Co-chaperone protein HscB

Overview
NameCo-chaperone protein HscB
Smed IDSMED30008254
Length (bp)1883
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Co-chaperone protein HscB (SMED30008254) t-SNE clustered cells

Violin plots show distribution of expression levels for Co-chaperone protein HscB (SMED30008254) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Co-chaperone protein HscB (SMED30008254) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Co-chaperone protein HscB (SMED30008254) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008254

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30008254h1SMcG0003779 SmedASXL_010257SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parenchymaSMED30008254h1SMcG0003779 dd_Smed_v4_10268_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Co-chaperone protein HscB vs. Ensembl Human
Match: HSCB (HscB mitochondrial iron-sulfur cluster cochaperone [Source:HGNC Symbol;Acc:HGNC:28913])

HSP 1 Score: 83.9593 bits (206), Expect = 1.508e-17
Identity = 60/190 (31.58%), Postives = 101/190 (53.16%), Query Frame = 2
Query:  485 KCWNCNESLCKCM---FFC-KCGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILTIKGYKLDEE-DITIDPDFFGEMIEYNERIVEINNDKDREILRNEIDQKFNDILKNVSGSILNTRYDEAFKHLKFLIYFSNLKNKL 1039
            +CWNC           FFC +C  +Q P     YF +       F +D   +  R++Q Q+ +HPD +S+ S+ EK  SE+ S +VN+AY TL  PL R +Y+L + G ++ E  D  +D  F  E++E NE++ E  ++   + + + +  K  +   NVS +     ++EA + L  + YFSN++ K+
Sbjct:   40 RCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDC-NRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKI 228          
BLAST of Co-chaperone protein HscB vs. Ensembl Human
Match: HSCB (HscB mitochondrial iron-sulfur cluster cochaperone [Source:HGNC Symbol;Acc:HGNC:28913])

HSP 1 Score: 52.7582 bits (125), Expect = 1.158e-7
Identity = 37/105 (35.24%), Postives = 58/105 (55.24%), Query Frame = 2
Query:  485 KCWNCNESLC---KCMFFC-KCGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILT 787
            +CWNC        +  FFC +C  +Q P     YF +       F +D   +  R++Q Q+ +HPD +S+ S+ EK  SE+ S +VN+AY TL  PL R +Y+++
Sbjct:   40 RCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDC-NRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLVS 143          
BLAST of Co-chaperone protein HscB vs. Ensembl Human
Match: HSCB (HscB mitochondrial iron-sulfur cluster cochaperone [Source:HGNC Symbol;Acc:HGNC:28913])

HSP 1 Score: 52.7582 bits (125), Expect = 1.158e-7
Identity = 37/105 (35.24%), Postives = 58/105 (55.24%), Query Frame = 2
Query:  485 KCWNCNESLC---KCMFFC-KCGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILT 787
            +CWNC        +  FFC +C  +Q P     YF +       F +D   +  R++Q Q+ +HPD +S+ S+ EK  SE+ S +VN+AY TL  PL R +Y+++
Sbjct:   40 RCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDC-NRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLVS 143          
BLAST of Co-chaperone protein HscB vs. Ensembl Human
Match: HSCB (HscB mitochondrial iron-sulfur cluster cochaperone [Source:HGNC Symbol;Acc:HGNC:28913])

HSP 1 Score: 52.7582 bits (125), Expect = 1.158e-7
Identity = 37/105 (35.24%), Postives = 58/105 (55.24%), Query Frame = 2
Query:  485 KCWNCNESLC---KCMFFC-KCGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILT 787
            +CWNC        +  FFC +C  +Q P     YF +       F +D   +  R++Q Q+ +HPD +S+ S+ EK  SE+ S +VN+AY TL  PL R +Y+++
Sbjct:   40 RCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDC-NRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLVS 143          
BLAST of Co-chaperone protein HscB vs. Ensembl Celegans
Match: dnj-15 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:U4PF47])

HSP 1 Score: 76.2554 bits (186), Expect = 1.608e-15
Identity = 64/204 (31.37%), Postives = 108/204 (52.94%), Query Frame = 2
Query:  431 RNCLH-LQAYVHDCKTLTRKCWNCNESLCKCMFFCKCGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILTIKGYKLDEEDITIDPDFFGEMIEYNERIVEINNDKDREILRNEIDQKFNDILKNVSGSILNTRYDEAFKHLKFLIYFSNLKNKL 1039
            R+ LH ++A  HD   L   CWNC + +   +   KC  IQ  +    YF+  G+ + +F LD + + +++ Q Q  LHPDK+   ++ EKKLSEE S  +NEAY  L  P  RA Y+  IK Y  +  +   + +   EM+E NE I E++++   +  ++ I+ + ++ L+ +     + +  EA   +  L Y  +LKN +
Sbjct:    4 RHLLHQIRAKTHDHTKLHPSCWNCKKDVQDPIICKKCNVIQPVTSGQDYFNYMGV-KFDFRLDQDELKQKFHQLQSKLHPDKFVMATDEEKKLSEEHSRKLNEAYKELADPFKRAKYL--IKEYGEEHPENLQNSEILMEMLERNEEIDEMHDENALKAEKSRIETEIDEQLEQLGTHFESKKIPEARDVIGRLTYLYSLKNTV 204          
BLAST of Co-chaperone protein HscB vs. Ensembl Fly
Match: Hsc20 (gene:FBgn0263606 transcript:FBtr0112440)

