Progesterone receptor membrane component 1

Overview
NameProgesterone receptor membrane component 1
Smed IDSMED30008259
Length (bp)1785
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008259

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30008259SMESG000010967.1 Contig3231GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008259SMESG000069126.1 Contig3231GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30008259SMESG000069126.1 SMESG000069122.1 dd_Smed_v4_2076_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30008259SMESG000069126.1 SMESG000069122.1 dd_Smed_v4_2076_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30008259SMESG000069126.1 SMESG000069122.1 dd_Smed_v4_2076_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008259SMESG000069126.1 SMESG000069122.1 dd_Smed_v4_2076_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30008259SMESG000069126.1 SMESG000069122.1 dd_Smed_v4_2076_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Human
Match: PGRMC2 (progesterone receptor membrane component 2 [Source:HGNC Symbol;Acc:HGNC:16089])

HSP 1 Score: 129.028 bits (323), Expect = 1.868e-33
Identity = 71/160 (44.38%), Postives = 105/160 (65.62%), Query Frame = 1
Query:  175 LNIILLSVCCYLLYKIY---------KLRTMEVELPVIKKKKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPGEVCEIVDSEED 627
            LN+ L+++     Y+++                E P     ++ KR+ +LEQLR++DG +N  I++A+NGK++DVT G  FYGP GPYG  AGRDA+R LATFCLD  +L+++YDD+SDL+  +M+ ++EWEMQF+ KY  +G+LL+PGE       EED
Sbjct:   56 LNVALVALVLLGAYRLWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEED 215          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Human
Match: PGRMC2 (progesterone receptor membrane component 2 [Source:HGNC Symbol;Acc:HGNC:16089])

HSP 1 Score: 129.028 bits (323), Expect = 1.868e-33
Identity = 71/160 (44.38%), Postives = 105/160 (65.62%), Query Frame = 1
Query:  175 LNIILLSVCCYLLYKIY---------KLRTMEVELPVIKKKKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPGEVCEIVDSEED 627
            LN+ L+++     Y+++                E P     ++ KR+ +LEQLR++DG +N  I++A+NGK++DVT G  FYGP GPYG  AGRDA+R LATFCLD  +L+++YDD+SDL+  +M+ ++EWEMQF+ KY  +G+LL+PGE       EED
Sbjct:   56 LNVALVALVLLGAYRLWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEED 215          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Human
Match: PGRMC2 (progesterone receptor membrane component 2 [Source:HGNC Symbol;Acc:HGNC:16089])

HSP 1 Score: 129.028 bits (323), Expect = 3.587e-33
Identity = 71/160 (44.38%), Postives = 105/160 (65.62%), Query Frame = 1
Query:  175 LNIILLSVCCYLLYKIY---------KLRTMEVELPVIKKKKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPGEVCEIVDSEED 627
            LN+ L+++     Y+++                E P     ++ KR+ +LEQLR++DG +N  I++A+NGK++DVT G  FYGP GPYG  AGRDA+R LATFCLD  +L+++YDD+SDL+  +M+ ++EWEMQF+ KY  +G+LL+PGE       EED
Sbjct:   80 LNVALVALVLLGAYRLWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEED 239          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Human
Match: PGRMC1 (progesterone receptor membrane component 1 [Source:HGNC Symbol;Acc:HGNC:16090])

HSP 1 Score: 119.783 bits (299), Expect = 1.558e-30
Identity = 81/181 (44.75%), Postives = 120/181 (66.30%), Query Frame = 1
Query:  148 LIYDLFSSPLNIILLSVCCYLLYKIYKLRTMEV-------ELPVIKKKKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPGEVCEIVDSEEDENSVPVSETKSKSD 669
            L++++F+SPLN++LL +C +LLYKI +             E P + + K  +R+ T  +LR FDGV++  I++A+NGK++DVT G  FYGP GPYG  AGRDA+R LATFCLD  +LK++YDD+SDL+ ++ + + +WE QF  KY  +GKLL+ GE   +   EE+    P  E+  K+D
Sbjct:   21 LLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPAASGDSDDDEPPPLPRLK--RRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEE----PKDESARKND 195          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Human
Match: PGRMC2 (progesterone receptor membrane component 2 [Source:HGNC Symbol;Acc:HGNC:16089])

HSP 1 Score: 87.0409 bits (214), Expect = 2.963e-20
Identity = 38/70 (54.29%), Postives = 53/70 (75.71%), Query Frame = 1
Query:  418 LAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPGEVCEIVDSEED 627
             AGRDA+R LATFCLD  +L+++YDD+SDL+  +M+ ++EWEMQF+ KY  +G+LL+PGE       EED
Sbjct:   14 FAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEED 83          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Celegans
Match: vem-1 (pep chromosome:WBcel235:X:8087555:8089427:-1 gene:WBGene00006890.1 transcript:K07E3.8.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:vem-1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.857e-22
Identity = 56/138 (40.58%), Postives = 85/138 (61.59%), Query Frame = 1
Query:  181 IILLSVCCYLLYKIYKLRTMEVELPVIKKK--KIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLR 588
            + L+ V  +  Y + +    E  LP   K+   +   ++T+E+LR++DGVKNE I+  LNG +YDVT G  FYGP   YG LAG DATRAL T  +D +++  ++DD + +S  E +   EWE QF+ KY  +G+L++
Sbjct:   15 VFLVVVLGFFFYWLTR---SEQPLPAPPKELAPLPMSDMTVEELRKYDGVKNEHILFGLNGTIYDVTRGKGFYGPGKAYGTLAGHDATRALGT--MDQNAVSSEWDDHTGISADEQETANEWETQFKFKYLTVGRLVK 147          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Celegans
Match: vem-1 (pep chromosome:WBcel235:X:8087554:8088574:-1 gene:WBGene00006890.1 transcript:K07E3.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:vem-1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.857e-22
Identity = 56/138 (40.58%), Postives = 85/138 (61.59%), Query Frame = 1
Query:  181 IILLSVCCYLLYKIYKLRTMEVELPVIKKK--KIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLR 588
            + L+ V  +  Y + +    E  LP   K+   +   ++T+E+LR++DGVKNE I+  LNG +YDVT G  FYGP   YG LAG DATRAL T  +D +++  ++DD + +S  E +   EWE QF+ KY  +G+L++
Sbjct:   15 VFLVVVLGFFFYWLTR---SEQPLPAPPKELAPLPMSDMTVEELRKYDGVKNEHILFGLNGTIYDVTRGKGFYGPGKAYGTLAGHDATRALGT--MDQNAVSSEWDDHTGISADEQETANEWETQFKFKYLTVGRLVK 147          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Celegans
Match: spsb-2 (SPSB (SPry and Socs Box) family [Source:UniProtKB/TrEMBL;Acc:Q965N7])

HSP 1 Score: 67.0106 bits (162), Expect = 2.987e-12
Identity = 60/235 (25.53%), Postives = 99/235 (42.13%), Query Frame = 1
Query:  895 GEILKSIIKWSSHDKSPAVSL-SENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCP-----AFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCSM-----------ENFSKLPIPGCLKELLV 1548
              +++    W+  D+SP + +  ++K   Y H  P    N T  IR  +G+S G   W+    E   GT  +VGV TK APL   +  Y  L+G +++S+G +      H G  K   P       ++    I C L++  G L F  D     V FQ +    G+ L+   ++     EI +T     + +L+ + +  +F  C             +    L IP  +KE L+
Sbjct:   18 NRLIQEQHSWNPDDRSPNIIVKDQDKLTLYRHPVP----NCTDCIRGKMGYSRGFHVWQIEWPERQRGTHAVVGVATKNAPLQAAE--YTTLVGSNNESYGWNIATRECHYGSWKWKYPYGNGRDGFNVPEKIYCILDMEQGNLSFATDNEYLGVVFQNL---RGKRLYPAVATLYGDCEITMT----HLGSLEPVEMLPLFELCRRRFRSIMGPDPDKRIKPLMIPPVMKEYLL 239          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Celegans
Match: spsb-1 (SPSB (SPry and Socs Box) family [Source:UniProtKB/TrEMBL;Acc:U4PM56])

HSP 1 Score: 65.4698 bits (158), Expect = 2.998e-11
Identity = 59/235 (25.11%), Postives = 103/235 (43.83%), Query Frame = 1
Query:  898 EILKSIIKWSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAF--------YSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMN----TLQELC---LGVIFRCCSMENFSKLPIPGCLKELLVSTF 1557
            + ++    W+  D+S  + + +      FH  P+  + ST  IR  +G+S G   W+    E   GT  +VGV TK APLH     Y  LIG  D+S+G        H+  +      +        Y+      C L++ +G + F  D+    VAF+ +    G++L+ + ++     EI++  Y  S+     +L ELC   + +       ++  +L IP  LK  L+  +
Sbjct:  127 QFIQEQHSWNPEDRSLNIFVKDEDKFT-FHRHPV--AQSTDCIRGKMGYSRGFHVWQIEWPERQRGTHAVVGVATKNAPLHAA--GYTALIGTTDESYGWDITRRECHHDSKHTMTWRYPFSNSRDVYNVPDKFYCILDMDEGYMAFATDDEFLGVAFRNL---KGKTLYPIVAAVWGHCEISM-RYLGSLEPEPLSLSELCRRRVRIEMGAQPEDHIEQLMIPPILKRYLMYQY 352          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Celegans
Match: spsb-1 (SPSB (SPry and Socs Box) family [Source:UniProtKB/TrEMBL;Acc:U4PM56])

HSP 1 Score: 65.4698 bits (158), Expect = 3.328e-11
Identity = 59/235 (25.11%), Postives = 103/235 (43.83%), Query Frame = 1
Query:  898 EILKSIIKWSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAF--------YSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMN----TLQELC---LGVIFRCCSMENFSKLPIPGCLKELLVSTF 1557
            + ++    W+  D+S  + + +      FH  P+  + ST  IR  +G+S G   W+    E   GT  +VGV TK APLH     Y  LIG  D+S+G        H+  +      +        Y+      C L++ +G + F  D+    VAF+ +    G++L+ + ++     EI++  Y  S+     +L ELC   + +       ++  +L IP  LK  L+  +
Sbjct:  125 QFIQEQHSWNPEDRSLNIFVKDEDKFT-FHRHPV--AQSTDCIRGKMGYSRGFHVWQIEWPERQRGTHAVVGVATKNAPLHAA--GYTALIGTTDESYGWDITRRECHHDSKHTMTWRYPFSNSRDVYNVPDKFYCILDMDEGYMAFATDDEFLGVAFRNL---KGKTLYPIVAAVWGHCEISM-RYLGSLEPEPLSLSELCRRRVRIEMGAQPEDHIEQLMIPPILKRYLMYQY 350          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Fly
Match: MSBP (gene:FBgn0030703 transcript:FBtr0301598)

