSVRKDEAAAKAALLRLTRSKHAAKELLNEIREEEKVVSSRPDLYESFQYRDLFTRPELRRSLMMSALLNVSQQWSGINAIFAYSHSVFYNAGVDPETIQYAIIGTGVINVVVTFISLALIEKVGRRKLLLIPNWILVGSLLVLTACINQQSNFAWLNYLTICIMLAYIVGFGLGFGPLTSMITCETFEQQARPQAMAVIQTVHYVSCFVLMLTFKFMEAAMKEFIFMLFACIVAVATTFLMFYLPESAHRSVKEVVADIKDGWRWRP 514          
BLAST of slc2a-1 vs. TrEMBL
Match: A0A267F5D1 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004313g1 PE=3 SV=1)

HSP 1 Score: 370.933 bits (951), Expect = 2.079e-118
Identity = 203/496 (40.93%), Postives = 318/496 (64.11%), Query Frame = 2
Query:   32 NPNLASSAEYMKFSDIKMFQMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKN--SPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRGYLWIP 1513
            +P +AS     K +  +  Q+T  +LL+ IT AL SS +YGYN++KLNTP +++  F N +YT+R G   + + L ++WS  ++ FV  GA+GSF  G  A+K GR+R L +N+ LA      E A+    + EL+++GR IIG N G++ GL ++++ E+SP+ +RGA  +FHQ+G+V GIL  QV+ L+ +LG    W +L GF+++P +LSC +LP CPESPRYL+  + DE AA+  + +  +    + EL   I + +K   +  D    FQY  LF   +LR +L++   L + QQWSGINAIFAYS S+F  AGV    IQY I+GTG++NV++TF++L L++K GRR LLL P+ +++  +L++   I  Q  F WL++ +I +ML YIVGF LG GP+  M+  ETF Q  R  A+ ++Q  H+    ++  +F+FME ++ E++F++FA I  ++  +++ +LPE+  RS+ ++V D K G+ W P
Sbjct:   22 DPTMASITSLAKKTLRR--QVTPIMLLTVITAAL-SSTMYGYNMSKLNTPYEILLSFINTTYTERNGVEPAPTFLTLIWSVIISAFVGAGALGSFSSGVFAEKFGRRRGLFINHLLAFASAAAEMAAYYCKVYELLIVGRAIIGFNSGISQGLVSLYIAEVSPKQVRGAFLSFHQIGIVIGILLGQVLSLEFVLGGVNTWPFLCGFSVMPCLLSCCLLPLCPESPRYLLSVRKDEAAAKAALLRLTRSKHAAKELLNEIREEEKVVSSRPDLYESFQYRDLFTRPELRRSLMMSALLNVSQQWSGINAIFAYSHSVFYNAGVDPEAIQYAIIGTGVINVVVTFISLALIEKVGRRKLLLIPNWILVGSLLVLTACINQQSNFAWLNYFTICIMLAYIVGFGLGFGPLTSMITCETFEQQARPQAMAVIQTVHYVSCFVLMLTFKFMEAAMKEFIFMLFACIVAVATTYLMFYLPESAHRSVKEVVADIKDGWRWRP 514          
BLAST of slc2a-1 vs. TrEMBL
Match: A0A267FPE7 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023233g1 PE=3 SV=1)

HSP 1 Score: 370.933 bits (951), Expect = 2.177e-118
Identity = 203/496 (40.93%), Postives = 318/496 (64.11%), Query Frame = 2
Query:   32 NPNLASSAEYMKFSDIKMFQMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKN--SPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRGYLWIP 1513
            +P +AS     K +  +  Q+T  +LL+ IT AL SS +YGYN++KLNTP +++  F N +YT+R G   + + L ++WS  ++ FV  GA+GSF  G  A+K GR+R L +N+ LA      E A+    + EL+++GR IIG N G++ GL ++++ E+SP+ +RGA  +FHQ+G+V GIL  QV+ L+ +LG    W +L GF+++P +LSC +LP CPESPRYL+  + DE AA+  + +  +    + EL   I + +K   +  D    FQY  LF   +LR +L++   L + QQWSGINAIFAYS S+F  AGV    IQY I+GTG++NV++TF++L L++K GRR LLL P+ +++  +L++   I  Q  F WL++ +I +ML YIVGF LG GP+  M+  ETF Q  R  A+ ++Q  H+    ++  +F+FME ++ E++F++FA I  ++  +++ +LPE+  RS+ ++V D K G+ W P
Sbjct:   22 DPTMASITSLAKKTLRR--QVTPIMLLTVITAAL-SSTMYGYNMSKLNTPYEILLSFINTTYTERNGVEPAPTFLTLIWSVIISAFVGAGALGSFSSGVFAEKFGRRRGLFINHLLAFASAAAEMAAYYCKVYELLIVGRAIIGFNSGISQGLVSLYIAEVSPKQVRGAFLSFHQIGIVIGILLGQVLSLEFVLGGVNTWPFLCGFSVMPCLLSCCLLPLCPESPRYLLSVRKDEAAAKAALLRLTRSKHAAKELLNEIREEEKVVSSRPDLYESFQYRDLFTRPELRRSLMMSALLNVSQQWSGINAIFAYSHSVFYNAGVDPEAIQYAIIGTGVINVVVTFISLALIEKVGRRKLLLIPNWILVGSLLVLTACINQQSNFAWLNYFTICIMLAYIVGFGLGFGPLTSMITCETFEQQARPQAMAVIQTVHYVSCFVLMLTFKFMEAAMKEFIFMLFACIVAVATTYLMFYLPESAHRSVKEVVADIKDGWRWRP 514          
BLAST of slc2a-1 vs. Ensembl Cavefish
Match: slc2a3a (solute carrier family 2, facilitated glucose transporter member 1-like [Source:NCBI gene;Acc:103021572])

HSP 1 Score: 352.058 bits (902), Expect = 1.005e-114
Identity = 195/472 (41.31%), Postives = 274/472 (58.05%), Query Frame = 2
Query:   89 QMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQ--KEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRG 1498
            Q+T +LL S  T  +GS   +GYN   +N P Q +Q FFNE++ +RYG P+      ++WS  V IF   G VGSF  G +ADK GR+RS+ + N LA++GG L          E+++ GR +IGL CGL  GL  +++ E+SP  +RGA    HQ+GVV GIL +Q+ GL+ LLG++K W  LL  T+IP +L C +LPFCPESPRYL+++ N E+ AR  + +         E+   DMQ  KE     +   K    +LFR    R  LLV + L + QQ SGINA+F YS  +F  AGV +    Y  +G G+VN + T V+L L+++AGRR+L L     M I  LLM  ++  +H    LS+LSI  +  ++  F +G GPIP  + +E F QGPR AA+ +    +W  N IV  SF  +E+  G Y+FIIF     L  IF    +PET GR+ D+I  +F + 
Sbjct:    9 QVTCYLLFSLGTAVIGS-LQFGYNTGVINAPEQKLQAFFNETWVRRYGKPIDAGVCTLVWSLAVAIFSVGGMVGSFSVGVVADKFGRRRSMFIVNILAVIGGSLMGLCTLCSSFEMVIAGRLVIGLFCGLFTGLTPMYVGEVSPTPLRGAFGTLHQLGVVVGILISQIFGLEFLLGSDKLWPLLLALTVIPAVLQCLLLPFCPESPRYLLINLNKEEEARKALVRLRG-----FEDVSKDMQEMKEESVKMNMEKKVTIPELFRTATYRQPLLVAVVLQLSQQLSGINAVFYYSTGIFESAGVTQPI--YATIGAGIVNTVFTVVSLFLVERAGRRTLHLIGLGGMAISALLMTIALLLKH-IESLSYLSIAAVFAFVAMFEMGPGPIPWFIVAELFSQGPRPAAMAVAGFSNWTANFIVGISFPKLEKLCGPYVFIIFMAFLILFFIFTYFRVPETKGRTFDEIAREFSKA 471          
BLAST of slc2a-1 vs. Ensembl Cavefish
Match: slc2a3a (solute carrier family 2, facilitated glucose transporter member 1-like [Source:NCBI gene;Acc:103021572])

HSP 1 Score: 339.347 bits (869), Expect = 5.904e-111
Identity = 186/452 (41.15%), Postives = 263/452 (58.19%), Query Frame = 2
Query:  149 YGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQ--KEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRG 1498
            +GYN   +N P Q ++ FFNE++ +RYG P+      ++WS  V IF   G VGSF  G +ADK GR+RS+ + N LA++GG L          E+++ GR +IGL CGL  GL  +++ E+SP  +RGA    HQ+GVV GIL +Q+ GL+ LLG++K W  LL  T+IP +L C +LPFCPESPRYL+++ N E+ AR  + +         E+   DMQ  KE     +   K    +LFR    R  LLV + L + QQ SGINA+F YS  +F  AGV +    Y  +G G+VN + T V+L L+++AGRR+L L     M I  LLM  ++  +H    LS+LSI  +  ++  F +G GPIP  + +E F QGPR AA+ +    +W  N IV  SF  +E+  G Y+FIIF     L  IF    +PET GR+ D+I  +F + 
Sbjct:    3 FGYNTGVINAPEQ-VKAFFNETWVRRYGKPIDAGVCTLVWSLAVAIFSVGGMVGSFSVGVVADKFGRRRSMFIVNILAVIGGSLMGLCTLCSSFEMVIAGRLVIGLFCGLFTGLTPMYVGEVSPTPLRGAFGTLHQLGVVVGILISQIFGLEFLLGSDKLWPLLLALTVIPAVLQCLLLPFCPESPRYLLINLNKEEEARKALVRLRG-----FEDVSKDMQEMKEESVKMNMEKKVTIPELFRTATYRQPLLVAVVLQLSQQLSGINAVFYYSTGIFESAGVTQP--IYATIGAGIVNTVFTVVSLFLVERAGRRTLHLIGLGGMAISALLMTIALLLKH-IESLSYLSIAAVFAFVAMFEMGPGPIPWFIVAELFSQGPRPAAMAVAGFSNWTANFIVGISFPKLEKLCGPYVFIIFMAFLILFFIFTYFRVPETKGRTFDEIAREFSKA 445          
BLAST of slc2a-1 vs. Ensembl Cavefish
Match: slc2a1a (solute carrier family 2, facilitated glucose transporter member 1-like [Source:NCBI gene;Acc:103042991])