HSP 1 Score: 73.1738 bits (178), Expect = 3.230e-14
Identity = 54/193 (27.98%), Postives = 98/193 (50.78%), Query Frame = 2
Query:  488 CWNCNE--SLCKCMFFCKCGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILTIKGYKLDEEDITIDPDFFGEMIEYNERIVEINNDKDREILRN----------EIDQKFNDIL--KNVSGSILNTRYDEAFKHLKFLIYFSN 1024
            CWNC +   L + M    CG +Q  +    YF +   P  +F L+   + + ++Q Q  +HPDKYS  +  E+  S + S+++N+AY TL  P+ R  Y+L ++G ++ +++  ++ +F   M+E NE   E+ + +D + L N          E+ +K N +   K++SG        E    +K+L+   N
Sbjct:   46 CWNCQKKSELKQNMICSDCGHLQDVNSGINYFKLLSFP-IQFSLESQKLTRSFRQLQTIVHPDKYSNKTSREQTNSSDWSSLINKAYKTLSTPIDRGQYLLQLEGEQMPQDNSALNKEFLMAMMERNE---EVEDAEDTQTLENLNIQLIKELEEMARKLNALFDSKDLSG------VKETLVEMKYLLSIQN 228          
BLAST of Co-chaperone protein HscB vs. Ensembl Zebrafish
Match: si:ch211-207k7.4 (si:ch211-207k7.4 [Source:NCBI gene;Acc:100150029])

HSP 1 Score: 107.842 bits (268), Expect = 1.177e-25
Identity = 72/218 (33.03%), Postives = 118/218 (54.13%), Query Frame = 2
Query:  413 SYKNDLRNCLHLQAY-------VHDCKTLTRKCWNCNESLCKCMFFCK-CGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILTIKGYKLDE-EDITIDPDFFGEMIEYNERIVEINNDKDREILRNEIDQKFNDILKNVSGSILNTRYDEAFKHLKFLIYFSNLKNKL 1039
            SY  D ++  H  A             T+ R CWNC  S    +FFC  C  IQ P ++ +YFD+    EN F LD   + +++ + Q+ LHPD +++ S+ E++ SEE SA+VN+AY TL+ PL RA+Y+L ++G  L+E  D T DP    E++E NE + E  +  +   +   + +K  D+ + ++ S+       A   L  + YF+N++ K+
Sbjct:   45 SYSKDFKDVCHSNAAKGRLTLNSFSTVTVNRVCWNCGAS--ADLFFCAFCKVIQPPDNKTSYFDILKCEEN-FSLDTQKLQQKYVKLQRVLHPDNFTQKSQKEQEYSEEQSALVNKAYRTLQKPLSRAVYMLELRGVLLEEGTDATADPALLLEVMEINESLAETRSQDEVSAIGRSVQEKLKDLTERMNSSLNRGDLLAAKMLLNKMKYFTNIQEKV 259          
BLAST of Co-chaperone protein HscB vs. Ensembl Zebrafish
Match: si:ch211-207k7.4 (si:ch211-207k7.4 [Source:NCBI gene;Acc:100150029])

HSP 1 Score: 74.7146 bits (182), Expect = 3.218e-15
Identity = 48/151 (31.79%), Postives = 88/151 (58.28%), Query Frame = 2
Query:  590 IPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILTIKGYKLDE-EDITIDPDFFGEMIEYNERIVEINNDKDREILRNEIDQKFNDILKNVSGSILNTRYDEAFKHLKFLIYFSNLKNKL 1039
            + E  F LD   + +++ + Q+ LHPD +++ S+ E++ SEE SA+VN+AY TL+ PL RA+Y+L ++G  L+E  D T DP    E++E NE + E  +  +   +   + +K  D+ + ++ ++       A   L  + YF+N++ K+
Sbjct:    6 LSEENFSLDTQKLQQKYVELQRVLHPDNFTQKSQKEQEYSEEQSALVNKAYRTLQKPLSRAVYMLELRGVLLEEGTDATADPALLLEVMEINESLAETRSQDEVSAIGRSVQEKLKDLTERMNSTLNRGDLLAAKMLLNKMKYFTNIQEKV 156          
BLAST of Co-chaperone protein HscB vs. Ensembl Xenopus
Match: arl2 (ADP ribosylation factor like GTPase 2 [Source:Xenbase;Acc:XB-GENE-494099])

HSP 1 Score: 83.1889 bits (204), Expect = 4.661e-17
Identity = 55/189 (29.10%), Postives = 102/189 (53.97%), Query Frame = 2
Query:  479 TRKCWNCNESLCKCMFFCK-CGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILTIKGYKLDE-EDITIDPDFFGEMIEYNERIVEINNDKDREILRNEIDQKFNDILKNVSGSILNTRYDEAFKHLKFLIYFSNLKNKL 1039
            +R CW C   + +   FC  C  +Q P     +F +    E  F++D   + ++++  Q+ LHPD +S+ SE E+ +SE+ S +VN+AY TL  PL R +Y+L++ G  L E  D  +D  F  +++E NE++ +     D E + + + ++   + K++  +       EA   L  + YFSN+++++
Sbjct:   75 SRLCWRCQAEMSRAELFCPTCTSLQPPDESKDFFQVLDC-EKSFNVDTQELQRKYRNLQRLLHPDFFSQKSESERNISEKQSTVVNKAYKTLLSPLKRGVYLLSLNGITLKEGADDEVDTQFLFDILELNEQLNDAETKDDIEEVGHFVQEQLVSLTKDLRKAFQQGDLQEAKILLAKMKYFSNIQDQV 262          
BLAST of Co-chaperone protein HscB vs. Ensembl Xenopus
Match: arl2 (ADP ribosylation factor like GTPase 2 [Source:Xenbase;Acc:XB-GENE-494099])