HSP 1 Score: 133.65 bits (335), Expect = 3.625e-35
Identity = 80/179 (44.69%), Postives = 121/179 (67.60%), Query Frame = 1
Query:  145 TLIYDLFSSPLNIILLSVCCYLLYKIYKLRTMEVELPVIKKKKI----IKRNLTLEQLREFDGVKNES-IIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPGEVCEIVDSEEDENSVPVSETKSKS 666
             +I ++  SP+N+ LL++ C+L+YKI + RT    + V K  +     I+R+ T+++LR++DG + +  +++A+NG +YDV+ G  FYGP GPY   AGRDA+R LATF +  S  K++YDD+SDLS  EMD ++EWEMQF+ KY ++GKLLR GE     D +EDE +V   E + K+
Sbjct:   31 NIIREILYSPMNLALLAIICFLVYKIVRDRTEVPSVGVAKPSEPELPKIRRDFTVKELRQYDGTQPDGRVLVAVNGSVYDVSKGRRFYGPGGPYATFAGRDASRNLATFSV-VSIDKDEYDDLSDLSAVEMDSVREWEMQFKEKYELVGKLLRKGEEPTNYDDDEDEENVNNDEQERKN 208          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Fly
Match: MSBP (gene:FBgn0030703 transcript:FBtr0074166)

HSP 1 Score: 133.65 bits (335), Expect = 3.625e-35
Identity = 80/179 (44.69%), Postives = 121/179 (67.60%), Query Frame = 1
Query:  145 TLIYDLFSSPLNIILLSVCCYLLYKIYKLRTMEVELPVIKKKKI----IKRNLTLEQLREFDGVKNES-IIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPGEVCEIVDSEEDENSVPVSETKSKS 666
             +I ++  SP+N+ LL++ C+L+YKI + RT    + V K  +     I+R+ T+++LR++DG + +  +++A+NG +YDV+ G  FYGP GPY   AGRDA+R LATF +  S  K++YDD+SDLS  EMD ++EWEMQF+ KY ++GKLLR GE     D +EDE +V   E + K+
Sbjct:   31 NIIREILYSPMNLALLAIICFLVYKIVRDRTEVPSVGVAKPSEPELPKIRRDFTVKELRQYDGTQPDGRVLVAVNGSVYDVSKGRRFYGPGGPYATFAGRDASRNLATFSV-VSIDKDEYDDLSDLSAVEMDSVREWEMQFKEKYELVGKLLRKGEEPTNYDDDEDEENVNNDEQERKN 208          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Fly
Match: MSBP (gene:FBgn0030703 transcript:FBtr0333719)

HSP 1 Score: 133.65 bits (335), Expect = 3.625e-35
Identity = 80/179 (44.69%), Postives = 121/179 (67.60%), Query Frame = 1
Query:  145 TLIYDLFSSPLNIILLSVCCYLLYKIYKLRTMEVELPVIKKKKI----IKRNLTLEQLREFDGVKNES-IIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPGEVCEIVDSEEDENSVPVSETKSKS 666
             +I ++  SP+N+ LL++ C+L+YKI + RT    + V K  +     I+R+ T+++LR++DG + +  +++A+NG +YDV+ G  FYGP GPY   AGRDA+R LATF +  S  K++YDD+SDLS  EMD ++EWEMQF+ KY ++GKLLR GE     D +EDE +V   E + K+
Sbjct:   31 NIIREILYSPMNLALLAIICFLVYKIVRDRTEVPSVGVAKPSEPELPKIRRDFTVKELRQYDGTQPDGRVLVAVNGSVYDVSKGRRFYGPGGPYATFAGRDASRNLATFSV-VSIDKDEYDDLSDLSAVEMDSVREWEMQFKEKYELVGKLLRKGEEPTNYDDDEDEENVNNDEQERKN 208          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Fly
Match: SP555 (gene:FBgn0260470 transcript:FBtr0333535)

HSP 1 Score: 100.523 bits (249), Expect = 4.448e-23
Identity = 67/207 (32.37%), Postives = 101/207 (48.79%), Query Frame = 1
Query:  922 WSSHDKSPAVSLS-ENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFY-SKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFR----CCSMENFSKLPIP 1524
            WS   +S  V L   N    +FH +    S  TAG++     + G   W+  + +   GTS+M G+GTK A LH     + N++G ++  WGLS+KG++WH GV   +   F  ++ T I    + ++GTL F  D     VAF+G   +  E L+ +  STAA  E+ +         LQ+ C  VI R       +E   KLP+P
Sbjct:   67 WSKRHRSKEVVLRGPNSRTVHFHPN---WSKGTAGVQGKRSLNNGRHYWELHVSQRVFGTSIMFGIGTKSARLHAN--AFRNMLGENEHGWGLSHKGVLWHEGVALLYTKRFRENQPTQIGVLFDGIEGTLTFYKDGKCLGVAFRG-LDQIDEPLYPIVCSTAAKTEMTLKCTRREFVNLQDRCRAVIMRRVRSAAQLEKL-KLPLP 266          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Fly
Match: SP555 (gene:FBgn0260470 transcript:FBtr0079005)

HSP 1 Score: 100.523 bits (249), Expect = 4.448e-23
Identity = 67/207 (32.37%), Postives = 101/207 (48.79%), Query Frame = 1
Query:  922 WSSHDKSPAVSLS-ENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFY-SKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFR----CCSMENFSKLPIP 1524
            WS   +S  V L   N    +FH +    S  TAG++     + G   W+  + +   GTS+M G+GTK A LH     + N++G ++  WGLS+KG++WH GV   +   F  ++ T I    + ++GTL F  D     VAF+G   +  E L+ +  STAA  E+ +         LQ+ C  VI R       +E   KLP+P
Sbjct:   67 WSKRHRSKEVVLRGPNSRTVHFHPN---WSKGTAGVQGKRSLNNGRHYWELHVSQRVFGTSIMFGIGTKSARLHAN--AFRNMLGENEHGWGLSHKGVLWHEGVALLYTKRFRENQPTQIGVLFDGIEGTLTFYKDGKCLGVAFRG-LDQIDEPLYPIVCSTAAKTEMTLKCTRREFVNLQDRCRAVIMRRVRSAAQLEKL-KLPLP 266          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Zebrafish
Match: si:dkey-23n7.10 (si:dkey-23n7.10 [Source:ZFIN;Acc:ZDB-GENE-141222-64])

HSP 1 Score: 171.4 bits (433), Expect = 4.423e-49
Identity = 87/206 (42.23%), Postives = 124/206 (60.19%), Query Frame = 1
Query:  919 KWSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCSMENFSK-LPIPGCL 1533
            +W    KSP   +S  +   YFH+ P+ +S  TAG+R   GF+ G   W+   LEPP G+SVMVGVGT+ A LH GD  +VNLIG D +SWGLSYKG IWH G  +++  AFY + T I   L+L  GTL F  +  +  VAF G+  + G++L+ + SSTA   E+ +   +  +++LQE C+ +I +  S    +K LP+P  L
Sbjct:   14 EWDPDSKSPDAHVSVCRQAVYFHISPLLDSQGTAGVRGTKGFTHGEHYWEIEFLEPPYGSSVMVGVGTQNALLHTGDQTFVNLIGMDSESWGLSYKGYIWHKGRSRKYTEAFYERNTVIGVLLDLSAGTLTFSRNGVNLGVAFTGL-EQVGKALYPLVSSTAPETELQLGLRSQRISSLQEHCIHIITQSLSQGRRAKGLPLPASL 218          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Zebrafish
Match: pgrmc1 (progesterone receptor membrane component 1 [Source:ZFIN;Acc:ZDB-GENE-041114-91])

HSP 1 Score: 125.561 bits (314), Expect = 4.847e-33
Identity = 81/161 (50.31%), Postives = 112/161 (69.57%), Query Frame = 1
Query:  148 LIYDLFSSPLNIILLSVCCYLLYKIYKLRTMEVELPVIKK-KKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPG-EVCEIVDSEE 624
            ++ ++F+SPLNI LL +C +LLYKI +        PV +   K+ KR+ TL  L+E+DG+KN  I++A+NGK++DVT G  FYGP GPYG  AG+DA+R LATFCL+  +LK+ +DD+SDL+  + + + EWE QF  KY  IGKLL+PG E  E  D EE
Sbjct:   12 ILQEIFTSPLNISLLCLCLFLLYKIIRGDKPADYGPVEEPLPKLKKRDFTLADLQEYDGLKNPRILMAVNGKVFDVTRGKKFYGPEGPYGVFAGKDASRGLATFCLEKEALKDTHDDLSDLNAMQQESLSEWETQFTQKYDYIGKLLKPGEEPTEYTDDEE 172          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Zebrafish
Match: pgrmc1 (progesterone receptor membrane component 1 [Source:ZFIN;Acc:ZDB-GENE-041114-91])

HSP 1 Score: 125.561 bits (314), Expect = 4.847e-33
Identity = 81/161 (50.31%), Postives = 112/161 (69.57%), Query Frame = 1
Query:  148 LIYDLFSSPLNIILLSVCCYLLYKIYKLRTMEVELPVIKK-KKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPG-EVCEIVDSEE 624
            ++ ++F+SPLNI LL +C +LLYKI +        PV +   K+ KR+ TL  L+E+DG+KN  I++A+NGK++DVT G  FYGP GPYG  AG+DA+R LATFCL+  +LK+ +DD+SDL+  + + + EWE QF  KY  IGKLL+PG E  E  D EE
Sbjct:   12 ILQEIFTSPLNISLLCLCLFLLYKIIRGDKPADYGPVEEPLPKLKKRDFTLADLQEYDGLKNPRILMAVNGKVFDVTRGKKFYGPEGPYGVFAGKDASRGLATFCLEKEALKDTHDDLSDLNAMQQESLSEWETQFTQKYDYIGKLLKPGEEPTEYTDDEE 172          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Zebrafish
Match: pgrmc2 (progesterone receptor membrane component 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2102])