HSP 1 Score: 337.035 bits (863), Expect = 2.139e-109
Identity = 173/480 (36.04%), Postives = 282/480 (58.75%), Query Frame = 2
Query:   71 SDIKMFQMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNS-----PELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKR 1495
            S+ K ++     L+ ++  A+  S  +GYN   +N P   I+ F+NE++  RY   + +S    LW+ +V+IF   G  GSF  G   +++GR+ S+++ N LA +   L   SK     E++++GR I+GL  GL+ G   +++ EI+P ++RGA+   HQ+G+V GIL AQV G+DS++G    W +LLGFT IP ++ C +LPFCPESPR+L++++N+E  A+  ++K    +       E++E    M +E         K    +LFR+   R  L++ I L + QQ+SGINA+F YS S+F +AGV      Y  +G G+VN + T V+L ++++AGRRSL L   M M +  ++M  ++    K+  LS++SIV +  ++  F +G GPIP  + +E F QGPR +A  +    +W  N IV   F+++E+  G Y+FIIF ++  +  +F    +PET GR+ D+I   F++
Sbjct:   18 SETKNYKHVTVQLMVAVGTAVIGSLQFGYNTGVINAPQTTIESFYNETWFNRYSEYIPESSRTALWALSVSIFSVGGIFGSFSVGLFVNRLGRRNSMLIANVLAFIAAGLMGFSKLAASWEMLIIGRLIVGLYSGLSTGFVPMYVGEIAPTTLRGALGTLHQLGIVIGILMAQVFGIDSIMGNATMWPFLLGFTFIPALIQCALLPFCPESPRFLLINQNEENKAKTVLKKLRGTDDVGADIQEMKEESRQMMRE--------KKVTIPELFRSPLYRQPLIIAIMLQLSQQFSGINAVFYYSTSIFKKAGVTYP--VYATIGAGIVNTVFTVVSLFVVERAGRRSLHLVGLMGMAVSAVVMTVAMALTEKYQGLSYVSIVAIFIFVAFFEIGPGPIPWFIVAELFSQGPRPSAFAVAGFSNWTANFIVGMCFQYVEQLTGPYVFIIFTVLLLIFFVFTYFKVPETKGRTFDEISAGFRQ 487          
BLAST of slc2a-1 vs. Ensembl Cavefish
Match: slc2a1a (solute carrier family 2, facilitated glucose transporter member 1-like [Source:NCBI gene;Acc:103042991])

HSP 1 Score: 334.339 bits (856), Expect = 1.039e-108
Identity = 171/468 (36.54%), Postives = 277/468 (59.19%), Query Frame = 2
Query:  107 LLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNS-----PELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKR 1495
            L+ ++  A+  S  +GYN   +N P   I+ F+NE++  RY   + +S    LW+ +V+IF   G  GSF  G   +++GR+ S+++ N LA +   L   SK     E++++GR I+GL  GL+ G   +++ EI+P ++RGA+   HQ+G+V GIL AQV G+DS++G    W +LLGFT IP ++ C +LPFCPESPR+L++++N+E  A+  ++K    +       E++E    M +E         K    +LFR+   R  L++ I L + QQ+SGINA+F YS S+F +AGV      Y  +G G+VN + T V+L ++++AGRRSL L   M M +  ++M  ++    K+  LS++SIV +  ++  F +G GPIP  + +E F QGPR +A  +    +W  N IV   F+++E+  G Y+FIIF ++  +  +F    +PET GR+ D+I   F++
Sbjct:   12 LMVAVGTAVIGSLQFGYNTGVINAPQTTIESFYNETWFNRYSEYIPESSRTALWALSVSIFSVGGIFGSFSVGLFVNRLGRRNSMLIANVLAFIAAGLMGFSKLAASWEMLIIGRLIVGLYSGLSTGFVPMYVGEIAPTTLRGALGTLHQLGIVIGILMAQVFGIDSIMGNATMWPFLLGFTFIPALIQCALLPFCPESPRFLLINQNEENKAKTVLKKLRGTDDVGADIQEMKEESRQMMREK--------KVTIPELFRSPLYRQPLIIAIMLQLSQQFSGINAVFYYSTSIFKKAGVTYP--VYATIGAGIVNTVFTVVSLFVVERAGRRSLHLVGLMGMAVSAVVMTVAMALTEKYQGLSYVSIVAIFIFVAFFEIGPGPIPWFIVAELFSQGPRPSAFAVAGFSNWTANFIVGMCFQYVEQLTGPYVFIIFTVLLLIFFVFTYFKVPETKGRTFDEISAGFRQ 469          
BLAST of slc2a-1 vs. Ensembl Cavefish
Match: slc2a1b (solute carrier family 2, facilitated glucose transporter member 1-like [Source:NCBI gene;Acc:103036684])

HSP 1 Score: 333.569 bits (854), Expect = 2.548e-108
Identity = 173/474 (36.50%), Postives = 277/474 (58.44%), Query Frame = 2
Query:   89 QMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYH-----QKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKR 1495
            ++T  L+L+  T  +GS   +GYN   +N P ++I+ F+NE++  RY  P++ + L  LWS +V IF   G  GSF  G   ++ GR+ S++L N LA +   L   SK     E+++ GRF++GL  GL+ G   +++ E++P ++RGA+   HQ+G+V GIL AQV GLD ++G    W +LLGFT IP +  C +LP CPESPRYL++++N+E  A+  ++K         +  E++E    M +E         K    +L R+   R  L++ + L + QQ SGINA+F +S ++F +AGV++    Y  +G G+VN   T V+L L+++AGRRSL L   + M    +LM  ++   ++  W+S++SIV +  ++  F +G GPIP  + +E F QGPR +A  +    +W  N IV   F+++E   G Y+FIIF I+  +  +F    +PET GR+ D+I   F +
Sbjct:    7 KLTLQLMLAVGTAVIGS-LQFGYNTGVINAPQKIIESFYNETWFDRYQEPITDTALTSLWSLSVAIFSVGGIFGSFSVGLFVNRFGRRNSMLLANVLAFLAAALMGFSKMGSSWEMLITGRFVVGLYSGLSTGFVPMYVGEVAPTALRGALGTLHQLGIVVGILVAQVFGLDVIMGNATMWPFLLGFTFIPALAQCILLPMCPESPRYLLINRNEESKAKAALKKLRGTSDVSADMQEMKEESRQMMREK--------KVTIPELLRSSIYRQPLVIAVMLQLSQQLSGINAVFYFSTAIFEKAGVEQP--VYATIGAGVVNTAFTVVSLFLVERAGRRSLHLIGLLGMAGSAILMTIALALLNQLEWMSYVSIVAIFAFVAFFEIGPGPIPWFIVAELFSQGPRPSAFAVAGFSNWTANFIVGMCFQYVERLCGPYVFIIFTILLVVFFVFTYFKVPETKGRTFDEIAAGFSQ 469          
BLAST of slc2a-1 vs. Ensembl Sea Lamprey
Match: SLC2A9 (solute carrier family 2 member 9 [Source:HGNC Symbol;Acc:HGNC:13446])

HSP 1 Score: 254.218 bits (648), Expect = 1.019e-78
Identity = 146/435 (33.56%), Postives = 243/435 (55.86%), Query Frame = 2
Query:  191 IQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKR 1495
            I+DFFN ++  R+ + LS + + +LWSFT+ I    G VG+ I  ++  + GRK +L+LNN LAI+  LL +        E++ +GRF++G++ G++L +  ++L EISP+++RG+      + +  G+   QV+ L  +LG E +W+ L G  ++PP++    LPF PESPRYL+L + D KAA   +++   +   +++  + ++Q E  A    I       L R R +R  ++     M C Q  G+NAI+ Y+ S+F QAG+  +   Y+I+ TG   VL   ++   ++K GRRSLL+     M +   ++  ++  Q  + W+S+LSI  +L  I  F +G G IP +L  E F Q  R AA  I     W  N I++  F F++ ++  Y F++FA +C  + IF+   LPET  R+  +I   F +
Sbjct:    2 IKDFFNTTWVDRWSTSLSDNSVTLLWSFTIAIMSIGGLVGALIMRFMVQRFGRKGTLLLNNALAILAALLMSLCFLAGSWEMLFLGRFVVGIDAGISLSVLPMYLAEISPKNLRGSTGQVSAIFICLGVFTGQVLNLKEVLGQESHWSILFGILVVPPLVQLATLPFMPESPRYLLLERQDVKAAEKALQRLLGRQ--DVQREMVEIQAEGIAQAH-ISVMSLWGLLRERAVRWQVITVAITMACYQLCGVNAIWFYASSIFRQAGIDPAITPYIIISTGGTEVLAALLSGLAIEKLGRRSLLIVGFGAMAVIFGVLTVALNLQDSYHWMSYLSIACVLAVIASFCIGPGGIPFVLTGELFEQSYRPAAFTIAGIVSWLSNFILSLVFPFIQTALDAYSFLVFAAVCLGAAIFLYFVLPETKKRTFMEISRSFDK 433          
BLAST of slc2a-1 vs. Ensembl Sea Lamprey
Match: slc2a11a (solute carrier family 2 member 11a [Source:ZFIN;Acc:ZDB-GENE-080723-20])

HSP 1 Score: 206.453 bits (524), Expect = 1.617e-60
Identity = 140/463 (30.24%), Postives = 246/463 (53.13%), Query Frame = 2
Query:  122 TVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLP-----LMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKR 1495
               +G SF YG+N++ ++ PT  IQ F N +  +RYG+ L +  L +LWS  V++F   G +G+ + G +A ++GRK +L+ NN  A++  +L   S+P    ELI++GR +IG+NCG+ L L  +FL E +PQ +RG +A    + + FGI++ Q+MGL  L+G E+ W +LL  T++P ++   +LP  PESPR+L++ ++D K     ++    + + ++ + + +M+ E+ A      K     L R    R  L+  + +   QQ  G++       S  T   V+   +    V  G    ++  V         +++AGRR LL+   M+M +  ++M  S+  Q    W+ +LS   +  YI+ F +G G +  M+ +E F Q  R AA  I  + +W     +   F FM + +G + F++F + C    +++   LPET  +S  +I  +F++
Sbjct:   27 ATGIGGSFQYGFNISVISAPTTHIQRFINTTCEQRYGAGLDQHVLTLLWSTVVSVFTLGGCLGALLAGPLAIRLGRKGALLFNNGFAVLAAVLMGVSRPATSFELIIIGRLLIGINCGVGLSLQPMFLGESAPQHLRGIMAMGGILFLPFGIVSGQIMGLRELMGEEEMWPFLLALTVVPALVQLAVLPLLPESPRFLLIDRDDRKRCLKALQWL--RGAGDVTDEMAEMRAEH-AKLQGQKKKMPLDLLRDPSQRWQLITVVVMGAGQQLCGLDVXPPPPCSAMTIVVVRSFEVALHPVFVGGGVYVVEPVRTKTQRGYFIERAGRRPLLIGGYMMMSVVCVVMTVSLHLQ-SVEWMPYLSATCVFGYILSFGIGPGGVTGMMAAELFTQEARPAAYMINGSCNWIFLFSIGMVFPFMVKELGSFCFLVFLVDCVCCALYIYFILPETRNKSFLEIAQEFEK 485          
BLAST of slc2a-1 vs. Ensembl Sea Lamprey
Match: slc2a11b (solute carrier family 2 member 11b [Source:NCBI gene;Acc:564970])