HSP 1 Score: 76.2554 bits (186), Expect = 6.977e-15
Identity = 49/170 (28.82%), Postives = 91/170 (53.53%), Query Frame = 2
Query:  479 TRKCWNCNESLCKCMFFCK-CGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILTIKGYKLDE-EDITIDPDFFGEMIEYNERIVEINNDKDREILRNEIDQKFNDILKNVSGSILNTRYD 982
            +R CW C   + +   FC  C  +Q P     +F +    E  F++D   + ++++  Q+ LHPD +S+ SE E+ +SE+ S +VN+AY TL  PL R +Y+L++ G  L E  D  +D  F  +++E NE++ +     D E + + + ++   + K++  +     +D
Sbjct:   75 SRLCWRCQAEMSRAELFCPTCTSLQPPDESKDFFQVLDC-EKSFNVDTQELQRKYRNLQRLLHPDFFSQKSESERNISEKQSTVVNKAYKTLLSPLKRGVYLLSLNGITLKEGADDEVDTQFLFDILELNEQLNDAETKDDIEEVGHFVQEQLVSLTKDLRKAFQQGHFD 243          
BLAST of Co-chaperone protein HscB vs. Ensembl Mouse
Match: Hscb (HscB iron-sulfur cluster co-chaperone [Source:MGI Symbol;Acc:MGI:2141135])

HSP 1 Score: 92.0485 bits (227), Expect = 1.359e-20
Identity = 60/195 (30.77%), Postives = 106/195 (54.36%), Query Frame = 2
Query:  470 KTLTRKCWNCN---ESLCKCMFFCK-CGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILTIKGYKLDE-EDITIDPDFFGEMIEYNERIVEINNDKDREILRNEIDQKFNDILKNVSGSILNTRYDEAFKHLKFLIYFSNLKNKL 1039
            K++  +CWNC    E  C   FFC  C  +Q P     YF +       F +D+  +  R++Q Q+ +HPD +S+ S+ EK  S++ S +VN+AY TL+ PL R +Y+L ++G ++ E  D   D  F  E++E NER+ +  ++   E +   +  K  +   N++ +     +++A + L  + YFSN++ K+
Sbjct:   34 KSIAPQCWNCGHAREVGCGDEFFCSHCRALQPPDPTRDYFSLMNC-NRSFRVDVTKLQHRYQQLQRLVHPDFFSQKSQTEKHFSDKHSTLVNDAYKTLQAPLTRGLYLLKLQGIEIPEGTDYKADSQFLVEIMEINERLADAQSEAAMEEIEATVRAKQKEFTDNINSAFEQGDFEKAKELLTKMRYFSNIEEKI 227          
BLAST of Co-chaperone protein HscB vs. Ensembl Mouse
Match: Hscb (HscB iron-sulfur cluster co-chaperone [Source:MGI Symbol;Acc:MGI:2141135])

HSP 1 Score: 47.7506 bits (112), Expect = 1.364e-6
Identity = 32/89 (35.96%), Postives = 53/89 (59.55%), Query Frame = 2
Query:  524 FFCK-CGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILT 787
            FFC  C  +Q P     YF +       F +D+  +  R++Q Q+ +HPD +S+ S+ EK  S++ S +VN+AY TL+ PL R +Y+++
Sbjct:    4 FFCSHCRALQPPDPTRDYFSLMNC-NRSFRVDVTKLQHRYQQLQRLVHPDFFSQKSQTEKHFSDKHSTLVNDAYKTLQAPLTRGLYLVS 91          
BLAST of Co-chaperone protein HscB vs. UniProt/SwissProt
Match: sp|Q8K3A0|HSC20_MOUSE (Iron-sulfur cluster co-chaperone protein HscB OS=Mus musculus OX=10090 GN=Hscb PE=1 SV=2)