HSP 1 Score: 123.635 bits (309), Expect = 5.335e-32
Identity = 70/148 (47.30%), Postives = 102/148 (68.92%), Query Frame = 1
Query:  196 VCCYLLYKIYKLRTMEVELPVIKKK----KIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPG-EVCEIVDSEE 624
              CY+LY  +  R    +L    +     K+ +R+ TL+QLR++DGV+N  I++A+N K++DVTSG  FYG  GPYG  AGRDA+R LATFCL+  +L+++YDD+SDL+  +M+ ++EWEMQF  KY  +G+LL+PG E  E  D E+
Sbjct:   47 AACYVLYARW-WRRAGADLGRGSEASPLPKMRRRDFTLQQLRDYDGVQNPRILMAVNTKVFDVTSGKKFYGREGPYGIFAGRDASRGLATFCLEKDALRDEYDDLSDLNAVQMESVREWEMQFMEKYDYVGRLLKPGDEPSEYTDEED 193          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Zebrafish
Match: pgrmc2 (progesterone receptor membrane component 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2102])

HSP 1 Score: 123.635 bits (309), Expect = 5.335e-32
Identity = 70/148 (47.30%), Postives = 102/148 (68.92%), Query Frame = 1
Query:  196 VCCYLLYKIYKLRTMEVELPVIKKK----KIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPG-EVCEIVDSEE 624
              CY+LY  +  R    +L    +     K+ +R+ TL+QLR++DGV+N  I++A+N K++DVTSG  FYG  GPYG  AGRDA+R LATFCL+  +L+++YDD+SDL+  +M+ ++EWEMQF  KY  +G+LL+PG E  E  D E+
Sbjct:   47 AACYVLYARW-WRRAGADLGRGSEASPLPKMRRRDFTLQQLRDYDGVQNPRILMAVNTKVFDVTSGKKFYGREGPYGIFAGRDASRGLATFCLEKDALRDEYDDLSDLNAVQMESVREWEMQFMEKYDYVGRLLKPGDEPSEYTDEED 193          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Xenopus
Match: ints13 (integrator complex subunit 13 [Source:Xenbase;Acc:XB-GENE-997276])

HSP 1 Score: 172.555 bits (436), Expect = 3.332e-49
Identity = 90/211 (42.65%), Postives = 122/211 (57.82%), Query Frame = 1
Query:  922 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCSMENFSK-LPIPGCLKELLVS 1551
            W +H ++P   LS    V YFH DP+ ES  TAG+R + GF  G   W+   LEPP G SVMVGVGT +A LH GD+ +VNL+G D +SWGLSYKG  WH G  +++   FY K T I   LN+ +GTL F  +     VAF G   K    L+ M SST+ G E+A+     ++ +LQE CL  +    + ++    LP+P  ++ LL S
Sbjct:   23 WDAHCQTPGTELSPCHRVVYFHTDPVLESCGTAGMRGSTGFLHGEHYWEIEFLEPPSGLSVMVGVGTGRAALHAGDFQFVNLLGMDTESWGLSYKGTAWHGGTSRRYTEPFYEKGTVIGVHLNIDEGTLAFYRNRQSLGVAFTG-LQKVQSPLYPMVSSTSPGTELAVGLQCSTLPSLQERCLSTLAHSLAQKDMVDCLPLPAAVRWLLKS 232          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Xenopus
Match: ints13 (integrator complex subunit 13 [Source:Xenbase;Acc:XB-GENE-997276])

HSP 1 Score: 172.94 bits (437), Expect = 3.519e-49
Identity = 90/211 (42.65%), Postives = 123/211 (58.29%), Query Frame = 1
Query:  922 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCSMENFSK-LPIPGCLKELLVS 1551
            W +H ++P   LS    V YFH DP+ ES  TAG+R + GF  G   W+   LEPP G SVMVGVGT +A LH GD+ +VNL+G D +SWGLSYKG  WH G  +++   FY K T I   LN+ +GTL F  +     VAF G+  K    L+ M SST+ G E+A+     ++ +LQE CL  +    + ++    LP+P  ++ LL S
Sbjct:   32 WDAHCQTPGTELSPCHRVVYFHTDPVLESCGTAGMRGSTGFLHGEHYWEIEFLEPPSGLSVMVGVGTGRAALHAGDFQFVNLLGMDTESWGLSYKGTAWHGGTSRRYTEPFYEKGTVIGVHLNIDEGTLAFYRNRQSLGVAFTGL-QKVQSPLYPMVSSTSPGTELAVGLQCSTLPSLQERCLSTLAHSLAQKDMVDCLPLPAAVRWLLKS 241          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Xenopus
Match: PGRMC2 (progesterone receptor membrane component 2 [Source:NCBI gene;Acc:394928])

HSP 1 Score: 126.331 bits (316), Expect = 5.969e-33
Identity = 68/141 (48.23%), Postives = 99/141 (70.21%), Query Frame = 1
Query:  205 YLLYKIYKLRTMEVELPVIKKKKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPGEVCEIVDSEED 627
            Y  ++IY          V    ++ +R+ TL+QL+E+DG +N  I++A+NGK++DVT G  FYGP+GPYG  AGRDA+R LATFCLD  +L+++YDD+SDL+  +M+ ++EWEMQF+ KY  +G+LL+PGE       EED
Sbjct:   46 YGAFRIYLRWKGSGSGGVASLPRMKRRDFTLQQLQEYDGTRNPRILLAVNGKVFDVTQGSKFYGPDGPYGLFAGRDASRGLATFCLDKEALRDEYDDLSDLNAVQMESVREWEMQFKEKYEYVGRLLKPGEEPSEYTDEED 186          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Xenopus
Match: ubap1 (ubiquitin associated protein 1 [Source:Xenbase;Acc:XB-GENE-947302])

HSP 1 Score: 120.939 bits (302), Expect = 2.983e-31
Identity = 82/179 (45.81%), Postives = 121/179 (67.60%), Query Frame = 1
Query:  148 LIYDLFSSPLNIILLSVCCYLLYKIYK------LRTMEVELPVIKKKKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPGEVCEIVDSEEDENSVPVSETKSKS 666
            ++ ++F+SPLNI LL +C YLLYKI +          E +LP +K+     R+ T  +L+E+DGV+N  I++A++GK++DVT G  FYGP GPYG  AGRDA+R LATFCLD  +LK+ YDD+SDL+ ++ + + +WE QF  KY  +GKLL+ GE  E  +  +DE++   S+ K K+
Sbjct:    6 ILQEIFTSPLNICLLCLCLYLLYKILRGDKPQTTENNEEQLPKMKR-----RDFTPAELKEYDGVQNPRILMAISGKVFDVTRGKKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDTYDDLSDLTATQRETLSDWEAQFTFKYHHVGKLLKDGE--EPTEYTDDEDAKDTSDLKKKN 177          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Xenopus
Match: spsb3 (splA/ryanodine receptor domain and SOCS box containing 3 [Source:NCBI gene;Acc:550104])

HSP 1 Score: 90.8929 bits (224), Expect = 4.060e-19
Identity = 67/210 (31.90%), Postives = 98/210 (46.67%), Query Frame = 1
Query:  922 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCC--SMENFSKLPIPGCLKELL 1545
            W    KS A  LS +     FH++    S  TA IR N   + G   W+  +  P  GT +MVG+GT    L    + + +L+G D +SWGLSY GL+ H G +  F   F  + + I   L+   G L F  +     VA   +  K    LF M  STAA   + +    C   +LQ LC   + +    S+++   LP+P  LK++L
Sbjct:  107 WDDCSKSTATVLSCDNRKVSFHME---YSCGTAAIRGNRMLTEGQHFWEIKMTSPVYGTDMMVGIGTSDVNLDKYRHTFCSLLGKDAESWGLSYTGLLQHKGDKSNFSSRF-GQGSIIGVHLDTWHGVLTFYKNRKCIGVAATQLRNK---KLFPMVCSTAAKSSMKVIRSCCCRTSLQYLCCARLRQLLPDSVDSLEVLPLPPGLKQVL 309          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Mouse
Match: Pgrmc2 (progesterone receptor membrane component 2 [Source:MGI Symbol;Acc:MGI:1918054])

HSP 1 Score: 127.487 bits (319), Expect = 3.260e-33
Identity = 72/160 (45.00%), Postives = 106/160 (66.25%), Query Frame = 1
Query:  175 LNIILLSVC---CYLLYKIYKLRTM------EVELPVIKKKKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPGEVCEIVDSEED 627
            LN+ L+++     Y L+  +  R +        E P     ++ KR+ +LEQLR++DG +   I++A+NGK++DVT G  FYGP GPYG  AGRDA+R LATFCLD  +L+++YDD+SDL+  +M+ ++EWEMQF+ KY  +G+LL+PGE       EED
Sbjct:   50 LNVALVALVLLGAYRLWVRWGRRGLCSGPGAGEESPAATLPRMKKRDFSLEQLRQYDGARTPRILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEED 209          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Mouse
Match: Pgrmc1 (progesterone receptor membrane component 1 [Source:MGI Symbol;Acc:MGI:1858305])

HSP 1 Score: 120.168 bits (300), Expect = 8.192e-31
Identity = 80/181 (44.20%), Postives = 121/181 (66.85%), Query Frame = 1
Query:  148 LIYDLFSSPLNIILLSVCCYLLYKIYKLRTMEV-------ELPVIKKKKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPGEVCEIVDSEEDENSVPVSETKSKSD 669
            L++++F+SPLN++LL +C +LLYKI +             E P + + K  +R+ T  +LR FDGV++  I++A+NGK++DVT G  FYGP GPYG  AGRDA+R LATFCLD  +LK++YDD+SDL+P++ + + +W+ QF  KY  +GKLL+ GE   +   +E+    P  ET  K++
Sbjct:   21 LLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPGASGDNDDDEPPPLPRLK--RRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTPAQQETLSDWDSQFTFKYHHVGKLLKEGEEPTVYSDDEE----PKDETARKNE 195          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Mouse
Match: Spsb3 (splA/ryanodine receptor domain and SOCS box containing 3 [Source:MGI Symbol;Acc:MGI:1891471])