HSP 1 Score: 148.288 bits (373), Expect = 5.585e-41
Identity = 91/288 (31.60%), Postives = 147/288 (51.04%), Query Frame = 2
Query:  614 GTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDI 1477
            G ++ W  +L   ++P +    +LPF PESP YL++ +   + AR  +     +    L+E +  M+ E    ++  G      + R R  R  L+  + L + QQ SG+NAI+ YS  +F +A + +  I YV +GTG   ++       L+D  GRR LLL   ++M +C   +  S+  Q +  W+ +LS+ L   YI+ F +G G I  +LP+E F Q  R AA  I  + +W    ++   F F+ E +G Y F+ F + C +  I V + LPET  RS  +I
Sbjct:    1 GQQQLWAVVLALPVLPALTQLLVLPFFPESPCYLLIDRGQPQQARQELSPLEHR----LDEELLAMRAEQEQMSE--GPRSVWDVMRNRGTRWQLITVLLLNVTQQLSGLNAIYFYSTYVFKEAKIPEEKIPYVTLGTGAAEIITAMSCGMLVDGLGRRPLLLCGYVLMSLCCAAITVSLALQERSIWMPYLSVALTFAYILSFGIGPGGIMGILPAELFMQDSRSAAFVISGSVNWFSFFLIGLLFPFLVEGMGPYCFVFFMVDCVMGSIIVCILLPETKDRSFVEI 282          
BLAST of slc2a-1 vs. Ensembl Sea Lamprey
Match: slc2a10 (solute carrier family 2 member 10 [Source:NCBI gene;Acc:560546])

HSP 1 Score: 75.485 bits (184), Expect = 4.022e-15
Identity = 70/279 (25.09%), Postives = 130/279 (46.59%), Query Frame = 2
Query:  323 GWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGL------DSLLGTEKNWNYLLGFTIIPPILSCFILPFC-PESPRYLMLSKNDEKAARLNMEKYHQKN-SPELE--EAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVK-KSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMII 1126
            G + D++GR+ ++  +  L + G    A +        ++ GR ++G+    +     +++ E++    RGA+ + +++GV  G+LAA    L         +G    W ++ G   +P +    +L  C P SP  L+     E A R       Q++ S E++   +  +M+K+Y              L R   +R  +L+G  L+  QQ +G   +  Y+ S+F  AG + ++++    VG GLV V  T V + ++D+ GRR  LL  S+ M +
Sbjct:   64 GPLLDRLGRRSAVACSGALLVTGSAFLACAPSYAA---LLGGRAVVGVAIAASSVATCVYVAEVAHPRRRGALVSAYELGVTGGVLAAYAANLVLGRGPGGTVGGVAPWRWMFGLCCVPALAQVMLLVACLPASPSSLLRCGQAEAAERTLRRILGQQDVSAEIDALRSSLEMEKQYSV---------LDLLRRKDSMRTRMLIGGGLVAFQQLTGQPTVLFYAASVFRAAGYRGEASVLLASVGLGLVKVAATSVAVAVVDRVGRRRSLLAGSVAMAL 330          
BLAST of slc2a-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006105.1 (pep scaffold:Pmarinus_7.0:GL483550:10411:12132:-1 gene:ENSPMAG00000005515.1 transcript:ENSPMAT00000006105.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 2.643e-10
Identity = 37/107 (34.58%), Postives = 53/107 (49.53%), Query Frame = 2
Query: 1175 WLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIG-EYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFK 1492
            WL+  S+  +      F+LG GPIP ++ SE F    RG A G+  A +W    +VT       E +G    F  FA +C    +  ++ LPET GRSL+ I   F+
Sbjct:   56 WLALASMAGLHRRCGRFSLGWGPIPWIVMSEVFPVRWRGVASGVCVAVNWISAFVVTKPTSAAVEWLGFPGAFWFFASVCAAGFVLTIVALPETKGRSLEQIQAHFE 162          
BLAST of slc2a-1 vs. Ensembl Yeast
Match: HXT13 (Putative transmembrane polyol transporter; supports growth on and uptake of mannitol and sorbitol with moderate affinity when overexpressed in a strain deleted for hexose family members; minor hexose transport activity when overexpressed in a similar strain; induced by non-fermentable carbon sources; induced in low glucose, repressed in high glucose; HXT13 has a paralog, HXT17, that arose from a segmental duplication [Source:SGD;Acc:S000000795])

HSP 1 Score: 144.05 bits (362), Expect = 1.568e-37
Identity = 125/454 (27.53%), Postives = 216/454 (47.58%), Query Frame = 2
Query:  239 LSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEK-----NWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPE----LEEAITDMQKEYFASTDAIGKFQYTQLFRAR-KLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPW---------LSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRGYL------WIPFRKK 1525
            LS  R+ +L    V +F    A+G  I   +AD +GR+ ++V+   + +VG +++ +S        +  G+ I GL  G    L  + L+EI+P  +RG + + +Q+ + FGI     +G  S+ GT K      W   LG   +  ++    +   PESPRYL+  +  E+A R ++ K + K SPE    L++A  D       +   +G+  + +LF  + K+   L+ GI +    Q +G N  F Y  ++F   G+       +++GT  VN   T + + ++DK GRR  LL+ +  M+ CM++   SIG +  +P            +  IV   FYI  FA    P+  ++ +E+F    +  A+ I  A +W    ++ F   F+  SI  Y   +F        ++V  FLPET G SL++I + ++ G        W+P  ++
Sbjct:  103 LSNVRMGLL----VAMFSIGCAIGGLIFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFV--GKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIF----LGYCSVYGTRKYDNTAQWRVPLGLCFLWALIIIIGMLLVPESPRYLIECERHEEA-RASIAKIN-KVSPEDPWVLKQA--DEINAGVLAQRELGEASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSIVLGT--VNFFSTIIAVMVVDKIGRRKCLLFGAAGMMACMVIF-ASIGVKCLYPHGQDGPSSKGAGNAMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSRAMSISTACNWLWQFLIGFFTPFITGSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEEIQLLYEEGIKPWKSASWVPPSRR 539          
BLAST of slc2a-1 vs. Ensembl Yeast
Match: HXT17 (Putative transmembrane polyol transporter; supports growth on and uptake of mannitol and sorbitol with moderate affinity when overexpressed in a strain deleted for hexose family members; minor hexose transport activity when overexpressed in a similar strain; induced by raffinose and galactose at pH 7.7 versus pH 4.7, repressed by high levels of glucose; HXT17 has a paralog, HXT13, that arose from a segmental duplication [Source:SGD;Acc:S000005355])

HSP 1 Score: 144.05 bits (362), Expect = 1.956e-37
Identity = 125/454 (27.53%), Postives = 216/454 (47.58%), Query Frame = 2
Query:  239 LSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEK-----NWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPE----LEEAITDMQKEYFASTDAIGKFQYTQLFRAR-KLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPW---------LSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRGYL------WIPFRKK 1525
            LS  R+ +L    V +F    A+G  I   +AD +GR+ ++V+   + +VG +++ +S        +  G+ I GL  G    L  + L+EI+P  +RG + + +Q+ + FGI     +G  S+ GT K      W   LG   +  ++    +   PESPRYL+  +  E+A R ++ K + K SPE    L++A  D       +   +G+  + +LF  + K+   L+ GI +    Q +G N  F Y  ++F   G+       +++GT  VN   T + + ++DK GRR  LL+ +  M+ CM++   SIG +  +P            +  IV   FYI  FA    P+  ++ +E+F    +  A+ I  A +W    ++ F   F+  SI  Y   +F        ++V  FLPET G SL++I + ++ G        W+P  ++
Sbjct:  103 LSNVRMGLL----VAMFSIGCAIGGLIFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFV--GKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIF----LGYCSVYGTRKYDNTAQWRVPLGLCFLWTLIIIIGMLLVPESPRYLIECERHEEA-RASIAKIN-KVSPEDPWVLKQA--DEINAGVLAQRELGEASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSIVLGT--VNFFSTIIAVMVVDKIGRRKCLLFGAAGMMACMVIF-ASIGVKCLYPHGQDGPSSKGAGNAMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSRAMSISTACNWLWQFLIGFFTPFITGSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEEIQLLYEEGIKPWKSASWVPPSRR 539          
BLAST of slc2a-1 vs. Ensembl Yeast
Match: HXT15 (Putative transmembrane polyol transporter; supports growth on and uptake of mannitol, sorbitol and xylitol with moderate affinity when overexpressed in a strain deleted for hexose family members; minor hexose transport activity when overexpressed in a similar strain; similarity to hexose transporters; expression is induced by low levels of glucose and repressed by high levels of glucose [Source:SGD;Acc:S000002404])