HSP 1 Score: 93.5893 bits (231), Expect = 3.141e-20
Identity = 60/195 (30.77%), Postives = 107/195 (54.87%), Query Frame = 2
Query:  470 KTLTRKCWNCN---ESLCKCMFFCK-CGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILTIKGYKLDE-EDITIDPDFFGEMIEYNERIVEINNDKDREILRNEIDQKFNDILKNVSGSILNTRYDEAFKHLKFLIYFSNLKNKL 1039
            K++  +CWNC    E+ C   FFC  C  +Q P     YF +       F +D+  +  R++Q Q+ +HPD +S+ S+ EK  S++ S +VN+AY TL+ PL R +Y+L ++G ++ E  D   D  F  E++E NER+ +  ++   E +   +  K  +   N++ +     +++A + L  + YFSN++ K+
Sbjct:   34 KSIAPQCWNCGHAREAGCGDEFFCSHCRALQPPDPTRDYFSLMNC-NRSFRVDVTKLQHRYQQLQRLVHPDFFSQKSQTEKHFSDKHSTLVNDAYKTLQAPLTRGLYLLKLQGIEIPEGTDYKADSQFLVEIMEINERLADAQSEAAMEEIEATVRAKQKEFTDNINSAFEQGDFEKAKELLTKMRYFSNIEEKI 227          
BLAST of Co-chaperone protein HscB vs. UniProt/SwissProt
Match: sp|Q8L7K4|HSCB_ARATH (Iron-sulfur cluster co-chaperone protein HscB homolog OS=Arabidopsis thaliana OX=3702 GN=HSCB PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.343e-18
Identity = 54/185 (29.19%), Postives = 93/185 (50.27%), Query Frame = 2
Query:  467 CKTLTRKCWNCNESLCKCMFFC-KCGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILTIKGYKLDEEDITIDPDFFGEMIEYNERIVEINNDKDREILRNEIDQKFNDILKNVSGSILNTRYDEAFKHLKFLIYF 1018
            C      CWNC E       FC  C  IQ       YF +FG+ E ++++D   +  ++K +Q+ LHPD     S+ E+  + E SA V EA  TL   L RA+YI+ + G  ++EE+   DP    E++E  E I E ++      +R+++ +K      +   +  + ++D+A K ++ + Y+
Sbjct:   60 CSESGAGCWNCGEKAA--FLFCNSCRSIQPVDDSVDYFQIFGL-EKKYEIDPGSLEGKYKDWQKKLHPDLVHNKSKKERDYAAEQSAKVTEACRTLTKRLSRAMYIMKLNGVNVNEEETITDPTLLMEIMELREAISEADDSTSLNQIRSQVQEKLKQWSDSFVEAFESQKFDDAVKCIQRMTYY 241          
BLAST of Co-chaperone protein HscB vs. UniProt/SwissProt
Match: sp|Q8IWL3|HSC20_HUMAN (Iron-sulfur cluster co-chaperone protein HscB OS=Homo sapiens OX=9606 GN=HSCB PE=1 SV=3)