HSP 1 Score: 83.9593 bits (206), Expect = 5.404e-17
Identity = 65/210 (30.95%), Postives = 94/210 (44.76%), Query Frame = 1
Query:  922 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVI--FRCCSMENFSKLPIPGCLKELL 1545
            W   +KS A  LS +     FH++    S  TA IR       G   W+  +  P  GT +MVG+GT    L    + + +L+G D+ SWGLSY GL+ H G +  F   F  + + I   L+   GTL F  +     VA   +        + M  STAA   + +     S  +LQ LC   +   R  S +    LP+P  LK++L
Sbjct:  107 WDDLNKSSATLLSCDNRKVSFHME---YSCGTAAIRGTKELGDGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYHHTFCSLLGRDEDSWGLSYTGLLHHKGDKTSFSSRF-GQGSIIGVHLDTWHGTLTFFKNRKCIGVAATRL---QNRRFYPMVCSTAAKSSMKVIRSCASSTSLQYLCCYRLRQLRPNSGDTLEGLPLPPGLKQVL 309          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Mouse
Match: Spsb3 (splA/ryanodine receptor domain and SOCS box containing 3 [Source:MGI Symbol;Acc:MGI:1891471])

HSP 1 Score: 83.9593 bits (206), Expect = 5.404e-17
Identity = 65/210 (30.95%), Postives = 94/210 (44.76%), Query Frame = 1
Query:  922 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVI--FRCCSMENFSKLPIPGCLKELL 1545
            W   +KS A  LS +     FH++    S  TA IR       G   W+  +  P  GT +MVG+GT    L    + + +L+G D+ SWGLSY GL+ H G +  F   F  + + I   L+   GTL F  +     VA   +        + M  STAA   + +     S  +LQ LC   +   R  S +    LP+P  LK++L
Sbjct:  107 WDDLNKSSATLLSCDNRKVSFHME---YSCGTAAIRGTKELGDGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYHHTFCSLLGRDEDSWGLSYTGLLHHKGDKTSFSSRF-GQGSIIGVHLDTWHGTLTFFKNRKCIGVAATRL---QNRRFYPMVCSTAAKSSMKVIRSCASSTSLQYLCCYRLRQLRPNSGDTLEGLPLPPGLKQVL 309          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Mouse
Match: Spsb3 (splA/ryanodine receptor domain and SOCS box containing 3 [Source:MGI Symbol;Acc:MGI:1891471])

HSP 1 Score: 83.9593 bits (206), Expect = 6.466e-17
Identity = 65/210 (30.95%), Postives = 94/210 (44.76%), Query Frame = 1
Query:  922 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVI--FRCCSMENFSKLPIPGCLKELL 1545
            W   +KS A  LS +     FH++    S  TA IR       G   W+  +  P  GT +MVG+GT    L    + + +L+G D+ SWGLSY GL+ H G +  F   F  + + I   L+   GTL F  +     VA   +        + M  STAA   + +     S  +LQ LC   +   R  S +    LP+P  LK++L
Sbjct:  142 WDDLNKSSATLLSCDNRKVSFHME---YSCGTAAIRGTKELGDGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYHHTFCSLLGRDEDSWGLSYTGLLHHKGDKTSFSSRF-GQGSIIGVHLDTWHGTLTFFKNRKCIGVAATRL---QNRRFYPMVCSTAAKSSMKVIRSCASSTSLQYLCCYRLRQLRPNSGDTLEGLPLPPGLKQVL 344          
BLAST of Progesterone receptor membrane component 1 vs. UniProt/SwissProt
Match: sp|O15173|PGRC2_HUMAN (Membrane-associated progesterone receptor component 2 OS=Homo sapiens OX=9606 GN=PGRMC2 PE=1 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 8.972e-33
Identity = 71/160 (44.38%), Postives = 105/160 (65.62%), Query Frame = 1
Query:  175 LNIILLSVCCYLLYKIY---------KLRTMEVELPVIKKKKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPGEVCEIVDSEED 627
            LN+ L+++     Y+++                E P     ++ KR+ +LEQLR++DG +N  I++A+NGK++DVT G  FYGP GPYG  AGRDA+R LATFCLD  +L+++YDD+SDL+  +M+ ++EWEMQF+ KY  +G+LL+PGE       EED
Sbjct:   56 LNVALVALVLLGAYRLWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEED 215          
BLAST of Progesterone receptor membrane component 1 vs. UniProt/SwissProt
Match: sp|Q5XIU9|PGRC2_RAT (Membrane-associated progesterone receptor component 2 OS=Rattus norvegicus OX=10116 GN=Pgrmc2 PE=1 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 2.280e-32
Identity = 72/160 (45.00%), Postives = 106/160 (66.25%), Query Frame = 1
Query:  175 LNIILLSVC---CYLLYKIYKLRTM------EVELPVIKKKKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPGEVCEIVDSEED 627
            LN+ L+++     Y L+  +  R +        E P     ++ KR+ +LEQLR++DG +   I++A+NGK++DVT G  FYGP GPYG  AGRDA+R LATFCLD  +L+++YDD+SDL+  +M+ ++EWEMQF+ KY  +G+LL+PGE       EED
Sbjct:   50 LNVALVALVLLGAYRLWVRWGRRGLCSGPGAGEESPAATLPRMKKRDFSLEQLRQYDGARTPRILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEED 209          
BLAST of Progesterone receptor membrane component 1 vs. UniProt/SwissProt
Match: sp|Q80UU9|PGRC2_MOUSE (Membrane-associated progesterone receptor component 2 OS=Mus musculus OX=10090 GN=Pgrmc2 PE=1 SV=2)

HSP 1 Score: 127.487 bits (319), Expect = 2.280e-32
Identity = 72/160 (45.00%), Postives = 106/160 (66.25%), Query Frame = 1
Query:  175 LNIILLSVC---CYLLYKIYKLRTM------EVELPVIKKKKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPGEVCEIVDSEED 627
            LN+ L+++     Y L+  +  R +        E P     ++ KR+ +LEQLR++DG +   I++A+NGK++DVT G  FYGP GPYG  AGRDA+R LATFCLD  +L+++YDD+SDL+  +M+ ++EWEMQF+ KY  +G+LL+PGE       EED
Sbjct:   50 LNVALVALVLLGAYRLWVRWGRRGLCSGPGAGEESPAATLPRMKKRDFSLEQLRQYDGARTPRILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEED 209          
BLAST of Progesterone receptor membrane component 1 vs. UniProt/SwissProt
Match: sp|Q5ZKN2|PGRC1_CHICK (Membrane-associated progesterone receptor component 1 OS=Gallus gallus OX=9031 GN=PGRMC1 PE=2 SV=3)

HSP 1 Score: 122.865 bits (307), Expect = 5.592e-31
Identity = 77/168 (45.83%), Postives = 117/168 (69.64%), Query Frame = 1
Query:  148 LIYDLFSSPLNIILLSVCCYLLYKIYK-----LRTMEVELPVIKKKKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPGEVCEIVDSEEDENS 636
            L+ ++  SPLN+ LL +C +LLY+I +      +  E   P + K K  +R+ TLEQLR +DGV++  I++A+NGK++DVT    FYGP+GPYG  AGRDA+R LATFCLD  +L++DYDD+SDL+ ++ + +++WE QF  KY  +GKLL+ GE   +   EE++++
Sbjct:   21 LLLEIVGSPLNLSLLGLCLFLLYQILRGERPAAQPGEAGPPPLPKMK--RRDFTLEQLRPYDGVRDPRILMAVNGKVFDVTRASKFYGPDGPYGIFAGRDASRGLATFCLDKEALRDDYDDLSDLNATQQETLRDWESQFTFKYHHVGKLLKDGEEPTVYSDEEEKDA 186          
BLAST of Progesterone receptor membrane component 1 vs. UniProt/SwissProt
Match: sp|Q95250|PGRC1_PIG (Membrane-associated progesterone receptor component 1 OS=Sus scrofa OX=9823 GN=PGRMC1 PE=1 SV=3)