HSP 1 Score: 142.124 bits (357), Expect = 7.587e-37
Identity = 123/458 (26.86%), Postives = 215/458 (46.94%), Query Frame = 2
Query:  239 LSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEK-----NWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKA----ARLNMEKYHQKNSPE----LEEAITDMQKEYFASTDAIGKFQYTQLFRAR-KLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPW---------LSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRGYL------WIPFRKK 1525
            LS  R+ +L    V +F    ++G      +AD +GR+ ++V+   + +VG +++ +S        +  G+ I GL  G    L  + L+EI+P  +RG + + +Q+ + FGI     +G  S+ GT K      W   +G   +  ++    +   PESPRYL+  +  E+A    A++N      K SPE    L++A  D       +   +G+  + +LF  + K+   L+ GI +    Q +G N  F Y  ++F   G+       +++GT  VN   T + + ++DK GRR  LL+ +  M+ CM++   SIG +  +P            +  IV   FYI  FA    P+  ++ +E+F    +  A+ I  AF+W    ++ F   F+  SI  Y   +F        ++V  FLPET G SL++I + ++ G        W+P  ++
Sbjct:  106 LSNVRMGLL----VAMFSVGCSIGGVAFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFV--GKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIF----LGYCSVYGTRKYSNTAQWRIPVGLCFLWALIIIVGMLLVPESPRYLIECERHEEACVSIAKIN------KVSPEDPWVLKQA--DEINAGVLAQRELGEASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSIVLGT--VNFFSTIIAVMVVDKIGRRKCLLFGAASMMACMVIF-ASIGVKCLYPHGQDGPSSKGAGNAMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSKAMSISTAFNWLWQFLIGFFTPFITGSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEEIQLLYEEGIKPWKSASWVPPSRR 542          
BLAST of slc2a-1 vs. Ensembl Yeast
Match: HXT7 (High-affinity glucose transporter; member of the major facilitator superfamily, nearly identical to Hxt6p, expressed at high basal levels relative to other HXTs, expression repressed by high glucose levels; HXT7 has a paralog, HXT4, that arose from the whole genome duplication [Source:SGD;Acc:S000002750])

HSP 1 Score: 140.198 bits (352), Expect = 3.680e-36
Identity = 140/521 (26.87%), Postives = 241/521 (46.26%), Query Frame = 2
Query:  119 ITVALGSSFLYGYNVAKLNTPTQMIQDFFNES-YTKRYG-------SPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEK-----NWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAAR-LNMEKYHQKNSP----ELEEAITDMQKEYFASTDAIGKFQYTQLFRAR-KLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFP---------WLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRGYL------WIPFRKKPYYIYANEVIAANKALYQ 1579
            I +A G  F++G++       T  I  F N++ + +R+G       + LSK R  ++    V+IF    A+G  I   + D  GRK  L++   + I+G +++ AS        I  GR I GL  G    L+ + ++E+SP+ +RG + + +Q+ +  GI     +G  +  GT+       W   LG      +     + F PESPRYL      E+A R + +      + P    E+E  +  ++ E  A     G   + +LF ++ K+   L++G  +   QQ +G N  F Y  ++F   G+  S    +++G  +VN   TFV + ++++ GRR+ LL+ +  M  CM++   S+G    +P            +  IV   FYI  FA    PIP ++ SETF    +  A+ I  A +W    ++ F   F+  +I  Y   +F         +VLL +PET G +L+++   ++ G L      W+P  ++     A E+   +K LY+
Sbjct:   70 IMIAFGG-FVFGWD-------TGTISGFINQTDFIRRFGMKHKDGTNYLSKVRTGLI----VSIFNIGCAIGGIILSKLGDMYGRKVGLIVVVVIYIIGIIIQIASINKWYQYFI--GRIISGLGVGGIAVLSPMLISEVSPKHLRGTLVSCYQLMITAGIF----LGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIGGMTFVPESPRYLAEVGKIEEAKRSIAVSNKVAVDDPSVLAEVEAVLAGVEAEKLA-----GNASWGELFSSKTKVLQRLIMGAMIQSLQQLTGDNYFFYYGTTIFKAVGLSDSFETSIVLG--IVNFASTFVGIYVVERYGRRTCLLWGAASMTACMVVY-ASVGVTRLWPNGQDQPSSKGAGNCMIVFACFYIFCFATTWAPIPYVVVSETFPLRVKSKAMSIATAANWLWGFLIGFFTPFITGAINFYYGYVFMGCLVFMFFYVLLVVPETKGLTLEEVNTMWEEGVLPWKSASWVPPSRRGANYDAEEMTHDDKPLYK 564          
BLAST of slc2a-1 vs. Ensembl Yeast
Match: HXT6 (High-affinity glucose transporter; member of the major facilitator superfamily, nearly identical to Hxt7p, expressed at high basal levels relative to other HXTs, repression of expression by high glucose requires SNF3; HXT6 has a paralog, HXT1, that arose from the whole genome duplication [Source:SGD;Acc:S000002751])

HSP 1 Score: 140.198 bits (352), Expect = 4.328e-36
Identity = 140/521 (26.87%), Postives = 241/521 (46.26%), Query Frame = 2
Query:  119 ITVALGSSFLYGYNVAKLNTPTQMIQDFFNES-YTKRYG-------SPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEK-----NWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAAR-LNMEKYHQKNSP----ELEEAITDMQKEYFASTDAIGKFQYTQLFRAR-KLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFP---------WLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRGYL------WIPFRKKPYYIYANEVIAANKALYQ 1579
            I +A G  F++G++       T  I  F N++ + +R+G       + LSK R  ++    V+IF    A+G  I   + D  GRK  L++   + I+G +++ AS        I  GR I GL  G    L+ + ++E+SP+ +RG + + +Q+ +  GI     +G  +  GT+       W   LG      +     + F PESPRYL      E+A R + +      + P    E+E  +  ++ E  A     G   + +LF ++ K+   L++G  +   QQ +G N  F Y  ++F   G+  S    +++G  +VN   TFV + ++++ GRR+ LL+ +  M  CM++   S+G    +P            +  IV   FYI  FA    PIP ++ SETF    +  A+ I  A +W    ++ F   F+  +I  Y   +F         +VLL +PET G +L+++   ++ G L      W+P  ++     A E+   +K LY+
Sbjct:   70 IMIAFGG-FVFGWD-------TGTISGFINQTDFIRRFGMKHKDGTNYLSKVRTGLI----VSIFNIGCAIGGIILSKLGDMYGRKVGLIVVVVIYIIGIIIQIASINKWYQYFI--GRIISGLGVGGIAVLSPMLISEVSPKHLRGTLVSCYQLMITAGIF----LGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIGGMTFVPESPRYLAEVGKIEEAKRSIAVSNKVAVDDPSVLAEVEAVLAGVEAEKLA-----GNASWGELFSSKTKVLQRLIMGAMIQSLQQLTGDNYFFYYGTTIFKAVGLSDSFETSIVLG--IVNFASTFVGIYVVERYGRRTCLLWGAASMTACMVVY-ASVGVTRLWPNGQDQPSSKGAGNCMIVFACFYIFCFATTWAPIPYVVVSETFPLRVKSKAMSIATAANWLWGFLIGFFTPFITGAINFYYGYVFMGCLVFMFFYVLLVVPETKGLTLEEVNTMWEEGVLPWKSASWVPPSRRGANYDAEEMAHDDKPLYK 564          
BLAST of slc2a-1 vs. Ensembl Nematostella
Match: EDO35120 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMF8])

HSP 1 Score: 293.508 bits (750), Expect = 3.774e-93
Identity = 170/493 (34.48%), Postives = 274/493 (55.58%), Query Frame = 2
Query:   32 NPNLASSAEYMKFSDIKMFQMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNE--SYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDM--QKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRG 1498
            NP+  SS        +K  ++T WL  +++   LGSSF +GYN + +N P Q I+ +F    +Y+            +  WS  V IF   G +G+      A++ GRKRSL+ NN LAIVG LL   S       L+ +GRF+IG+NCG+   +A I+L+E++P  +RG++   +Q G+V G+L   + GL  +LGT K W YLLGF+I+P +     LP+CP SPRYL++  + E  A   + K   + + ++ E I +M  +++  A+T+ +      QLF  R L+M LL+G  +M+ QQ  GINA+  YS S+F + GV +S +     G G+V ++ T + + L++  GRR+L+L     M +   +M  +  ++     + ++++V  L  +V F +G G IP  + +E F QGPR AA  +    +WA N I+  +F  M+ ++  Y FI+F  +  +   F   F+PET GR+++DI   F+ G
Sbjct:   13 NPDEESSKR------VKGGKLTFWLAYATLVCILGSSFQFGYNTSCINAPEQDIKTYFRSIGNYS------------DFEWSIAVAIFAIGGMIGALAGPLFANRFGRKRSLLANNGLAIVGALLMFLSYFAKTSPLLTVGRFVIGINCGMNTAIAPIYLSELAPIHLRGSLGTLNQFGIVSGLLVGFIFGLKQVLGTSKGWQYLLGFSILPAVFQLVTLPWCPNSPRYLLIELDQELQAVEALRKL--RATDDVTEDINEMKIERDREATTEHV---SVLQLFVRRDLQMPLLIGCVMMMAQQLGGINAVLYYSTSIFEKVGVPESRV--ATTGIGVVALVFTAIAVRLVEVLGRRTLMLIGLGGMFLFYTVMTIAFCFESS-TGMKYVAVVATLTLVVFFMIGPGAIPWFITAEMFSQGPRPAACAVAATVNWATNFIIGIAFPSMQVALYPYTFIVFMALVAIFWTFTFFFVPETKGRTIEDITDHFRGG 479          
BLAST of slc2a-1 vs. Ensembl Nematostella
Match: EDO42667 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0Y9])