HSP 1 Score: 83.9593 bits (206), Expect = 7.242e-17
Identity = 60/190 (31.58%), Postives = 101/190 (53.16%), Query Frame = 2
Query:  485 KCWNCNESLCKCM---FFC-KCGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILTIKGYKLDEE-DITIDPDFFGEMIEYNERIVEINNDKDREILRNEIDQKFNDILKNVSGSILNTRYDEAFKHLKFLIYFSNLKNKL 1039
            +CWNC           FFC +C  +Q P     YF +       F +D   +  R++Q Q+ +HPD +S+ S+ EK  SE+ S +VN+AY TL  PL R +Y+L + G ++ E  D  +D  F  E++E NE++ E  ++   + + + +  K  +   NVS +     ++EA + L  + YFSN++ K+
Sbjct:   40 RCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDC-NRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKI 228          
BLAST of Co-chaperone protein HscB vs. UniProt/SwissProt
Match: sp|Q9KTX9|HSCB_VIBCH (Co-chaperone protein HscB homolog OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=hscB PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 2.749e-14
Identity = 47/161 (29.19%), Postives = 91/161 (56.52%), Query Frame = 2
Query:  572 YFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILTIKGYKLDEEDITI-DPDFFGEMIEYNERIVEINNDKDREILRNEIDQKFNDI----LKNVSGSILNTRYDEAFKHLKFLIYFSNLKNKL 1039
            YF++FG+P  +F+LD + ++ +++  Q+  HPD ++  SE ++ ++ + +A +N+AY TLK PL RA Y+L+++G +++ E  T+ DP F  E +E  E +  +    D E      D K   +    L  + G +  + +  A   ++ L + + LKN++
Sbjct:    3 YFELFGLPI-QFELDGSLLSSQFRALQKRFHPDNFATASERDRLMAVQQAAQINDAYQTLKDPLRRAEYLLSLQGIEMNAEQQTLQDPMFLMEQMELREELESVTACADPEAALVAFDTKVTAMQRHYLAQLQGQLAQSEWLAAADQIRKLKFIAKLKNEV 162          
BLAST of Co-chaperone protein HscB vs. UniProt/SwissProt
Match: sp|A5F3G7|HSCB_VIBC3 (Co-chaperone protein HscB homolog OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=hscB PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 2.749e-14
Identity = 47/161 (29.19%), Postives = 91/161 (56.52%), Query Frame = 2
Query:  572 YFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILTIKGYKLDEEDITI-DPDFFGEMIEYNERIVEINNDKDREILRNEIDQKFNDI----LKNVSGSILNTRYDEAFKHLKFLIYFSNLKNKL 1039
            YF++FG+P  +F+LD + ++ +++  Q+  HPD ++  SE ++ ++ + +A +N+AY TLK PL RA Y+L+++G +++ E  T+ DP F  E +E  E +  +    D E      D K   +    L  + G +  + +  A   ++ L + + LKN++
Sbjct:    3 YFELFGLPI-QFELDGSLLSSQFRALQKRFHPDNFATASERDRLMAVQQAAQINDAYQTLKDPLRRAEYLLSLQGIEMNAEQQTLQDPMFLMEQMELREELESVTACADPEAALVAFDTKVTAMQRHYLAQLQGQLAQSEWLAAADQIRKLKFIAKLKNEV 162          
BLAST of Co-chaperone protein HscB vs. TrEMBL
Match: A0A2T7NFC4 (J domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_20371 PE=3 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 5.002e-26
Identity = 70/192 (36.46%), Postives = 118/192 (61.46%), Query Frame = 2
Query:  482 RKCWNCNESL--CKCMFFCKCGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILTIKGYKLDEEDITIDPDFFGEMIEYNERIVEINNDKDREILRNEIDQKFNDILKNVSGSILNTRYDEAFKHLKFLIYFSNLKNKL*FYY 1051
            RKCWNC  +    + +FFCKCG +Q P+   TYF +FGI +N F++D+  +++ +K  Q+ LHPD +S  S+ E++L+E+ SA +N+AY +L  PL RA Y+L++ G+ ++E    ++PDF  E+++ NERI E +   + E + NEI  K  +  K +S +  +    +A      L Y+ N++ K+  +Y
Sbjct:   10 RKCWNCGRTTDPSEELFFCKCGVVQTPADGMTYFTLFGIDQN-FEIDIKKLSEEYKNLQKRLHPDMFSNKSKEEQELAEQQSAFLNKAYFSLLKPLPRAQYLLSLYGFDIEEGSTEMNPDFLMEVLDLNERIGE-STTGEMENIENEIVSKIQEYTKQLSDAFSSGDIIKARDITSRLKYYDNVEAKIKAFY 199          
BLAST of Co-chaperone protein HscB vs. TrEMBL
Match: V4A8L8 (J domain-containing protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_96796 PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 7.486e-25
Identity = 63/187 (33.69%), Postives = 111/187 (59.36%), Query Frame = 2
Query:  485 KCWNCNESLCKC--MFFCKCGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILTIKGYKLDEEDITIDPDFFGEMIEYNERIVEINNDKDREILRNEIDQKFNDILKNVSGSILNTRYDEAFKHLKFLIYFSNLKNKL 1039
            +CW C   +     +F+CKCG +QKP+   TYF +FG+ E+ FD+DL  +++++ + Q+ LHPDK+S+ SE EK  + + S++VN+AY  L  PL RAIY+L +    ++E     DP+F  E++E NE + E+++ +D +I   + +      ++ +S +  +     A +    L Y+SN+  K+
Sbjct:    1 ECWKCGRQMTDPAELFYCKCGIVQKPASNLTYFQLFGLNED-FDVDLKPLSEKYIELQKQLHPDKFSQASETEKSHAADQSSLVNKAYSVLTKPLHRAIYMLELHDNPIEESSAISDPEFLMEIMELNEELAEVDSPEDLKIFEEQNESNIVKNIQEISAAFKSKNIPSAHELAIKLQYYSNISEKI 186          
BLAST of Co-chaperone protein HscB vs. TrEMBL
Match: T1JFU1 (J domain-containing protein OS=Strigamia maritima OX=126957 PE=3 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 6.409e-24
Identity = 73/228 (32.02%), Postives = 122/228 (53.51%), Query Frame = 2
Query:  368 FSSLNKQLYDFISNLSYKNDLRNCLHLQAYVHDCKTLTRKCWNCNESLCKCMFFC-KCGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILTIKGYKLDEEDITIDPDFFGEMIEYNERIVEINNDKDREILRNEI----DQKFNDILKNVSGSILNTRYDEAFKHLKFLIYFSNLKNK 1036
            F S  +Q    I  L+  N  +  L L + +   ++  R CW C   + K  F C +C  +Q P  +  +F +F + E +FD+D++ +  R+K  Q+  HPDK++  S  E+  S   SA +N+AY TL  PL R +YIL ++G  L EE +T+  DF  E++E NE +V+ + D +      EI     +K +  ++N+S  + +  +D A K L  L Y++N++ K
Sbjct:   22 FRSARRQRASGIVQLAKFNVTKRGLQLSSSIRSNES-ERMCWKCQSVIPKQKFVCSECQCLQSPDSKMNHFQLFEM-EEKFDVDVHALTNRFKNLQRKFHPDKFAGKSRVERDHSALYSAQINKAYQTLLKPLQRGLYILELRGRPLVEESVTMSADFLMEIMEINEALVDADADVESTAKVEEIASKNAEKIDKSIENLSSELKSGNWDAAQKTLAELKYYTNIEEK 247          
BLAST of Co-chaperone protein HscB vs. TrEMBL
Match: A0A1S3JYJ6 (iron-sulfur cluster co-chaperone protein HscB, mitochondrial-like OS=Lingula unguis OX=7574 GN=LOC106177280 PE=3 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 3.301e-23
Identity = 66/193 (34.20%), Postives = 124/193 (64.25%), Query Frame = 2
Query:  476 LTRKCWNCNESL--CKCMFFCK---CGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILTIKGYKLDEEDITIDPDFFGEMIEYNERIVEINNDKDREILRNEIDQKFNDILKNVSGSILNTRYDEAFKHLKFLIYFSNLKNKL 1039
            L R CW C++ +   + +FFC    CG IQ P  Q T+F + GI ++ FD+D   ++K ++  Q+ +HPDK+S+ S  E+ +SE+ ++++N+AY TL +PL R +YIL ++G  ++E+ I ++P+F  E++E NERI+E ++ K+ E ++ E     ++++K +S +     + +A   L  + YF+N+++K+
Sbjct:   89 LERPCWRCHKIVNPKEDLFFCTYEDCGVIQHPLEQLTFFQIMGIAKS-FDIDTVRMSKIYRNLQRLIHPDKFSQKSVEERTISEQQASLINKAYFTLLHPLSRGLYILELEGISIEEDSIDMEPEFLMEVMEINERILESDDAKEVEQIKQENKNNKDNLVKELSFAFRQNDFAQAKILLSRMKYFANIEDKV 280          
BLAST of Co-chaperone protein HscB vs. TrEMBL
Match: A0A0B6ZYP6 (J domain-containing protein OS=Arion vulgaris OX=1028688 GN=ORF84337 PE=4 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 5.562e-23
Identity = 62/188 (32.98%), Postives = 114/188 (60.64%), Query Frame = 2
Query:  482 RKCWNCNESL--CKCMFFCKCGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILTIKGYKLDEEDITIDPDFFGEMIEYNERIVEINNDKDREILRNEIDQKFNDILKNVSGSILNTRYDEAFKHLKFLIYFSNLKNKL 1039
            R CWNC       + +FFC CG +QKP+++ TYFD+  + +  FD+D+  +   +K+ Q+ LHPDK+S  ++ E  L+++ SA++N+AY+TL+ PL RAIY+L ++   + E+D   +P+F  E+++ NE+I  ++N  D E L    D +  + +K +S    +   D+  +    L Y++ ++ ++
Sbjct:  105 RHCWNCGRDTNPVRELFFCDCGVVQKPANELTYFDLMQM-KPSFDIDIKRLGDIFKETQKKLHPDKFSGKTQAETDLAQQQSALLNKAYNTLQKPLSRAIYLLHLQNIDISEKDNFTEPEFLTEIMDINEQISNVHNASDTEGLEKTNDARIANCVKEISNLYSSNNLDDMKRATIKLRYYTTIQERV 291          
BLAST of Co-chaperone protein HscB vs. Ensembl Cavefish
Match: si:ch211-207k7.4 (HscB mitochondrial iron-sulfur cluster cochaperone [Source:NCBI gene;Acc:103030933])