HSP 1 Score: 122.865 bits (307), Expect = 6.854e-31
Identity = 81/180 (45.00%), Postives = 121/180 (67.22%), Query Frame = 1
Query:  148 LIYDLFSSPLNIILLSVCCYLLYKIYKLRTMEV------ELPVIKKKKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPGEVCEIVDSEEDENSVPVSETKSKSD 669
            L++++F+SPLN++LL +C +LLYKI +            E P + + K  +R+ T  +LR FDGV++  I++A+NGK++DVT G  FYGP GPYG  AGRDA+R LATFCLD  +LK++YDD+SDL+P++ + + +W+ QF  KY  +GKLL+ GE   +   EE+    P  E+  K+D
Sbjct:   21 LLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPAASDSDDDEPPPLPRLK--RRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTPAQQETLNDWDSQFTFKYHHVGKLLKEGEEPTVYSDEEE----PKDESARKND 194          
BLAST of Progesterone receptor membrane component 1 vs. TrEMBL
Match: C3Y974 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_118668 PE=4 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 1.194e-51
Identity = 97/214 (45.33%), Postives = 129/214 (60.28%), Query Frame = 1
Query:  919 KWSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCS-MENFSKLPIPGCLKELLVSTF 1557
            +W  ++KSP V LS  +  AYFHVDP+  S  TAG+R   GF+TG   W+   LEPP GTSVMVGVGTKKA LH G+Y Y+NL+G D++SWGLSYKG  WHNG  +Q+   FY + T I   LNL +GTL +  +     VAF+ +    GE L+ +  STAA  E+ +   +C  N+LQE C   I +     +   KLP+P  +K  L   +
Sbjct:   23 RWDVNNKSPEVQLSSCQLAAYFHVDPVDSSIGTAGVRGTKGFTTGEHYWEVIFLEPPHGTSVMVGVGTKKALLHLGNYQYINLLGRDEESWGLSYKGTTWHNGKYQQYTEPFYDQTTVIGVHLNLYNGTLTYYRNGKSLGVAFRSI--NRGEELYPIICSTAAETEMELGMRSCRFNSLQEKCCFTIMQAMKGKQAVDKLPLPTVIKSRLKEQY 234          
BLAST of Progesterone receptor membrane component 1 vs. TrEMBL
Match: A0A4W3JEU6 (Uncharacterized protein OS=Callorhinchus milii OX=7868 GN=LOC103174954 PE=4 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 3.689e-50
Identity = 93/210 (44.29%), Postives = 130/210 (61.90%), Query Frame = 1
Query:  919 KWSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCSMEN-FSKLPIPGCLKELL 1545
            +W  + KSPA  LS  +   YFH+DP+ +S  TAG+R   GF+ G   W+   LEPP GTSVMVG GT++A LH G+Y ++N++G D +SWGLSYKG IWH+G  +Q+   FY + T I   LNL  GT+ F  +  +  VAF G+  K G SL+ +ASSTAA  E+ +    C  ++LQE CL  + +    +N  + LP+P  +K LL
Sbjct:   20 EWDINAKSPAAQLSPCRRAVYFHIDPVLKSVGTAGVRGTKGFNHGEHYWEIEFLEPPYGTSVMVGAGTRRALLHTGNYQFINMLGMDSESWGLSYKGTIWHDGQSRQYTEPFYEQATIIGINLNLYTGTMTFYRNGQNLGVAFSGL-NKVGASLYPIASSTAAETELQLGVRGCRFHSLQEWCLYTVLQNLRDKNHINALPLPELIKGLL 228          
BLAST of Progesterone receptor membrane component 1 vs. TrEMBL
Match: A0A401P950 (Uncharacterized protein OS=Scyliorhinus torazame OX=75743 GN=scyTo_0010594 PE=4 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 1.462e-48
Identity = 97/213 (45.54%), Postives = 129/213 (60.56%), Query Frame = 1
Query:  919 KWSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCSME-NFSKLPIP----GCLKEL 1542
            +W  + KSPAV LS  +   YFHVD + +S +TAG+R   GF+ G+  W+   LEPP GTSVMVG GT++A LH G+Y +VNL+G D +SWGLSYKG IWH G  K++   FY K T I   LNL DGT+ F  +  +  VAF G+  K G  L+ M SSTAA  E+ +   +C   +LQE CL  + +    + +   LP+P    G LKE 
Sbjct:   20 EWDINAKSPAVLLSPCRRAVYFHVDSLLQSEATAGVRGTKGFAHGVHYWEVKFLEPPYGTSVMVGAGTEQACLHLGNYTFVNLLGMDSESWGLSYKGTIWHGGRSKRYTEPFYDKATIIGVDLNLYDGTMAFYKNGHNLGVAFTGL-NKIGMPLYPMTSSTAAETELQLGVRSCRFASLQEQCLHTVLQHLEDKAHIDTLPLPEFIRGQLKEF 231          
BLAST of Progesterone receptor membrane component 1 vs. TrEMBL
Match: W5MER4 (Si:dkey-23n7.10 OS=Lepisosteus oculatus OX=7918 PE=4 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 8.469e-47
Identity = 95/220 (43.18%), Postives = 125/220 (56.82%), Query Frame = 1
Query:  889 HMGEILKSIIKWSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCSMENFS-KLPIPGCLKELL 1545
            H+GE  +    W    KSPA  LS  +   YFH DP+ ES  TAG+R   GFS G   W+   LEPP G+SVMVG+GTKKA LH G+Y +++L+G D +SWGLSYKG +WH G  + +   FY K T I   LNL  GTL F  +     +AF G+  + G  L+ + SSTA   E+ +   TC   +LQE CL  I +       +  LP+P  L+E L
Sbjct:    4 HVGEHWE----WDMDAKSPAARLSPCRRAVYFHTDPVLESEGTAGVRGTKGFSHGEHYWEIEFLEPPCGSSVMVGLGTKKALLHTGNYQFIDLLGMDCESWGLSYKGSVWHGGESRTYTQPFYDKSTVIGVLLNLHTGTLVFYRNGSSLGLAFSGL-DQVGAPLYPLVSSTAPETELFLGLRTCQFTSLQERCLQAIAQTLGQRAAADSLPLPAALQEQL 218          
BLAST of Progesterone receptor membrane component 1 vs. TrEMBL
Match: A0A210QSW3 (SPRY domain-containing SOCS box protein 3 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05634 PE=4 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 1.652e-46
Identity = 89/211 (42.18%), Postives = 124/211 (58.77%), Query Frame = 1
Query:  922 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVI---FRCCSMENFSKLPIPGCLKELL 1545
            W   +KSP + LS +   AYF++DP++ S  TAG+R   GF+ G   W+   LEPP GTSVM+GVGT+KA LH GDY +V+L+G D +SWGLSY+G +WH+G+ ++FC   + +   I C LNL  GTL +  D     VAF G+       L+ M SSTA   E+ +   +C   +LQE C   I    RC S +    LP+P  +K  +
Sbjct:   26 WDQFNKSPDIQLSPDLENAYFYIDPVYNSTGTAGVRGTKGFTEGEHYWEVTFLEPPNGTSVMIGVGTEKAGLHTGDYRFVDLLGIDRESWGLSYRGDLWHDGMCQEFCAPMFHR-AVIGCHLNLYKGTLAYYQDGHQLGVAFTGL-NNLSMPLYPMVSSTATETELGLGKRSCRYLSLQEKCYQAIKNSLRCSSEDEVDNLPLPKTMKTFI 234          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Cavefish
Match: si:dkey-23n7.10 (si:dkey-23n7.10 [Source:ZFIN;Acc:ZDB-GENE-141222-64])

HSP 1 Score: 137.887 bits (346), Expect = 5.563e-37
Identity = 79/206 (38.35%), Postives = 113/206 (54.85%), Query Frame = 1
Query:  919 KWSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCC-SMENFSKLPIPGCL 1533
            +W +  KSP   LS      YFH+ P+ ES  TAG+R    F+ G   W+   LEP  G+SVMVGVGT  A LH  +  ++NLI  D +SWGLSYKG +WHNG  +++   FY + T I   L+   GTL F  +  +  +AF  +  +   +L+ M SSTA   E+ +   T  +++LQE C+  I  C   + +   LP+P  L
Sbjct:   14 EWDTEGKSPDACLSSCHQSVYFHISPLLESQGTAGVRGT-RFTHGEHYWEIEFLEPLYGSSVMVGVGTLNARLH-AEGQFINLI-MDTESWGLSYKGFLWHNGRSRKYTEPFYDRNTVIGVLLDRTAGTLTFYKNGKNLGLAFSDL-DRVASALYPMVSSTAPETELQLGLRTSRLSSLQEHCIHTITHCLGKLGHTHSLPLPRAL 215          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Cavefish
Match: pgrmc2 (membrane-associated progesterone receptor component 2-like [Source:NCBI gene;Acc:103044397])

HSP 1 Score: 127.102 bits (318), Expect = 1.329e-33
Identity = 72/152 (47.37%), Postives = 105/152 (69.08%), Query Frame = 1
Query:  181 IILLSVCCYLLYKIYKLRTMEVELPVIKK---KKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPG-EVCEIVDSEE 624
            +IL+   CY++Y+ +  R+        +     K+ +R+ TLEQLRE+DG +N  I+IA+N K++DVTSG  FYG  GPYG  AGRDA+R LATFCL+  +L+++YDD+SDL+  +M+ ++EWEMQF  KY  +G+LL+PG E  E  D E+
Sbjct:   22 LILVLATCYVVYRRWLRRSGADAAAASEASPLPKMGRRDFTLEQLREYDGAQNPRILIAVNMKVFDVTSGKKFYGREGPYGIFAGRDASRGLATFCLEKDALRDEYDDLSDLNAVQMESVREWEMQFMEKYDYVGRLLKPGDEPSEYTDEED 173          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Cavefish
Match: pgrmc2 (membrane-associated progesterone receptor component 2-like [Source:NCBI gene;Acc:103044397])

HSP 1 Score: 127.487 bits (319), Expect = 1.455e-33
Identity = 72/152 (47.37%), Postives = 105/152 (69.08%), Query Frame = 1
Query:  181 IILLSVCCYLLYKIYKLRTMEVELPVIKK---KKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPG-EVCEIVDSEE 624
            +IL+   CY++Y+ +  R+        +     K+ +R+ TLEQLRE+DG +N  I+IA+N K++DVTSG  FYG  GPYG  AGRDA+R LATFCL+  +L+++YDD+SDL+  +M+ ++EWEMQF  KY  +G+LL+PG E  E  D E+
Sbjct:   38 LILVLATCYVVYRRWLRRSGADAAAASEASPLPKMGRRDFTLEQLREYDGAQNPRILIAVNMKVFDVTSGKKFYGREGPYGIFAGRDASRGLATFCLEKDALRDEYDDLSDLNAVQMESVREWEMQFMEKYDYVGRLLKPGDEPSEYTDEED 189          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Cavefish
Match: pgrmc2 (membrane-associated progesterone receptor component 2-like [Source:NCBI gene;Acc:103044397])

HSP 1 Score: 127.872 bits (320), Expect = 1.602e-33
Identity = 72/152 (47.37%), Postives = 105/152 (69.08%), Query Frame = 1
Query:  181 IILLSVCCYLLYKIYKLRTMEVELPVIKK---KKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPG-EVCEIVDSEE 624
            +IL+   CY++Y+ +  R+        +     K+ +R+ TLEQLRE+DG +N  I+IA+N K++DVTSG  FYG  GPYG  AGRDA+R LATFCL+  +L+++YDD+SDL+  +M+ ++EWEMQF  KY  +G+LL+PG E  E  D E+
Sbjct:   44 LILVLATCYVVYRRWLRRSGADAAAASEASPLPKMGRRDFTLEQLREYDGAQNPRILIAVNMKVFDVTSGKKFYGREGPYGIFAGRDASRGLATFCLEKDALRDEYDDLSDLNAVQMESVREWEMQFMEKYDYVGRLLKPGDEPSEYTDEED 195          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Cavefish
Match: pgrmc1 (progesterone receptor membrane component 1 [Source:NCBI gene;Acc:103038229])

HSP 1 Score: 124.02 bits (310), Expect = 2.032e-32
Identity = 83/164 (50.61%), Postives = 115/164 (70.12%), Query Frame = 1
Query:  148 LIYDLFSSPLNIILLSVCCYLLYKIYK----LRTMEVELPVIKKKKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPG-EVCEIVDSEE 624
            ++ ++F+SPLN+ LL +C +LLYKI++        E+E P+ K KK   R+ TL +L+E+DG  N  I++A+NGK++DVT G  FYGP+GPYG  AGRDA+R LATFCLD  +LK+ +DD+SDL+  + + + EWE QF  KY  IGKLL+PG E  E  D EE
Sbjct:   13 ILQEIFTSPLNLSLLCLCLFLLYKIFRGDKPADVGEIEEPLPKLKK---RDFTLAELKEYDGTTNPRILMAVNGKVFDVTRGKKFYGPDGPYGVFAGRDASRGLATFCLDKEALKDVHDDLSDLNAMQQESLSEWETQFTQKYDYIGKLLKPGEEPTEYTDDEE 173          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Sea Lamprey
Match: si:ch1073-228j22.2 (si:ch1073-228j22.2 [Source:ZFIN;Acc:ZDB-GENE-110411-227])