HSP 1 Score: 261.151 bits (666), Expect = 1.920e-81
Identity = 157/473 (33.19%), Postives = 253/473 (53.49%), Query Frame = 2
Query:   95 TRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKA-------GRRSLLLYPSMVMIICMLLMIPSIGYQHKF-PWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDF 1489
            T WL+ ++    LGSSF +GYN A +N+P ++ +   +    K+Y     K      WS  V IF   G +G+ +   +++ IGRKR L+ NNF+A +G +    S  ++   L+++GR  IG+N GL   +  I+L+EISP  +RG++   +Q G+ FGIL   + GL  +LG+   W +L+GF+I+P I+    LPFCP SPRYL+L +N E  A   ++     N  ++ E I +M+ E   S         T LFR + LRM LL+G+ + + QQ SGIN++  YS ++  +A +  S  +Y  +G G+++        P  D++       GRR+L+L+    M  C++  + ++G+  K    +  L  VL  +         GPIP  + +E F QGPR AA  +    +W  N I+   F  +++++  Y FI+F ++     +F    +PET GRS+DDI   F
Sbjct:    1 TGWLIYATAVAVLGSSFQFGYNSACINSPVEVRE---SRPDIKKYFKTQHKPLATYDWSIIVGIFPFGGMLGALVGPTLSNIIGRKRCLLYNNFIAAIGSISMIVSYYVVSSPLLIIGRIFIGINAGLNTAVVPIYLSEISPIQLRGSLGTLNQFGICFGILLGYIFGLKEVLGSGSKWPWLIGFSIVPAIIQMMTLPFCPRSPRYLLLKRNKEADAVHALQILRGTN--DVSEDIAEMRIEQEQSLRE-PHVSVTSLFRLKHLRMPLLIGVVMQMSQQLSGINSVIYYSTTILDEAHIPGS--RYATLGVGIIS--------PDKDRSGGLVEVLGRRTLMLWGLGGM--CIMYGVITLGFSLKVRSCMESLPWVLFSY--------TGPIPWFITAEIFSQGPRPAACTVAAVVNWLSNFIIGIGFPSLQKALDPYTFIVFLVLVLGFWLFTYFLVPETKGRSIDDITRQF 447          
BLAST of slc2a-1 vs. Ensembl Nematostella
Match: EDO32615 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUJ6])

HSP 1 Score: 153.68 bits (387), Expect = 4.306e-41
Identity = 122/409 (29.83%), Postives = 206/409 (50.37%), Query Frame = 2
Query:  305 VGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAAR----LNMEKYH-QKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMII----CMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEY-LFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFK-RG 1498
            +G  I G++ D IGRK +L+L +     G LL    K      ++  GRF+ GL  G+      ++++E +  S RGA+ + +Q+G+  GIL +  +G       +  W+ + G    P  L   ++ F PE+ R+L+  K + +A +    L    Y   K   E++ +I D Q + F+    + +F+   L R        L+ +SL   QQ+SGINA   Y  ++F +AG K      +++G   V  + + ++L L+D+ GRR LL+   + M I    C +    ++ +      ++ LS+  +  YIVGFALG GP   ++ SE F    RG A GI   F+W  + +VT +F  + + + E   F  F      S++FV  F+PET G++L++I  +F+ RG
Sbjct:   55 LGGPIQGFLIDLIGRKFALILTSVPFCSGWLLIGFGKN---AAMLNAGRFMSGLGVGMASLNVPVYISETASFSNRGAMGSINQLGITAGILISYAIGY----AFDWRWSAVAG--SFPAALLVVLMAFMPETARWLIAKKKETRARKTLLWLRGPDYDIDKELCEIKASI-DTQNQRFS----LKEFKNPSLLRP------FLISMSLHFFQQFSGINAFMFYCATIFQKAGFKDPTGVPILIGA--VQFVASAISLALIDRGGRRFLLIVAGVGMSISCFTCAVYFFITVNFGMTEVDIAWLSVTSVAVYIVGFALGWGPCTWLIMSEIFPVRARGTATGIATFFNWFCSFVVTKTFSALIDGLTEAGTFCFFGAFVFASVLFVYFFVPETKGKTLEEIQTEFETRG 441          
BLAST of slc2a-1 vs. Ensembl Nematostella
Match: EDO42861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0E6])

HSP 1 Score: 143.665 bits (361), Expect = 2.397e-37
Identity = 128/424 (30.19%), Postives = 206/424 (48.58%), Query Frame = 2
Query:  290 VATGAV-GSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICML-------LMIPSIGYQ------------HKFP-----WLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESI---GEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDI 1477
            V  GA+ G+ + GW  +  GRK +++       VG +L A +       ++ +GRFI GL  G+      +++ EIS  S+RG + + +Q+ V  G+L A  MG+         W +L     I P L   ++ F PE+PR+ +  K    A  L+   + +    ++EE    ++    A+ D        +  R   ++  L + I+LM  QQ+ GINAI   S S+F QAG + S    VI+G   V  + T +   ++DKAGR+ LL   ++ M + ++       L IP+   Q            H  P     WL+  SIV  +F +V FAL  GP+P ++ SE F    RG A  I    +W++   VT +F  +E++I   G Y F  +  +  L  +FVL+F+PET G++L+ I
Sbjct:   51 VTLGAILGAPLGGWTLEYFGRKGTIMACAVPFEVGWMLIAYANSHY---MLYIGRFITGLAVGMVSLTVPVYIAEISSPSLRGMLGSVNQLAVTMGLLLAYSMGV------VLKWRWLACSGAIFPALLVVLMFFVPETPRWSLSHKRRRDA--LDAMMWFRGPEADVEEECYRIE----ATMDNTQSMSCAEFCRPAIMK-PLFISIALMFFQQFCGINAILFNSASIFHQAGFQDSKAVSVIIGA--VQFVGTGIACLVVDKAGRKLLLWTTALGMTVSLIALGFYFELYIPTTQEQPTPTPALLESIHHSIPAGKISWLAITSIV--VFNLV-FALAWGPVPWLVMSEIFPLQARGIASSISTLCNWSLAFAVTKTFVNIEDAITIQGTYWF--YGGLSFLGFLFVLMFVPETKGKTLEQI 451          
BLAST of slc2a-1 vs. Ensembl Nematostella
Match: EDO42862 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0E7])

HSP 1 Score: 123.25 bits (308), Expect = 2.669e-30
Identity = 122/434 (28.11%), Postives = 205/434 (47.24%), Query Frame = 2
Query:  104 LLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYL-LGFTIIPPILSCFILPFC-PESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYF---ASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICM----------LLMIPS----------IGYQHKFP--WLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHW 1324
            ++L++   ALGS   +G++   L   +  ++D   E    + G  L ++   +  S      +A+  +G    G+I D+ GRK +L+L+   + +G LL A ++      ++  GRFI GL  GL       ++ EIS   +RGA+ + HQ+ +  G+L A + G+         W  + L   IIP +L   +L FC PE+PR+  L  N+  AA  ++E +   N         D+++E F    + D   K  +++  R   +R  L+VG+ LM+ QQ  G   +     S+F  AG   S    +++G       I  +   +MDK GRR LL+  SM +++C+          L++IPS           G  H  P  ++S L+I  ++ + V F+L  GP+P ++ SE F    RG A  I  +  W
Sbjct:   41 VILATFLAALGS-ICFGFS---LGYSSPALEDIEKE----KDGIRLDQNEGALFSSLVTLGALASSPLG----GFIVDRFGRKATLMLSAVPSELGWLLIAFAQN---HAMMYAGRFIAGLGIGLIAVAVPTYIAEISSAKLRGALGSVHQLSITAGLLLAYIFGVFF------KWRAIALAGAIIPGVL--VVLMFCVPETPRWF-LGHNERGAALKSLEWFRGPNG--------DIEQECFEIECTLDTHEKLTFSEFLRP-AIRNPLIVGVGLMVFQQLCGAIVVVFNCASIFKSAGFDNSKAVSILLGASQFGANI--IACLIMDKIGRRILLM--SMALLMCISHIGLGTYFELIIIPSNSSLHNSTVHSGLIHSIPSSYISWLAITCIIVFNVAFSLAWGPVPWLVMSEIFPLRARGVAGSIATSAAW 437          
BLAST of slc2a-1 vs. Ensembl Medaka
Match: slc2a1a (solute carrier family 2, facilitated glucose transporter member 1-like [Source:NCBI gene;Acc:101161039])

HSP 1 Score: 340.887 bits (873), Expect = 2.466e-111
Identity = 172/460 (37.39%), Postives = 276/460 (60.00%), Query Frame = 2
Query:  116 SITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKR 1495
            ++  A+  S  +GYN   +N P  +I+ F+NE+++ R+  P+S+S L  LWS +V IF   G +GSF  G   ++ GR+ S+++ + L  +       SK     E++++GRFI+GL+ GL+ G   +++ EISP S+RGA+   HQ+GVV GIL AQ+ GL+S++G    W  LLGFT++P IL C +LPFCPESPRYL++++N+E  A   + K   + + E+ E I +M++E         K    +LFR+   R  ++V I L + QQ SGINA+F YS  +F +AGV +    Y  +G G+VN   T V+L ++++ GRR L L   M M +  + +  ++  Q +  W+S++SIV +  ++  F +G GPIP  + +E F QGPR AA+ +    +W+ N +V   F+++E+  G Y+FIIF ++     +F    +PET GR+ D+I   F+ 
Sbjct:    3 AVGTAVIGSLQFGYNTGVINAPQTIIESFYNETWSSRFSEPISQSALTALWSVSVAIFSVGGMLGSFSVGLFVNRFGRRNSMLMASALPFIAAAFMGFSKLAASFEMLIVGRFIVGLHSGLSTGFVPMYVEEISPTSLRGAMGTLHQLGVVIGILVAQIFGLESIMGNASLWPLLLGFTLVPAILQCVLLPFCPESPRYLLINRNEESKACSVLMKL--RGTDEVSEDIQEMREESQKMMRE-KKVTIAELFRSPVYRQPMIVAIMLQLSQQLSGINAVFYYSTGIFERAGVAQP--VYATIGAGVVNTAFTVVSLFVVERTGRRPLHLIGLMGMAVSAVFLTVAMALQDQLRWMSYVSIVAIFSFVAFFEIGPGPIPWFIVAELFSQGPRPAAIAVAGLSNWSANFLVGLCFQYVEQLCGPYVFIIFTVLLLGFFVFTYFKVPETKGRTFDEIAAGFRH 457          
BLAST of slc2a-1 vs. Ensembl Medaka
Match: SLC2A4 (solute carrier family 2 member 4 [Source:NCBI gene;Acc:101158976])