HSP 1 Score: 105.531 bits (262), Expect = 5.491e-25
Identity = 62/188 (32.98%), Postives = 109/188 (57.98%), Query Frame = 2
Query:  482 RKCWNCNESLCKCMFFCK-CGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILTIKGYKLDE-EDITIDPDFFGEMIEYNERIVEINNDKDREILRNEIDQKFNDILKNVSGSILNTRYDEAFKHLKFLIYFSNLKNKL 1039
            R CW+C       +FFC  C  IQ P+H  TYF +    +  F +D+  + +R+ + Q+ LHPD +S  S  E++ SE+ SA+VN+AY TL+ P+ RA+Y+L + G +L E  D T DP+F  E++E NE++ E  + ++ + +   + +   D+ + ++ ++       A + L  + YF+NL+ K+
Sbjct:   76 RSCWSCGSP--AQLFFCSACKIIQPPNHGATYFQILNC-DQTFAVDVPELQRRYLELQRSLHPDNFSLKSPTEQEYSEKQSALVNKAYRTLQKPVPRAVYMLQLHGVRLQEGTDATADPNFLLEVMETNEKLAESRSPEEVDDIGQAVRETLKDLTEQMNTALNKGDLQSARELLARMKYFANLEEKV 260          
BLAST of Co-chaperone protein HscB vs. Ensembl Sea Lamprey
Match: si:ch211-207k7.4 (si:ch211-207k7.4 [Source:NCBI gene;Acc:100150029])

HSP 1 Score: 76.6406 bits (187), Expect = 3.153e-16
Identity = 54/187 (28.88%), Postives = 101/187 (54.01%), Query Frame = 2
Query:  485 KCWNCNESL-CKCMFFC-KCGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILTIKGYKLDEEDITIDPDFFGEMIEYNERIVEINNDKDREILRNEIDQKFNDILKNVSGSILNTRYDEAFKHLKFLIYFSNLKNKL 1039
            +CW C   +    +FFC +C  +  P    + F + G  E+ F ++L  + + +   Q+ LHPD +S+ S+ E  LS++ SA+VN+AY+TL  PL R +Y+L   G  L++    +DP+F  E++E NE + + ++ ++ E +     +K  ++ + V  +     +  A   L  + YF+N+  K+
Sbjct:   19 RCWGCRSDVGADSVFFCSRCHSVLPPRPGASLFQLLGCNES-FSVNLQKLQQAYLALQRQLHPDNFSQKSQRELDLSQQQSALVNKAYNTLLKPLPRGVYLLERHGLSLEDTTEDMDPEFLMEIMEINEDLEDADSLQEIEDISRCNLEKLQELTQEVMQAFDAGNFLLARLLLTKMNYFTNIDEKV 204          
BLAST of Co-chaperone protein HscB vs. Ensembl Yeast
Match: JAC1 (Specialized J-protein that functions in Fe-S cluster biogenesis; functions with Hsp70 in Fe-S cluster biogenesis in mitochondria; involved in iron metabolism; contains a J domain typical to J-type chaperones; localizes to the mitochondrial matrix [Source:SGD;Acc:S000002986])