HSP 1 Score: 63.5438 bits (153), Expect = 2.146e-11
Identity = 62/224 (27.68%), Postives = 93/224 (41.52%), Query Frame = 1
Query:  922 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSY-KGLIWHNGVEKQF---------CPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIA---ITSYTCSMNTLQELCLGVIFRCC---SMENFSKLPIPGCLKELL 1545
            +SS D SP++SL E  ++   H  P+ ++   A  R    +  G+  W+        GT   VGV T  APL      YV L+G   +SWG    +   +H  V+            C +F+     +   L++ +GTL F  D     VAF G+    G++L+   S+     EI    I         L ELC   I  C     +E  + LP+P  +K  L
Sbjct:   55 FSSTDLSPSMSLKEGDALT-VHRRPMRDTTDAA--RGRTAYRRGVHTWEITWPTEQRGTHAAVGVATSDAPLEA--TGYVALVGRGRESWGWDLGRCKAYHGAVDSPGRPYPAHLLPCESFHVPERLVMA-LDMEEGTLSFVVDGEYLGVAFSGL---RGKTLYPAVSAVWGNCEIKMRYINGIEPGPLPLDELCRRSIRNCLGNDRLEEINALPLPTLIKRYL 269          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001173.1 (pep scaffold:Pmarinus_7.0:GL481490:14086:14830:1 gene:ENSPMAG00000001050.1 transcript:ENSPMAT00000001173.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 5.583e-7
Identity = 42/144 (29.17%), Postives = 65/144 (45.14%), Query Frame = 1
Query: 1033 NIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSY-KGLIWHNGV------EKQFCPAFYS---KYTTIQCFLNLLD---GTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAI 1425
            ++GF+ G+  W+        GT  +VGV T  APLH     Y +L+G    SWG    +  ++H G       E +  PA+ +    +     FL +LD   GT+ F  D     VAF+G+    G  L+ + S+     EI +
Sbjct:   67 SVGFTRGLHAWEVTWPARQRGTHAVVGVATADAPLH--SVGYTSLVGSTADSWGWDLGRNKLYHAGKAVGRDGEHRTYPAYLTADESFVVSDSFLVVLDMDEGTVSFVVDGQYLGVAFRGL---KGRKLYPVVSAVWGHCEITM 205          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Yeast
Match: DAP1 (Heme-binding protein; involved in regulation of cytochrome P450 protein Erg11p; damage response protein, related to mammalian membrane progesterone receptors; mutations lead to defects in telomeres, mitochondria, and sterol synthesis [Source:SGD;Acc:S000006091])

HSP 1 Score: 63.5438 bits (153), Expect = 1.881e-12
Identity = 45/113 (39.82%), Postives = 65/113 (57.52%), Query Frame = 1
Query:  268 KKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLK---EDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLL-RPG 594
            + ++  N     L +F+G  +E I IA+ GK+YD T G  FYGP+GPY   AG DA+R LA    D   +K   +  D + DL+  ++D + EW+  FE+KY  IG L+  PG
Sbjct:   37 EPVVAGNFFPRTLSKFNGHDDEKIFIAIRGKVYDCTRGRQFYGPSGPYTNFAGHDASRGLALNSFDLDVIKDWDQPIDPLDDLTKEQIDALDEWQEHFENKYPCIGTLIPEPG 149          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Nematostella
Match: EDO48444 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJX3])

HSP 1 Score: 145.206 bits (365), Expect = 1.496e-39
Identity = 81/203 (39.90%), Postives = 118/203 (58.13%), Query Frame = 1
Query:  922 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPL-VAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCSMENFSKLPIPG 1527
            W    +SP V L  +  VA FH+DP+ ES  TA +  N  F+ G   W+  L +   GTS+M+GV T+ A LH  +Y YVNL+G D +SWGLS++G IWH G + +FC  F+   T I   L++  GT+ F F  G PL VAF G+  + G  L+ +ASSTA+  E+ +    C  +TL + C   I +  + +N ++LP+P 
Sbjct:   47 WDFQSRSPNVYLCYHNKVACFHIDPVVESTGTAAVLGNKAFAHGQHYWEIKLTDV-RGTSMMIGVATQDAMLHTDNYEYVNLVGRDQESWGLSHRGEIWHGGQKWKFCEPFFDS-TVIGVLLDMDKGTISF-FKNGQPLGVAFTGLQDR-GCELYPIASSTASESEVELGYRCCKYSTLIDQCCMEIIKHVNRDNMNRLPLPA 245          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Nematostella
Match: EDO47007 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN50])

HSP 1 Score: 110.923 bits (276), Expect = 9.824e-29
Identity = 57/120 (47.50%), Postives = 89/120 (74.17%), Query Frame = 1
Query:  247 ELPVIKKKKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPGEVCE 606
            E P  + +   KR+ TL++L+E+DG+K+  +++A+NGK++DVT G +FYGP GPY   AG DA+R LATF L   ++K++YDD+SDL+  + D ++EWE QF+ KY ++G+LL+PGE  +
Sbjct:    2 EPPPKRLEPFKKRDFTLDELKEYDGLKSPYVLMAVNGKVFDVTRGKDFYGPGGPYSNFAGHDASRGLATFSLGPEAIKDEYDDLSDLNGMQQDSLREWEQQFDEKYDLVGRLLKPGEKHQ 121          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Nematostella
Match: EDO28769 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5J3])

HSP 1 Score: 105.531 bits (262), Expect = 8.388e-27
Identity = 63/151 (41.72%), Postives = 89/151 (58.94%), Query Frame = 1
Query: 1006 SNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPL-VAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTL 1455
            S  TA +  N  F+ G   W+  L +   GTS+M+GV T+ A LH  +Y YVNL+G D +SWGLS++G IWH G + +FC  F+   T I   L++  GT+ F F  G PL VAF G+  + G  L+ +ASSTA+  E+ +    C  +TL
Sbjct:    1 STGTAAVLGNKAFAHGQHYWEIKLTDVR-GTSMMIGVATQDAMLHTDNYEYVNLVGRDQESWGLSHRGEIWHGGQKWKFCEPFFDS-TVIGVLLDMDKGTISF-FKNGQPLGVAFTGLQDR-GCELYPIASSTASESEVELGYRCCKYSTL 147          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Nematostella
Match: EDO48347 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJX4])

HSP 1 Score: 87.0409 bits (214), Expect = 8.253e-20
Identity = 57/170 (33.53%), Postives = 85/170 (50.00%), Query Frame = 1
Query: 1042 FSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCSM-ENFSKLPIPGCLKELLV 1548
            F  G+  W+  +     GT +MVGVGTK   L      + +++G D  SWGLSY G   H+G+   +   F  + TTI   ++   G L F  D+    VA +G+    G+ L+ M SSTAA  ++ +T  T   ++LQ LC   I +  S   N   LP+P  +K+ L 
Sbjct:   16 FDGGVHYWEVKMTSAVYGTDMMVGVGTKDTDLERYRSSFCSILGRDQDSWGLSYFGTFHHDGLTHDYTTKF-DRGTTIGIHVDTWSGRLTFLRDDQPLGVAAEGL---KGKELYPMVSSTAARTKMRLTRSTSLKHSLQYLCCEAIGKALSHPNNVHDLPLPPGVKKHLA 181          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Nematostella
Match: EDO49444 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGM7])

HSP 1 Score: 78.9518 bits (193), Expect = 6.632e-18
Identity = 45/104 (43.27%), Postives = 72/104 (69.23%), Query Frame = 1
Query:  283 RNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDN---SSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLL 585
            R  T+ +L+ +DGV  E I +A+NGK++DVTS  N++GP GP   LAG+DA+RAL TF +DN   +  ++  DD++DL+P + D + E+E Q+  +Y  +G+L+
Sbjct:    4 REFTVRELKGYDGVNKELIYVAVNGKVFDVTSAWNYFGPAGPDCLLAGKDASRALVTFSVDNFYQTEQRDSMDDLNDLNPLQRDCLFEYETQYMERYPCVGRLV 107          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Medaka
Match: pgrmc1 (progesterone receptor membrane component 1 [Source:NCBI gene;Acc:100125824])

HSP 1 Score: 125.176 bits (313), Expect = 6.827e-33
Identity = 84/170 (49.41%), Postives = 118/170 (69.41%), Query Frame = 1
Query:  139 ALTLIYDLFSSPLNIILLSVCCYLLYKIYKLRTM----EVELPVIKKKKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPG-EVCEIVDSEEDEN 633
            +  +  ++F+SPLN+ LLS+C +LLY+I++        EVE P+ K KK   R+ TL +L+ +DG++N  I++A+NGK++DVT G  FYGP GPYG  AGRDA+R LATFCLD  SLK++YDD+SDL   + D + EWE QF  KY  +GKLL+PG E  E  D +E ++
Sbjct:   11 SAGIFQEIFTSPLNLTLLSLCLFLLYQIFRGDRQPDFGEVETPLPKLKK---RDFTLAELKPYDGLENPRILMAVNGKVFDVTRGKKFYGPEGPYGVFAGRDASRGLATFCLDKESLKDEYDDLSDLDAMQQDSLAEWETQFTFKYDYVGKLLKPGEEPTEYTDDDEGKD 177          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Medaka
Match: pgrmc1 (progesterone receptor membrane component 1 [Source:NCBI gene;Acc:100125824])

HSP 1 Score: 124.405 bits (311), Expect = 7.975e-33
Identity = 83/164 (50.61%), Postives = 116/164 (70.73%), Query Frame = 1
Query:  157 DLFSSPLNIILLSVCCYLLYKIYKLRTM----EVELPVIKKKKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPG-EVCEIVDSEEDEN 633
            ++F+SPLN+ LLS+C +LLY+I++        EVE P+    K+ KR+ TL +L+ +DG++N  I++A+NGK++DVT G  FYGP GPYG  AGRDA+R LATFCLD  SLK++YDD+SDL   + D + EWE QF  KY  +GKLL+PG E  E  D +E ++
Sbjct:    5 EIFTSPLNLTLLSLCLFLLYQIFRGDRQPDFGEVETPL---PKLKKRDFTLAELKPYDGLENPRILMAVNGKVFDVTRGKKFYGPEGPYGVFAGRDASRGLATFCLDKESLKDEYDDLSDLDAMQQDSLAEWETQFTFKYDYVGKLLKPGEEPTEYTDDDEGKD 165          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Medaka
Match: pgrmc2 (progesterone receptor membrane component 2 [Source:NCBI gene;Acc:100049307])