HSP 1 Score: 340.502 bits (872), Expect = 5.795e-111
Identity = 173/468 (36.97%), Postives = 283/468 (60.47%), Query Frame = 2
Query:   92 MTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKR 1495
            +T  L LS  T  LGS   +GYN+  +N P ++I++ +N ++  RYG P+  + L  LWS +V IF   G   SF  G+I++ +GR++++++NN  A +GG +   SK     E++++GRFIIG  CGL   L  +++ EI+P S+RGA+   HQ+G+V GIL AQ++GL+SLLG+E  W  LLG T++P +L   +LPFCPESPR+L + ++ E  A+  + +   ++  E+ + + +M++E     D   K    +LFR+   R  +++ I L + QQ SG+NAIF YS ++F +AGV+     Y  +G G+VN   T V+L L+++ GRR+L +     M IC +LM  ++      PW+S++S++ +  ++  F +G GPIP    +E F QGPR AA+ +    +W  N I+   F+++ E  G Y+F+IFA +    L++    +PET G++ D I  +F +
Sbjct:   13 VTGTLALSVFTAVLGS-LTFGYNIGVINAPQKIIEEDYNATWVHRYGEPIPTATLTSLWSLSVAIFSIGGMFSSFCVGFISEWLGRRKAMLINNLFAFIGGSMMGMSKLCRSFEMMILGRFIIGAYCGLACSLTPMYVGEIAPTSLRGALGTLHQLGIVTGILIAQILGLESLLGSEDLWPVLLGLTVMPTVLQMGLLPFCPESPRFLYIIRSQEHLAKRGLRRLTGRD--EVADMLAEMKEEK-RRMDMEKKVSILELFRSPFYRQPIIISILLQLSQQLSGVNAIFYYSTNIFIKAGVQSP--VYATIGVGVVNCAFTVVSLFLVERMGRRTLHMLGLAGMCICAVLMTMALALLESIPWMSYISMLAIFGFVAFFEIGPGPIPWFFVAELFSQGPRPAAMAVAGCSNWTANFIIAMCFQYIAEICGPYVFLIFATLLVFFLVYTFFRVPETRGKTFDQIAANFNQ 474          
BLAST of slc2a-1 vs. Ensembl Medaka
Match: slc2a3b (solute carrier family 2, facilitated glucose transporter member 3 [Source:NCBI gene;Acc:101167147])

HSP 1 Score: 338.576 bits (867), Expect = 4.824e-110
Identity = 185/476 (38.87%), Postives = 275/476 (57.77%), Query Frame = 2
Query:   65 KFSDIKMFQMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFK 1492
            +  D K  +     LL  ++ A+  S  +GYN   +N P Q ++ FF    T RYG P S+  +  +WSF V IF   G +GSF  G + +  GRK+S+++ N LA+VGG L   S      E++++GRF IG+ CGL  GL  +++ EISP ++RGA    HQ+GVV GIL AQ+ GL+ LLG+++ W  LL  TI+P +L   +LPFCPESPRYL++  N E+ AR  + +   +   ++++ I +M++E         K    +LFR+   R  +++ I L + QQ SGINA+F YS  +F  AGV +    Y  +G G+VN + T V+L L+++AGRR+L L     M I  L+M  S+        LS+L+IV +  ++  F +G GPIP  + +E F QGPR AA+ +    +W  N +V   F  +EE  G Y+F+IF ++  L  IF  L +PET GR+ DDI   F 
Sbjct:    3 QLEDDKPKKKVTPYLLYCVSTAVIGSLQFGYNTGVINAPEQKLRQFFQNVSTDRYGEPFSQGTITTVWSFAVAIFSVGGMIGSFSVGTMVNIFGRKKSMMITNILALVGGGLMGLSSLTKSFEVVIVGRFFIGVFCGLCTGLTPMYVGEISPTALRGAFGTLHQLGVVIGILVAQIFGLEFLLGSDELWPLLLALTILPAVLQSIMLPFCPESPRYLLIVLNKEEEARKALVRL--RGCEDVDDDIQEMKEEGMKMAME-KKVTILELFRSPNYRQPIIIAIILQLSQQLSGINAVFYYSTGIFQTAGVTQP--IYATIGAGVVNTVFTVVSLFLIERAGRRTLHLIGLAGMAISALVMTISLSLVKTNESLSYLAIVAVFGFVASFEMGPGPIPWFIVAELFSQGPRPAAMAVSGCSNWTANFLVGLGFPKLEELCGPYVFLIFMVLLILFFIFTYLRVPETKGRTFDDIAQGFS 473          
BLAST of slc2a-1 vs. Ensembl Medaka
Match: slc2a3a (solute carrier family 2, facilitated glucose transporter member 1 [Source:NCBI gene;Acc:101173640])

HSP 1 Score: 338.961 bits (868), Expect = 6.124e-110
Identity = 189/469 (40.30%), Postives = 274/469 (58.42%), Query Frame = 2
Query:   89 QMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQ--KEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDF 1489
            Q+T +LL S  T  +GS   +GYN   +N P Q ++ FFN ++ +RYG P+S     I+WS  V IF   G VGS   G +A++ GR+RS+ + N LA++GGLL   S      E+++ GR +IGL CG   GL  +++ E+SP  +RGA    HQ+GVV GIL AQ+ GL++LLG+EK W  LL  T+ P +L C +LPFCPESPR+L+ +   E+ AR  + +         E+   D+Q  KE  A      K    +LFR    R  LL+ + L + QQ SGINA+F YS  +F  AGVK+    Y  +G G+VN + T V+L L++KAGRR+L L     M I  L+M  S+      P +S+++I+ ++F++  F LG GPIP  + +E F QGPR AA+ +    +W  N +V  SF  +EE  G ++F+IF     L  IF  + +PET GR+ ++I   F
Sbjct:    7 QVTGYLLFSMGTAVIGS-LQFGYNTGVINAPEQKLRSFFNNTWVERYGEPISPGVCTIVWSIAVAIFSVGGMVGSVSVGVLANRFGRRRSMFIVNSLAVIGGLLMGFSTVCSSYEMVIAGRLVIGLFCGFFTGLTPMYVGEVSPTPLRGAFGTLHQLGVVLGILIAQIFGLEALLGSEKLWPLLLALTVAPAVLQCILLPFCPESPRFLLCNLKLEEQARKVLVRLRGT-----EDVSKDLQEMKEESAKMAQEKKVTIPELFRLASYRQPLLIAVMLQLSQQLSGINAVFYYSTGIFQSAGVKQPI--YATIGAGIVNTIFTVVSLFLVEKAGRRTLHLLGLGGMAIGALVMTISL-LLKDIPAMSYVAIIAIMFFVAMFELGPGPIPWFIVAELFSQGPRPAAMAVAGCCNWTANFLVGMSFPKLEEWCGPWVFLIFTAFLILFFIFTYIKVPETKGRTFEEISRVF 466          
BLAST of slc2a-1 vs. Ensembl Medaka
Match: slc2a3a (solute carrier family 2, facilitated glucose transporter member 1 [Source:NCBI gene;Acc:101173640])

HSP 1 Score: 338.961 bits (868), Expect = 6.124e-110
Identity = 189/469 (40.30%), Postives = 274/469 (58.42%), Query Frame = 2
Query:   89 QMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQ--KEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDF 1489
            Q+T +LL S  T  +GS   +GYN   +N P Q ++ FFN ++ +RYG P+S     I+WS  V IF   G VGS   G +A++ GR+RS+ + N LA++GGLL   S      E+++ GR +IGL CG   GL  +++ E+SP  +RGA    HQ+GVV GIL AQ+ GL++LLG+EK W  LL  T+ P +L C +LPFCPESPR+L+ +   E+ AR  + +         E+   D+Q  KE  A      K    +LFR    R  LL+ + L + QQ SGINA+F YS  +F  AGVK+    Y  +G G+VN + T V+L L++KAGRR+L L     M I  L+M  S+      P +S+++I+ ++F++  F LG GPIP  + +E F QGPR AA+ +    +W  N +V  SF  +EE  G ++F+IF     L  IF  + +PET GR+ ++I   F
Sbjct:    7 QVTGYLLFSMGTAVIGS-LQFGYNTGVINAPEQKLRSFFNNTWVERYGEPISPGVCTIVWSIAVAIFSVGGMVGSVSVGVLANRFGRRRSMFIVNSLAVIGGLLMGFSTVCSSYEMVIAGRLVIGLFCGFFTGLTPMYVGEVSPTPLRGAFGTLHQLGVVLGILIAQIFGLEALLGSEKLWPLLLALTVAPAVLQCILLPFCPESPRFLLCNLKLEEQARKVLVRLRGT-----EDVSKDLQEMKEESAKMAQEKKVTIPELFRLASYRQPLLIAVMLQLSQQLSGINAVFYYSTGIFQSAGVKQPI--YATIGAGIVNTIFTVVSLFLVEKAGRRTLHLLGLGGMAIGALVMTISL-LLKDIPAMSYVAIIAIMFFVAMFELGPGPIPWFIVAELFSQGPRPAAMAVAGCCNWTANFLVGMSFPKLEEWCGPWVFLIFTAFLILFFIFTYIKVPETKGRTFEEISRVF 466          
BLAST of slc2a-1 vs. Planmine SMEST
Match: SMESG000072446.1 (SMESG000072446.1)

HSP 1 Score: 1058.13 bits (2735), Expect = 0.000e+0
Identity = 517/517 (100.00%), Postives = 517/517 (100.00%), Query Frame = 2
Query:   62 MKFSDIKMFQMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRGYLWIPFRKKPYYIYANEVIAANKALYQTGGANVTLEIE 1612
            MKFSDIKMFQMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRGYLWIPFRKKPYYIYANEVIAANKALYQTGGANVTLEIE
Sbjct:    1 MKFSDIKMFQMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRGYLWIPFRKKPYYIYANEVIAANKALYQTGGANVTLEIE 517          
BLAST of slc2a-1 vs. Planmine SMEST
Match: SMESG000072446.1 (SMESG000072446.1)

HSP 1 Score: 1036.56 bits (2679), Expect = 0.000e+0
Identity = 507/507 (100.00%), Postives = 507/507 (100.00%), Query Frame = 2
Query:   92 MTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRGYLWIPFRKKPYYIYANEVIAANKALYQTGGANVTLEIE 1612
            MTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRGYLWIPFRKKPYYIYANEVIAANKALYQTGGANVTLEIE
Sbjct:    1 MTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRGYLWIPFRKKPYYIYANEVIAANKALYQTGGANVTLEIE 507          
BLAST of slc2a-1 vs. Planmine SMEST
Match: SMESG000081673.1 (SMESG000081673.1)