HSP 1 Score: 45.0542 bits (105), Expect = 8.744e-6
Identity = 36/147 (24.49%), Postives = 71/147 (48.30%), Query Frame = 2
Query:  605 FDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILT-IKGYKLDEED-----ITIDPDFFGEMIEYNERIVEINNDKDREILRNEIDQKFNDILKNVSGSILNTRYDEAFKHLKFLIYFSNL 1027
            + +D + + K ++Q Q   HPD   + SE          + +N+AYHTLK PL R+ Y+L  ++   L +E       T DP    ++++ ++ + +++++   ++L  +  ++  DI   +     +  Y  A K    L Y+ NL
Sbjct:   29 WTIDQSRLRKEYRQLQAQHHPDMAQQGSEQS--------STLNQAYHTLKDPLRRSQYMLKLLRNIDLTQEQTSNEVTTSDPQLLLKVLDIHDELSQMDDEAGVKLLEKQNKERIQDIEAQLGQCYNDKDYAAAVKLTVELKYWYNL 167          
BLAST of Co-chaperone protein HscB vs. Ensembl Nematostella
Match: EDO47472 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMA9])

HSP 1 Score: 100.908 bits (250), Expect = 6.188e-24
Identity = 65/194 (33.51%), Postives = 107/194 (55.15%), Query Frame = 2
Query:  467 CKTLTRKCWNCNESL-CKCMFFC-KCGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILTIKGYKLDEEDIT-IDPDFFGEMIEYNERIVEINNDKDREILRNEIDQKFNDILKNVSGSILNTRYDEAFKHLKFLIYFSNLKNKL 1039
            C +  R CW C+ +L     FFC  C  IQ P     YF++   PE  F +D   + K ++  Q  LHPD++S  +E E+  S   S++VN+AY TL  PL R +Y+L I G  ++E DI+  +  F  E++E NE+I + +NDK+ +++ +E + K      +V+ +        A +HL  L Y++N+ N++
Sbjct:   52 CCSRPRTCWKCHSNLFGHADFFCPSCDVIQPPEGDANYFEIMDRPEG-FRIDTEVLTKDYRDLQMKLHPDRFSLQAEEEQNFSALQSSVVNQAYRTLLKPLSRGLYLLKIHGESIEEGDISSCNAKFLMEIMEINEKIEDASNDKNIQVIEDENNAKIQRCTHDVAEAFEEGNIMAAKEHLCKLKYYTNISNQI 244          
BLAST of Co-chaperone protein HscB vs. Ensembl Medaka
Match: si:ch211-207k7.4 (HscB mitochondrial iron-sulfur cluster cochaperone [Source:NCBI gene;Acc:101162843])

HSP 1 Score: 85.8853 bits (211), Expect = 2.521e-18
Identity = 66/213 (30.99%), Postives = 106/213 (49.77%), Query Frame = 2
Query:  416 YKNDLR--NCLHLQAYVHDCKTLTRKCWNCNESLCKC-MFFC-KCGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILTIKGYKLDE-EDITIDPDFFGEMIEYNERIVEINNDKDREILRNEIDQKFNDILKNVSGSILNTRYDEAFKHLKFLIYFSNLKNKL 1039
            Y N++R  NC   QA  +        CWNC + L     FFC  C  IQ P+   +YF +    +  F +D   + +R+ Q Q+ LHPD +S+ S  E++ SE  SA+VN AY TL  PL R +Y+L ++G  L+E  D   D  F   ++E NE + E    ++ E +  +   K  D+   +  ++       A   L  + Y++N++ K+
Sbjct:   50 YPNEVRFRNCSTSQAKTN--------CWNCKQLLDNVPAFFCNSCKTIQPPAEGESYFKIMDC-DYTFTVDTQKLQRRYLQLQRFLHPDNFSQRSAKEREYSESQSALVNRAYKTLLKPLSRGLYMLELEGMHLEEGTDSGADSAFLMRLMEINEAVDEAQTPEEAEEIGRDTRGKLADLTGQIDAALHKGELHAAKALLVQMKYYANIEEKV 253          
BLAST of Co-chaperone protein HscB vs. Ensembl Medaka
Match: si:ch211-207k7.4 (HscB mitochondrial iron-sulfur cluster cochaperone [Source:NCBI gene;Acc:101162843])

HSP 1 Score: 85.8853 bits (211), Expect = 4.556e-18
Identity = 66/213 (30.99%), Postives = 106/213 (49.77%), Query Frame = 2
Query:  416 YKNDLR--NCLHLQAYVHDCKTLTRKCWNCNESLCKC-MFFC-KCGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILTIKGYKLDE-EDITIDPDFFGEMIEYNERIVEINNDKDREILRNEIDQKFNDILKNVSGSILNTRYDEAFKHLKFLIYFSNLKNKL 1039
            Y N++R  NC   QA  +        CWNC + L     FFC  C  IQ P+   +YF +    +  F +D   + +R+ Q Q+ LHPD +S+ S  E++ SE  SA+VN AY TL  PL R +Y+L ++G  L+E  D   D  F   ++E NE + E    ++ E +  +   K  D+   +  ++       A   L  + Y++N++ K+
Sbjct:   50 YPNEVRFRNCSTSQAKTN--------CWNCKQLLDNVPAFFCNSCKTIQPPAEGESYFKIMDC-DYTFTVDTQKLQRRYLQLQRFLHPDNFSQRSAKEREYSESQSALVNRAYKTLLKPLSRGLYMLELEGMHLEEGTDSGADSAFLMRLMEINEAVDEAQTPEEAEEIGRDTRGKLADLTGQIDAALHKGELHAAKALLVQMKYYANIEEKV 253          
BLAST of Co-chaperone protein HscB vs. Planmine SMEST
Match: SMESG000029778.1 (SMESG000029778.1)