HSP 1 Score: 124.02 bits (310), Expect = 3.106e-32
Identity = 67/119 (56.30%), Postives = 92/119 (77.31%), Query Frame = 1
Query:  271 KIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPG-EVCEIVDSEE 624
            K+ +R+ TLEQLRE+DGV+N  I++A+N K++DVTSG  FYG +GPYG  AGRDA+R LATFCLD   L+++YDD+SDL+  +M+ ++EWEMQF  KY  +G+LL+PG E  E  D E+
Sbjct:   72 KMRRRDFTLEQLREYDGVQNPRILMAVNMKVFDVTSGKKFYGKDGPYGIFAGRDASRGLATFCLDKGFLRDEYDDLSDLTAVQMESVREWEMQFMEKYDYVGRLLKPGDEPSEYTDEED 190          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Medaka
Match: spsb3b (splA/ryanodine receptor domain and SOCS box containing 3 [Source:NCBI gene;Acc:101162324])

HSP 1 Score: 87.8113 bits (216), Expect = 4.297e-18
Identity = 68/211 (32.23%), Postives = 96/211 (45.50%), Query Frame = 1
Query:  922 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELC---LGVIFRCCSMENFSKLPIPGCLKELL 1545
            W  H KS    LS++     FH D    S  TA IR     S G   W+  +  P  GT +MVG+GT +  L    Y + +L+G+D+ SWGLSY GL+ H G + +F P F  + + I   L+   GTL F  +     VA   +  K     + M  STAA   + +     +  +LQ LC   L     CC  +    L +P  L+  L
Sbjct:  109 WDEHCKSSGAFLSKDSRKVSFHSD---YSCGTAAIRGRKELSEGQHYWEVKMTSPVYGTDMMVGIGTSEVNLDKFKYSFGSLLGHDEDSWGLSYTGLLQHKGDKVKFSPRF-GQGSVIGVHLDTWHGTLSFYQNRQFIGVAATNLQNK---KFYPMVCSTAAKSSMKVIRACYTPTSLQYLCSARLRQTLPCCP-DVVGALELPPGLRTFL 311          
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Medaka
Match: spsb3a (SPRY domain-containing SOCS box protein 3 [Source:NCBI gene;Acc:101158278])

HSP 1 Score: 76.2554 bits (186), Expect = 1.488e-14
Identity = 61/210 (29.05%), Postives = 96/210 (45.71%), Query Frame = 1
Query:  922 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCS--MENFSKLPIPGCLKELL 1545
            W +  +S A  LS +     FH +    S  TA IR +   + G   W+  +  P  GT +MVG+GT +  L    + + +L+G D  SWGLSY GL+ H G +  F   F  + + I   L+   GTL F  +     +A   +  K     + MA STAA   + +     +  +L  LC   + +     ++    LP+P  L++LL
Sbjct:  108 WDATSRSTATLLSCDNRKVNFHSE---YSCGTAAIRGSKELAEGQHFWEIKMTSPVYGTDMMVGIGTSEVNLDKYRHTFCSLLGKDADSWGLSYTGLLHHKGDKMNFSTRF-GQGSIIGVHLDTWHGTLTFFKNRKCIGIAATELQNK---RFYPMACSTAAKSSMKVIRSCSAPTSLLYLCCARLRQLAPDCIDILDVLPLPPGLRQLL 310          
BLAST of Progesterone receptor membrane component 1 vs. Planmine SMEST
Match: SMESG000069126.1 (SMESG000069126.1)

HSP 1 Score: 467.233 bits (1201), Expect = 4.101e-164
Identity = 225/225 (100.00%), Postives = 225/225 (100.00%), Query Frame = 1
Query:  892 MGEILKSIIKWSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCSMENFSKLPIPGCLKELLVSTFCNA 1566
            MGEILKSIIKWSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCSMENFSKLPIPGCLKELLVSTFCNA
Sbjct:    1 MGEILKSIIKWSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCSMENFSKLPIPGCLKELLVSTFCNA 225          
BLAST of Progesterone receptor membrane component 1 vs. Planmine SMEST
Match: SMESG000069122.1 (SMESG000069122.1)

HSP 1 Score: 268.085 bits (684), Expect = 3.828e-87
Identity = 157/158 (99.37%), Postives = 157/158 (99.37%), Query Frame = 1
Query:   88 MNDKLKNEPVTSNPYDYALTLIYDLFSSPLNIILLSVCCYLLYKIYKLRTMEVELPVIKKKKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESK 561
            MNDKLKNEPVTSNP DYALTLIYDLFSSPLNIILLSVCCYLLYKIYKLRTMEVELPVIKKKKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSGGNFYGPNGPYGCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESK
Sbjct:    1 MNDKLKNEPVTSNPCDYALTLIYDLFSSPLNIILLSVCCYLLYKIYKLRTMEVELPVIKKKKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSGGNFYGPNGPYGCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESK 158          
BLAST of Progesterone receptor membrane component 1 vs. Planmine SMEST
Match: SMESG000069753.1 (SMESG000069753.1)

HSP 1 Score: 103.99 bits (258), Expect = 1.982e-25
Identity = 65/152 (42.76%), Postives = 104/152 (68.42%), Query Frame = 1
Query:  145 TLIYDLFSSPLNIILLSVCCYLLYKIYKLRTMEVELPVIKKKKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVT-SXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPGE 597
            ++I D+FS+ +NIILL  C  L+Y ++  +++     ++ K K+  R+ T+  L +++G+ +   +IA+NG ++DVT +G N YG   PY   AGRDA+RAL+ FC D    K++YDD++DL+  EM ++KEWE+QF+ KY  +G+LLRPGE
Sbjct:    9 SMISDVFSNSVNIILLLACLILIYYLFFRKSVTYYENILPKLKM--RDFTVTDLSQYNGLNSPYRLIAVNGNIFDVTKAGQNLYGEGAPYSNFAGRDASRALSRFCNDPDVFKDEYDDLTDLNSDEMGRLKEWELQFKEKYQFVGRLLRPGE 158          
BLAST of Progesterone receptor membrane component 1 vs. Planmine SMEST
Match: SMESG000069753.1 (SMESG000069753.1)

HSP 1 Score: 103.99 bits (258), Expect = 2.204e-25
Identity = 65/152 (42.76%), Postives = 104/152 (68.42%), Query Frame = 1
Query:  145 TLIYDLFSSPLNIILLSVCCYLLYKIYKLRTMEVELPVIKKKKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVT-SXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPGE 597
            ++I D+FS+ +NIILL  C  L+Y ++  +++     ++ K K+  R+ T+  L +++G+ +   +IA+NG ++DVT +G N YG   PY   AGRDA+RAL+ FC D    K++YDD++DL+  EM ++KEWE+QF+ KY  +G+LLRPGE
Sbjct:   12 SMISDVFSNSVNIILLLACLILIYYLFFRKSVTYYENILPKLKM--RDFTVTDLSQYNGLNSPYRLIAVNGNIFDVTKAGQNLYGEGAPYSNFAGRDASRALSRFCNDPDVFKDEYDDLTDLNSDEMGRLKEWELQFKEKYQFVGRLLRPGE 161          
BLAST of Progesterone receptor membrane component 1 vs. Planmine SMEST
Match: SMESG000069753.1 (SMESG000069753.1)