HSP 1 Score: 336.65 bits (862), Expect = 4.440e-109
Identity = 182/517 (35.20%), Postives = 297/517 (57.45%), Query Frame = 2
Query:   50 SAEYMKFSDIKMFQMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESY-----TKRYGS--PLSKSRLN----------ILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLS--------HLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRGYLWIPFRKK 1525
            + E++        +++  L+L+      GSS LYGYN+A +N P   I+ F N++         Y S  P+  S +N           L++ T T+FV  G +G+F  GWIAD +GR+  L+LN+   I+GG++   +       L+ +GRF IG+N G+T+GLA+++LTEI+P++ RGA+   HQ+ V  GI+   ++ +   L T+  W      T IP +LS  ILPFCPESPR++ L K++    R    + +Q    +++  I ++Q+E   +     KF++ Q+F  ++LRM L++   + + QQ SGINA+ +YS S+   AG+ +   QY ++  G++NV+ T V+LPL++K GRR+LLL+PS+++   +L +   +   +    +S         +S+  ++ YI+GFA GLGP+P ++ +E FRQ PRGAA  I QA  WA N+IV FS+  M ++IG Y F+ F ++  +  +F  L++PET  R+ DD+  D   G   I  +K 
Sbjct:    2 TNEHLVIDSQNKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSVDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLE--DVDIFIGELQEESDIAKSQ-PKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTVSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKS 515          
BLAST of slc2a-1 vs. Planmine SMEST
Match: SMESG000081662.1 (SMESG000081662.1)

HSP 1 Score: 335.495 bits (859), Expect = 1.299e-108
Identity = 184/513 (35.87%), Postives = 289/513 (56.34%), Query Frame = 2
Query:   89 QMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESY----TKRYGSPLSKS--------------RLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLS--------HLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRGYLWIPFRK-----KPYY 1534
            +++  L+L+      GSS LYGYN+A +N P   I+ F NE+      K     LSK+                N L++ T T+FV  G +G+F  GWIAD +GR+  L++N+   I+G ++   +    I  L+ +GRF IG+N G+T+GLA+++LTEI+P++ RGA+   HQ+ V  GI+   ++ +   L TE  W      T IP ILS  +LP CPESPR++ L +  E  AR   +++ + N  E  +      +E         KF++ QLF  + LRM L++   + + QQ SGINA+ +YS S+ + AG+ +   QY ++  G++NV+ T  +LPL++K GRR LLL+PS+++ + +L +  ++   +    LS         +S+  ++ YI+GFA GLGP+P ++  E FRQ PRGAA  + QA  WA N+IV FS+  M ++IG Y F+ F ++  +  +F  LF+PET  R+ DD+  D   G   I  +K     +P Y
Sbjct:   14 KISPTLILTVFLTCFGSSLLYGYNMAVINLPADRIKCFLNETVLNVPCKDAYDTLSKTFNSSIISGVKSGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLMNHIFVIIGAIINGLTVKTKIASLLFVGRFFIGINSGVTVGLASMYLTEIAPRAYRGAIGACHQLAVTVGIVIGYLLTMTHTLNTESLWPIACACTAIPAILSLILLPLCPESPRFIFLKQFKEDLAR---KEFIRLNRMEDVDVFLGELREEVEIAKNQPKFKFFQLFTQKDLRMPLIIACLIQVMQQLSGINAVISYSSSMLSTAGIPEVYSQYCVITIGILNVICTLSSLPLLEKFGRRILLLWPSILLAVSLLFLTITVNLVNAPGLLSLSNQKIVGGISVFFIMTYIIGFAFGLGPVPALIVGEIFRQEPRGAAYSVSQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVLVCWVFFFLFMPETKNRTFDDVARDLAFGTTVIGKKKTQELNRPIY 523          
BLAST of slc2a-1 vs. Planmine SMEST
Match: SMESG000081662.1 (SMESG000081662.1)

HSP 1 Score: 335.495 bits (859), Expect = 1.607e-108
Identity = 184/513 (35.87%), Postives = 289/513 (56.34%), Query Frame = 2
Query:   89 QMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNESY----TKRYGSPLSKS--------------RLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSLVLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTEISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIPPILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDMQKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAYSESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPSMVMIICMLLMIPSIGYQHKFPWLS--------HLSIVLMLFYIVGFALGLGPIPCMLPSETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIICTLSLIFVLLFLPETNGRSLDDIVMDFKRGYLWIPFRK-----KPYY 1534
            +++  L+L+      GSS LYGYN+A +N P   I+ F NE+      K     LSK+                N L++ T T+FV  G +G+F  GWIAD +GR+  L++N+   I+G ++   +    I  L+ +GRF IG+N G+T+GLA+++LTEI+P++ RGA+   HQ+ V  GI+   ++ +   L TE  W      T IP ILS  +LP CPESPR++ L +  E  AR   +++ + N  E  +      +E         KF++ QLF  + LRM L++   + + QQ SGINA+ +YS S+ + AG+ +   QY ++  G++NV+ T  +LPL++K GRR LLL+PS+++ + +L +  ++   +    LS         +S+  ++ YI+GFA GLGP+P ++  E FRQ PRGAA  + QA  WA N+IV FS+  M ++IG Y F+ F ++  +  +F  LF+PET  R+ DD+  D   G   I  +K     +P Y
Sbjct:   21 KISPTLILTVFLTCFGSSLLYGYNMAVINLPADRIKCFLNETVLNVPCKDAYDTLSKTFNSSIISGVKSGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLMNHIFVIIGAIINGLTVKTKIASLLFVGRFFIGINSGVTVGLASMYLTEIAPRAYRGAIGACHQLAVTVGIVIGYLLTMTHTLNTESLWPIACACTAIPAILSLILLPLCPESPRFIFLKQFKEDLAR---KEFIRLNRMEDVDVFLGELREEVEIAKNQPKFKFFQLFTQKDLRMPLIIACLIQVMQQLSGINAVISYSSSMLSTAGIPEVYSQYCVITIGILNVICTLSSLPLLEKFGRRILLLWPSILLAVSLLFLTITVNLVNAPGLLSLSNQKIVGGISVFFIMTYIIGFAFGLGPVPALIVGEIFRQEPRGAAYSVSQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVLVCWVFFFLFMPETKNRTFDDVARDLAFGTTVIGKKKTQELNRPIY 530          
The following BLAST results are available for this feature:
BLAST of slc2a-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC2A12.246e-11538.35solute carrier family 2 member 1 [Source:HGNC Symb... [more]
SLC2A31.070e-10137.01solute carrier family 2 member 3 [Source:HGNC Symb... [more]
SLC2A146.073e-9836.58solute carrier family 2 member 14 [Source:HGNC Sym... [more]
SLC2A146.073e-9836.58solute carrier family 2 member 14 [Source:HGNC Sym... [more]
SLC2A141.663e-9736.58solute carrier family 2 member 14 [Source:HGNC Sym... [more]
back to top
BLAST of slc2a-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fgt-16.613e-8332.98Facilitated glucose transporter protein 1 [Source... [more]
fgt-19.794e-8332.98Facilitated glucose transporter protein 1 [Source... [more]
R09B5.114.367e-7933.12Facilitated glucose transporter homolog [Source:U... [more]
R09B5.114.367e-7933.12Facilitated glucose transporter homolog [Source:U... [more]
F53H8.31.259e-5528.30pep chromosome:WBcel235:X:938516:942608:1 gene:WBG... [more]
back to top
BLAST of slc2a-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Glut11.395e-9936.97gene:FBgn0264574 transcript:FBtr0333493[more]
Glut11.413e-9936.97gene:FBgn0264574 transcript:FBtr0333496[more]
Glut11.413e-9936.97gene:FBgn0264574 transcript:FBtr0333497[more]
Glut13.586e-9936.97gene:FBgn0264574 transcript:FBtr0333498[more]
Glut11.400e-9837.06gene:FBgn0264574 transcript:FBtr0333499[more]
back to top
BLAST of slc2a-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc2a1b1.145e-11137.13solute carrier family 2 member 1b [Source:ZFIN;Acc... [more]
slc2a1a1.040e-10736.65solute carrier family 2 member 1a [Source:ZFIN;Acc... [more]
slc2a1a1.040e-10736.65solute carrier family 2 member 1a [Source:ZFIN;Acc... [more]
slc2a3a1.309e-10641.79solute carrier family 2 member 3a [Source:ZFIN;Acc... [more]
slc2a3a1.640e-10641.79solute carrier family 2 member 3a [Source:ZFIN;Acc... [more]
back to top
BLAST of slc2a-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc2a56.617e-10436.82solute carrier family 2 member 5 [Source:NCBI gene... [more]
slc2a52.727e-10336.97solute carrier family 2 member 5 [Source:NCBI gene... [more]
dnajc281.650e-10136.73DnaJ heat shock protein family (Hsp40) member C28 ... [more]
dnajc282.719e-10136.36DnaJ heat shock protein family (Hsp40) member C28 ... [more]
dnajc285.088e-10136.25DnaJ heat shock protein family (Hsp40) member C28 ... [more]
back to top
BLAST of slc2a-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc2a15.455e-11738.53solute carrier family 2 (facilitated glucose trans... [more]
Slc2a57.390e-10238.67solute carrier family 2 (facilitated glucose trans... [more]
Slc2a32.343e-9937.66solute carrier family 2 (facilitated glucose trans... [more]
Slc2a71.219e-9734.91solute carrier family 2 (facilitated glucose trans... [more]
Slc2a46.707e-9436.15solute carrier family 2 (facilitated glucose trans... [more]
back to top
BLAST of slc2a-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P27674|GTR1_BOVIN6.235e-11738.53Solute carrier family 2, facilitated glucose trans... [more]
sp|P79365|GTR1_SHEEP1.104e-11638.53Solute carrier family 2, facilitated glucose trans... [more]
sp|P20303|GTR1_PIG3.463e-11638.53Solute carrier family 2, facilitated glucose trans... [more]
sp|P17809|GTR1_MOUSE3.816e-11638.53Solute carrier family 2, facilitated glucose trans... [more]
sp|P46896|GTR1_CHICK2.937e-11538.74Solute carrier family 2, facilitated glucose trans... [more]
back to top
BLAST of slc2a-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YIQ80.000e+0100.00Slc2a-1 OS=Schmidtea mediterranea OX=79327 GN=slc2... [more]
A0A1S3JNR31.789e-13640.47solute carrier family 2, facilitated glucose trans... [more]
A0A267F3K81.520e-11941.33MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A267F5D12.079e-11840.93MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A267FPE72.177e-11840.93MFS domain-containing protein OS=Macrostomum ligna... [more]
back to top
BLAST of slc2a-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc2a3a1.005e-11441.31solute carrier family 2, facilitated glucose trans... [more]
slc2a3a5.904e-11141.15solute carrier family 2, facilitated glucose trans... [more]
slc2a1a2.139e-10936.04solute carrier family 2, facilitated glucose trans... [more]
slc2a1a1.039e-10836.54solute carrier family 2, facilitated glucose trans... [more]
slc2a1b2.548e-10836.50solute carrier family 2, facilitated glucose trans... [more]
back to top
BLAST of slc2a-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC2A91.019e-7833.56solute carrier family 2 member 9 [Source:HGNC Symb... [more]
slc2a11a1.617e-6030.24solute carrier family 2 member 11a [Source:ZFIN;Ac... [more]
slc2a11b5.585e-4131.60solute carrier family 2 member 11b [Source:NCBI ge... [more]
slc2a104.022e-1525.09solute carrier family 2 member 10 [Source:NCBI gen... [more]
ENSPMAT00000006105.12.643e-1034.58pep scaffold:Pmarinus_7.0:GL483550:10411:12132:-1 ... [more]
back to top
BLAST of slc2a-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HXT131.568e-3727.53Putative transmembrane polyol transporter; support... [more]
HXT171.956e-3727.53Putative transmembrane polyol transporter; support... [more]
HXT157.587e-3726.86Putative transmembrane polyol transporter; support... [more]
HXT73.680e-3626.87High-affinity glucose transporter; member of the m... [more]
HXT64.328e-3626.87High-affinity glucose transporter; member of the m... [more]
back to top
BLAST of slc2a-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO351203.774e-9334.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426671.920e-8133.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326154.306e-4129.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428612.397e-3730.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428622.669e-3028.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc2a-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc2a1a2.466e-11137.39solute carrier family 2, facilitated glucose trans... [more]
SLC2A45.795e-11136.97solute carrier family 2 member 4 [Source:NCBI gene... [more]
slc2a3b4.824e-11038.87solute carrier family 2, facilitated glucose trans... [more]
slc2a3a6.124e-11040.30solute carrier family 2, facilitated glucose trans... [more]
slc2a3a6.124e-11040.30solute carrier family 2, facilitated glucose trans... [more]
back to top
BLAST of slc2a-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072446.10.000e+0100.00SMESG000072446.1[more]
SMESG000072446.10.000e+0100.00SMESG000072446.1[more]
SMESG000081673.14.440e-10935.20SMESG000081673.1[more]
SMESG000081662.11.299e-10835.87SMESG000081662.1[more]
SMESG000081662.11.607e-10835.87SMESG000081662.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30008266
GenBankAKN21396.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008266 ID=SMED30008266|Name=slc2a-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1653bp
CAAATGAGCTAATAAATTCATTTTTCATTTTAATCCGAACCTCGCATCAT
CAGCTGAATACATGAAGTTCTCCGACATCAAAATGTTTCAGATGACCCGC
TGGCTTTTGTTGAGCAGCATCACTGTGGCATTAGGATCATCTTTTTTATA
TGGTTATAATGTAGCAAAATTGAATACACCGACACAAATGATTCAAGATT
TTTTCAATGAATCCTACACAAAACGTTATGGGTCTCCACTTTCGAAAAGT
AGACTGAATATCCTTTGGTCATTCACGGTGACGATATTCGTTGCCACTGG
AGCCGTTGGGTCTTTTATTTGTGGGTGGATCGCCGATAAAATTGGAAGAA
AAAGATCCCTTGTGTTGAATAATTTCTTAGCGATTGTTGGAGGTCTATTG
GAAGCGGCATCTAAACCCCTAATGATTCCAGAATTAATAATGATGGGAAG
ATTTATTATTGGTCTTAATTGTGGACTGACATTAGGTTTAGCAACAATTT
TCCTTACTGAAATTTCACCACAGAGTATTCGTGGTGCAGTAGCTAATTTC
CATCAAGTTGGCGTTGTTTTTGGAATTCTTGCTGCTCAGGTAATGGGACT
TGACTCCTTATTAGGAACTGAGAAGAATTGGAATTACCTACTTGGATTTA
CAATTATACCTCCGATACTTTCATGCTTTATTTTACCATTTTGTCCCGAA
AGTCCAAGGTATTTGATGCTATCAAAGAATGATGAAAAGGCAGCTAGATT
GAACATGGAAAAATATCATCAAAAAAACAGCCCTGAACTAGAAGAAGCCA
TTACAGACATGCAAAAGGAATATTTTGCGTCAACTGATGCTATTGGAAAA
TTCCAGTACACTCAATTATTCAGGGCTCGCAAATTGCGCATGGCACTCCT
GGTTGGGATTTCACTAATGATATGTCAACAATGGTCAGGAATTAATGCGA
TTTTTGCATACTCCGAATCATTGTTTACCCAGGCCGGGGTCAAGAAATCA
AATATACAATATGTGATTGTGGGAACTGGTTTGGTTAATGTTTTAATTAC
ATTTGTCAATTTGCCTCTCATGGATAAAGCAGGAAGACGTTCACTGCTGT
TATATCCATCAATGGTGATGATCATATGCATGCTTCTAATGATACCATCA
ATTGGATACCAACATAAATTCCCCTGGCTTTCTCACTTAAGTATTGTACT
TATGCTTTTTTATATTGTCGGATTTGCACTCGGTTTAGGACCAATACCAT
GCATGCTGCCATCAGAAACCTTTCGTCAAGGTCCAAGAGGAGCAGCAGTT
GGAATTGTTCAAGCATTTCACTGGGCAATGAATATGATTGTTACTTTCTC
GTTTAGGTTTATGGAAGAATCAATTGGGGAATATTTATTCATCATCTTCG
CAATTATATGCACATTAAGCTTAATTTTTGTACTGCTTTTCCTACCAGAA
ACAAATGGACGATCATTAGATGATATTGTTATGGATTTCAAGCGTGGATA
CCTTTGGATCCCATTTCGAAAGAAGCCTTATTATATTTATGCAAATGAAG
TTATCGCTGCCAATAAAGCACTTTATCAAACCGGGGGAGCAAATGTAACA
CTTGAAATAGAATAAACTAGTTAGCACAAAGGTTTTTTAAAAATGGTAAT
GAA
back to top

protein sequence of SMED30008266-orf-1

>SMED30008266-orf-1 ID=SMED30008266-orf-1|Name=SMED30008266-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=518bp
MKFSDIKMFQMTRWLLLSSITVALGSSFLYGYNVAKLNTPTQMIQDFFNE
SYTKRYGSPLSKSRLNILWSFTVTIFVATGAVGSFICGWIADKIGRKRSL
VLNNFLAIVGGLLEAASKPLMIPELIMMGRFIIGLNCGLTLGLATIFLTE
ISPQSIRGAVANFHQVGVVFGILAAQVMGLDSLLGTEKNWNYLLGFTIIP
PILSCFILPFCPESPRYLMLSKNDEKAARLNMEKYHQKNSPELEEAITDM
QKEYFASTDAIGKFQYTQLFRARKLRMALLVGISLMICQQWSGINAIFAY
SESLFTQAGVKKSNIQYVIVGTGLVNVLITFVNLPLMDKAGRRSLLLYPS
MVMIICMLLMIPSIGYQHKFPWLSHLSIVLMLFYIVGFALGLGPIPCMLP
SETFRQGPRGAAVGIVQAFHWAMNMIVTFSFRFMEESIGEYLFIIFAIIC
TLSLIFVLLFLPETNGRSLDDIVMDFKRGYLWIPFRKKPYYIYANEVIAA
NKALYQTGGANVTLEIE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR003663Sugar/inositol_transpt
IPR005828MFS_sugar_transport-like
IPR005829Sugar_transporter_CS
IPR020846MFS_dom
Vocabulary: molecular function
TermDefinition
GO:0022891substrate-specific transmembrane transporter activity
GO:0022857transmembrane transporter activity
GO:0005215transporter activity
GO:0033300dehydroascorbic acid transporter activity
GO:0042802identical protein binding
GO:0043621protein self-association
GO:0055056D-glucose transmembrane transporter activity
GO:0005355glucose transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006461protein complex assembly
GO:0006810transport
GO:0008643carbohydrate transport
GO:0015758glucose transport
GO:0042149cellular response to glucose starvation
GO:0046323glucose import
GO:0070837dehydroascorbic acid transport
GO:1904659glucose transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0016323basolateral plasma membrane
GO:0016324apical plasma membrane
GO:0030496midbody
GO:0030864cortical actin cytoskeleton
GO:0031982vesicle
GO:0042470melanosome
GO:0045121membrane raft
GO:0070062extracellular exosome
GO:0072562blood microparticle
GO:0001939female pronucleus
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003663Sugar/inositol transporterPRINTSPR00171SUGRTRNSPORTcoord: 27..37
score: 28.18
coord: 378..399
score: 31.25
coord: 401..413
score: 38.01
coord: 127..146
score: 32.08
coord: 289..299
score: 54.02
IPR003663Sugar/inositol transporterTIGRFAMTIGR00879TIGR00879coord: 12..472
e-value: 1.7E-92
score: 308.6
IPR005828Major facilitator, sugar transporter-likePFAMPF00083Sugar_trcoord: 20..473
e-value: 7.1E-112
score: 374.5
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 4..478
e-value: 1.6E-131
score: 441.3
NoneNo IPR availablePANTHERPTHR23503FAMILY NOT NAMEDcoord: 16..478
NoneNo IPR availableCDDcd17432MFS_GLUT_Class2coord: 19..472
e-value: 1.27252E-139
score: 408.543
NoneNo IPR availableTMHMMTMhelixcoord: 411..433
NoneNo IPR availableTMHMMTMhelixcoord: 65..87
NoneNo IPR availableTMHMMTMhelixcoord: 190..212
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 161..180
NoneNo IPR availableTMHMMTMhelixcoord: 126..148
NoneNo IPR availableTMHMMTMhelixcoord: 315..337
NoneNo IPR availableTMHMMTMhelixcoord: 438..460
NoneNo IPR availableTMHMMTMhelixcoord: 278..300
NoneNo IPR availableTMHMMTMhelixcoord: 100..122
NoneNo IPR availableTMHMMTMhelixcoord: 376..398
NoneNo IPR availableTMHMMTMhelixcoord: 344..366
IPR005829Sugar transporter, conserved sitePROSITEPS00217SUGAR_TRANSPORT_2coord: 132..157
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 19..465
score: 41.599
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 10..471