HSP 1 Score: 103.605 bits (257), Expect = 2.291e-25
Identity = 65/151 (43.05%), Postives = 103/151 (68.21%), Query Frame = 1
Query:  148 LIYDLFSSPLNIILLSVCCYLLYKIYKLRTMEVELPVIKKKKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVT-SXXXXXXXXXXXXCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKEWEMQFESKYFVIGKLLRPGE 597
            +I D+FS+ +NIILL  C  L+Y ++  +++     ++ K K+  R+ T+  L +++G+ +   +IA+NG ++DVT +G N YG   PY   AGRDA+RAL+ FC D    K++YDD++DL+  EM ++KEWE+QF+ KY  +G+LLRPGE
Sbjct:    1 MISDVFSNSVNIILLLACLILIYYLFFRKSVTYYENILPKLKM--RDFTVTDLSQYNGLNSPYRLIAVNGNIFDVTKAGQNLYGEGAPYSNFAGRDASRALSRFCNDPDVFKDEYDDLTDLNSDEMGRLKEWELQFKEKYQFVGRLLRPGE 149          
The following BLAST results are available for this feature:
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PGRMC21.868e-3344.38progesterone receptor membrane component 2 [Source... [more]
PGRMC21.868e-3344.38progesterone receptor membrane component 2 [Source... [more]
PGRMC23.587e-3344.38progesterone receptor membrane component 2 [Source... [more]
PGRMC11.558e-3044.75progesterone receptor membrane component 1 [Source... [more]
PGRMC22.963e-2054.29progesterone receptor membrane component 2 [Source... [more]
back to top
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vem-11.857e-2240.58pep chromosome:WBcel235:X:8087555:8089427:-1 gene:... [more]
vem-11.857e-2240.58pep chromosome:WBcel235:X:8087554:8088574:-1 gene:... [more]
spsb-22.987e-1225.53SPSB (SPry and Socs Box) family [Source:UniProtKB... [more]
spsb-12.998e-1125.11SPSB (SPry and Socs Box) family [Source:UniProtKB... [more]
spsb-13.328e-1125.11SPSB (SPry and Socs Box) family [Source:UniProtKB... [more]
back to top
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MSBP3.625e-3544.69gene:FBgn0030703 transcript:FBtr0301598[more]
MSBP3.625e-3544.69gene:FBgn0030703 transcript:FBtr0074166[more]
MSBP3.625e-3544.69gene:FBgn0030703 transcript:FBtr0333719[more]
SP5554.448e-2332.37gene:FBgn0260470 transcript:FBtr0333535[more]
SP5554.448e-2332.37gene:FBgn0260470 transcript:FBtr0079005[more]
back to top
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-23n7.104.423e-4942.23si:dkey-23n7.10 [Source:ZFIN;Acc:ZDB-GENE-141222-6... [more]
pgrmc14.847e-3350.31progesterone receptor membrane component 1 [Source... [more]
pgrmc14.847e-3350.31progesterone receptor membrane component 1 [Source... [more]
pgrmc25.335e-3247.30progesterone receptor membrane component 2 [Source... [more]
pgrmc25.335e-3247.30progesterone receptor membrane component 2 [Source... [more]
back to top
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ints133.332e-4942.65integrator complex subunit 13 [Source:Xenbase;Acc:... [more]
ints133.519e-4942.65integrator complex subunit 13 [Source:Xenbase;Acc:... [more]
PGRMC25.969e-3348.23progesterone receptor membrane component 2 [Source... [more]
ubap12.983e-3145.81ubiquitin associated protein 1 [Source:Xenbase;Acc... [more]
spsb34.060e-1931.90splA/ryanodine receptor domain and SOCS box contai... [more]
back to top
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pgrmc23.260e-3345.00progesterone receptor membrane component 2 [Source... [more]
Pgrmc18.192e-3144.20progesterone receptor membrane component 1 [Source... [more]
Spsb35.404e-1730.95splA/ryanodine receptor domain and SOCS box contai... [more]
Spsb35.404e-1730.95splA/ryanodine receptor domain and SOCS box contai... [more]
Spsb36.466e-1730.95splA/ryanodine receptor domain and SOCS box contai... [more]
back to top
BLAST of Progesterone receptor membrane component 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O15173|PGRC2_HUMAN8.972e-3344.38Membrane-associated progesterone receptor componen... [more]
sp|Q5XIU9|PGRC2_RAT2.280e-3245.00Membrane-associated progesterone receptor componen... [more]
sp|Q80UU9|PGRC2_MOUSE2.280e-3245.00Membrane-associated progesterone receptor componen... [more]
sp|Q5ZKN2|PGRC1_CHICK5.592e-3145.83Membrane-associated progesterone receptor componen... [more]
sp|Q95250|PGRC1_PIG6.854e-3145.00Membrane-associated progesterone receptor componen... [more]
back to top
BLAST of Progesterone receptor membrane component 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3Y9741.194e-5145.33Uncharacterized protein OS=Branchiostoma floridae ... [more]
A0A4W3JEU63.689e-5044.29Uncharacterized protein OS=Callorhinchus milii OX=... [more]
A0A401P9501.462e-4845.54Uncharacterized protein OS=Scyliorhinus torazame O... [more]
W5MER48.469e-4743.18Si:dkey-23n7.10 OS=Lepisosteus oculatus OX=7918 PE... [more]
A0A210QSW31.652e-4642.18SPRY domain-containing SOCS box protein 3 OS=Mizuh... [more]
back to top
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-23n7.105.563e-3738.35si:dkey-23n7.10 [Source:ZFIN;Acc:ZDB-GENE-141222-6... [more]
pgrmc21.329e-3347.37membrane-associated progesterone receptor componen... [more]
pgrmc21.455e-3347.37membrane-associated progesterone receptor componen... [more]
pgrmc21.602e-3347.37membrane-associated progesterone receptor componen... [more]
pgrmc12.032e-3250.61progesterone receptor membrane component 1 [Source... [more]
back to top
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch1073-228j22.22.146e-1127.68si:ch1073-228j22.2 [Source:ZFIN;Acc:ZDB-GENE-11041... [more]
ENSPMAT00000001173.15.583e-729.17pep scaffold:Pmarinus_7.0:GL481490:14086:14830:1 g... [more]
back to top
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DAP11.881e-1239.82Heme-binding protein; involved in regulation of cy... [more]
back to top
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO484441.496e-3939.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470079.824e-2947.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO287698.388e-2741.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483478.253e-2033.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494446.632e-1843.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Progesterone receptor membrane component 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pgrmc16.827e-3349.41progesterone receptor membrane component 1 [Source... [more]
pgrmc17.975e-3350.61progesterone receptor membrane component 1 [Source... [more]
pgrmc23.106e-3256.30progesterone receptor membrane component 2 [Source... [more]
spsb3b4.297e-1832.23splA/ryanodine receptor domain and SOCS box contai... [more]
spsb3a1.488e-1429.05SPRY domain-containing SOCS box protein 3 [Source:... [more]
back to top
BLAST of Progesterone receptor membrane component 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069126.14.101e-164100.00SMESG000069126.1[more]
SMESG000069122.13.828e-8799.37SMESG000069122.1[more]
SMESG000069753.11.982e-2542.76SMESG000069753.1[more]
SMESG000069753.12.204e-2542.76SMESG000069753.1[more]
SMESG000069753.12.291e-2543.05SMESG000069753.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008259 ID=SMED30008259|Name=Progesterone receptor membrane component 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1785bp
GCTATATTGTGTTTATTTAGCTTTTCGCCTACAAATAGCCAATTAACTCA
AAACATTATTATTTAAAATAGCCAAAAATAAAAAACAATGAATGACAAAT
TGAAAAATGAACCGGTAACATCTAATCCCTATGATTATGCTTTAACTTTA
ATTTATGATCTTTTTTCGAGTCCATTGAATATTATCTTGCTTTCCGTTTG
CTGTTATTTGCTATATAAAATTTACAAATTACGCACAATGGAAGTAGAGT
TACCAGTGATTAAGAAGAAAAAAATCATTAAAAGAAATCTTACTCTTGAG
CAACTTCGTGAATTTGATGGAGTTAAAAATGAAAGCATAATAATTGCACT
TAATGGAAAATTGTACGATGTTACTTCCGGAGGTAATTTTTATGGACCAA
ATGGTCCGTATGGTTGTCTTGCTGGAAGAGATGCTACGAGAGCTTTGGCA
ACATTTTGTTTGGATAACAGTAGTTTAAAAGAGGATTATGATGACATATC
AGATTTAAGTCCTTCGGAAATGGATCAAATGAAAGAATGGGAAATGCAAT
TTGAAAGTAAATATTTTGTAATTGGAAAGCTGCTACGACCAGGAGAAGTA
TGTGAGATTGTAGATAGTGAGGAAGATGAAAATAGTGTTCCAGTATCAGA
AACGAAATCGAAATCTGACTGAAATGAAACTTTGAATCAATTTTTATGAA
CTTGTTTCTGTTTTTATAAATAATGCTTCTGTTGAAATGTGCTGAAACAA
TCCGCTAATTAAAAGTTCAATAACTTATTTTATTTGATTTTAAAAATATT
TTATAAAATAATTGAAATTTGTCATTTTTGTTTAAATGCATCAATGTATT
TTGGACTTTGAACAATATCATTTGTGAGAATAATTTAACATATGGGAGAA
ATATTAAAATCAATTATTAAATGGTCGTCCCATGACAAAAGTCCTGCAGT
GAGTTTGTCAGAAAATAAATCCGTTGCATATTTCCATGTGGATCCAATAT
TTGAAAGCAACAGCACAGCCGGCATTCGATCAAATATTGGATTTAGTACT
GGAATGATTTGTTGGAAATTTGCTTTACTTGAACCGCCTTTGGGTACATC
GGTAATGGTTGGTGTCGGTACAAAAAAGGCACCGTTGCATTTTGGAGACT
ATTGCTACGTGAATTTAATTGGTTACGATGACCAAAGCTGGGGATTGAGT
TATAAGGGATTGATTTGGCATAATGGGGTTGAAAAACAGTTCTGTCCTGC
TTTTTATTCGAAATATACTACAATACAATGTTTTCTAAATTTGCTGGATG
GGACTTTGCGTTTTCAATTTGATGAAGGAGATCCACTTGTTGCGTTTCAA
GGGGTTTTCCCTAAATATGGTGAGTCTTTGTTTGCTATGGCCAGTTCGAC
TGCCGCTGGTATGGAGATCGCTATCACTAGTTACACTTGCTCAATGAATA
CATTACAAGAGTTATGCTTGGGTGTCATTTTCCGATGTTGTAGCATGGAG
AATTTTTCAAAATTGCCCATTCCTGGTTGTTTGAAGGAATTGCTGGTATC
AACATTTTGTAATGCATGACAGATTTATGTGTTTATATTTATTTATATAT
ATTTTTATATACATTTACACTCCATTTTCACGTATCTATGAAATCTGGTG
ATTTTTTTGCTAAATCCATTATTTGATATAAATGTGATTTGTAAAATATA
ATTTTTATTCCTTTTTTGTTTATCAGAATCCCTGCTGCCTTACCACTGCA
GCATCACTGTATAATCACGTAAATTTCTATTGCAC
back to top

protein sequence of SMED30008259-orf-1

>SMED30008259-orf-1 ID=SMED30008259-orf-1|Name=SMED30008259-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=195bp
MNDKLKNEPVTSNPYDYALTLIYDLFSSPLNIILLSVCCYLLYKIYKLRT
MEVELPVIKKKKIIKRNLTLEQLREFDGVKNESIIIALNGKLYDVTSGGN
FYGPNGPYGCLAGRDATRALATFCLDNSSLKEDYDDISDLSPSEMDQMKE
WEMQFESKYFVIGKLLRPGEVCEIVDSEEDENSVPVSETKSKSD*
back to top

protein sequence of SMED30008259-orf-2

>SMED30008259-orf-2 ID=SMED30008259-orf-2|Name=SMED30008259-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=226bp
MGEILKSIIKWSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIG
FSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSW
GLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLV
AFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCC
SMENFSKLPIPGCLKELLVSTFCNA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:1903538regulation of meiotic cell cycle process involved in oocyte maturation
GO:0035556intracellular signal transduction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR043136B30.2/SPRY_sf
IPR036036SOCS_box-like_dom_sf
IPR001199Cyt_B5-like_heme/steroid-bd
IPR003877SPRY_dom
IPR001870B30.2/SPRY
IPR001496SOCS_box
IPR013320ConA-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005496steroid binding
GO:0008289lipid binding
GO:0020037heme binding
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0012505endomembrane system
GO:0016020membrane
GO:0016021integral component of membrane
GO:0031090organelle membrane
GO:0043231intracellular membrane-bounded organelle
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR043136B30.2/SPRY domain superfamilyGENE3DG3DSA:2.60.120.920coord: 6..191
e-value: 5.4E-23
score: 83.6
IPR003877SPRY domainPFAMPF00622SPRYcoord: 68..156
e-value: 2.4E-9
score: 37.3
NoneNo IPR availablePANTHERPTHR12245SPRY DOMAIN CONTAINING SOCS BOX PROTEINcoord: 9..218
NoneNo IPR availablePANTHERPTHR12245:SF16SI:DKEY-23N7.10coord: 9..218
IPR001496SOCS box domainPROSITEPS50225SOCScoord: 187..218
score: 10.364
IPR001870B30.2/SPRY domainPROSITEPS50188B302_SPRYcoord: 1..185
score: 13.254
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 8..179
IPR036036SOCS box-like domain superfamilySUPERFAMILYSSF158235SOCS box-likecoord: 187..220