HSP 1 Score: 426.787 bits (1096), Expect = 1.114e-147
Identity = 227/228 (99.56%), Postives = 227/228 (99.56%), Query Frame = 2
Query:  356 MRKVFSSLNKQLYDFISNLSYKNDLRNCLHLQAYVHDCKTLTRKCWNCNESLCKCMFFCKCGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDXXXXXXXXXXXXXXXXXAIVNEAYHTLKYPLLRAIYILTIKGYKLDEEDITIDPDFFGEMIEYNERIVEINNDKDREILRNEIDQKFNDILKNVSGSILNTRYDEAFKHLKFLIYFSNLKNKL 1039
            MRKVFSSLNKQLYDFISNLSYKNDLRNCLHLQAYVHDCKTLTRKCWNCNESLCKCMFFCKCGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDKYSKFSEYEKKLSEESSAIVNEAYHTLKYPLLRAIYILTIKGYKLDEEDITIDPDFFGEMIEYNERIVEINNDKDREILRNEIDQKFNDILKNVS SILNTRYDEAFKHLKFLIYFSNLKNKL
Sbjct:    1 MRKVFSSLNKQLYDFISNLSYKNDLRNCLHLQAYVHDCKTLTRKCWNCNESLCKCMFFCKCGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQDLHPDKYSKFSEYEKKLSEESSAIVNEAYHTLKYPLLRAIYILTIKGYKLDEEDITIDPDFFGEMIEYNERIVEINNDKDREILRNEIDQKFNDILKNVSDSILNTRYDEAFKHLKFLIYFSNLKNKL 228          
The following BLAST results are available for this feature:
BLAST of Co-chaperone protein HscB vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
HSCB1.508e-1731.58HscB mitochondrial iron-sulfur cluster cochaperone... [more]
HSCB1.158e-735.24HscB mitochondrial iron-sulfur cluster cochaperone... [more]
HSCB1.158e-735.24HscB mitochondrial iron-sulfur cluster cochaperone... [more]
HSCB1.158e-735.24HscB mitochondrial iron-sulfur cluster cochaperone... [more]
back to top
BLAST of Co-chaperone protein HscB vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dnj-151.608e-1531.37DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
back to top
BLAST of Co-chaperone protein HscB vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Hsc203.230e-1427.98gene:FBgn0263606 transcript:FBtr0112440[more]
back to top
BLAST of Co-chaperone protein HscB vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch211-207k7.41.177e-2533.03si:ch211-207k7.4 [Source:NCBI gene;Acc:100150029][more]
si:ch211-207k7.43.218e-1531.79si:ch211-207k7.4 [Source:NCBI gene;Acc:100150029][more]
back to top
BLAST of Co-chaperone protein HscB vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
arl24.661e-1729.10ADP ribosylation factor like GTPase 2 [Source:Xenb... [more]
arl26.977e-1528.82ADP ribosylation factor like GTPase 2 [Source:Xenb... [more]
back to top
BLAST of Co-chaperone protein HscB vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Hscb1.359e-2030.77HscB iron-sulfur cluster co-chaperone [Source:MGI ... [more]
Hscb1.364e-635.96HscB iron-sulfur cluster co-chaperone [Source:MGI ... [more]
back to top
BLAST of Co-chaperone protein HscB vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8K3A0|HSC20_MOUSE3.141e-2030.77Iron-sulfur cluster co-chaperone protein HscB OS=M... [more]
sp|Q8L7K4|HSCB_ARATH2.343e-1829.19Iron-sulfur cluster co-chaperone protein HscB homo... [more]
sp|Q8IWL3|HSC20_HUMAN7.242e-1731.58Iron-sulfur cluster co-chaperone protein HscB OS=H... [more]
sp|Q9KTX9|HSCB_VIBCH2.749e-1429.19Co-chaperone protein HscB homolog OS=Vibrio choler... [more]
sp|A5F3G7|HSCB_VIBC32.749e-1429.19Co-chaperone protein HscB homolog OS=Vibrio choler... [more]
back to top
BLAST of Co-chaperone protein HscB vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7NFC45.002e-2636.46J domain-containing protein OS=Pomacea canaliculat... [more]
V4A8L87.486e-2533.69J domain-containing protein (Fragment) OS=Lottia g... [more]
T1JFU16.409e-2432.02J domain-containing protein OS=Strigamia maritima ... [more]
A0A1S3JYJ63.301e-2334.20iron-sulfur cluster co-chaperone protein HscB, mit... [more]
A0A0B6ZYP65.562e-2332.98J domain-containing protein OS=Arion vulgaris OX=1... [more]
back to top
BLAST of Co-chaperone protein HscB vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-207k7.45.491e-2532.98HscB mitochondrial iron-sulfur cluster cochaperone... [more]
back to top
BLAST of Co-chaperone protein HscB vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-207k7.43.153e-1628.88si:ch211-207k7.4 [Source:NCBI gene;Acc:100150029][more]
back to top
BLAST of Co-chaperone protein HscB vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
JAC18.744e-624.49Specialized J-protein that functions in Fe-S clust... [more]
back to top
BLAST of Co-chaperone protein HscB vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO474726.188e-2433.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Co-chaperone protein HscB vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch211-207k7.42.521e-1830.99HscB mitochondrial iron-sulfur cluster cochaperone... [more]
si:ch211-207k7.44.556e-1830.99HscB mitochondrial iron-sulfur cluster cochaperone... [more]
back to top
BLAST of Co-chaperone protein HscB vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000029778.11.114e-14799.56SMESG000029778.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008254 ID=SMED30008254|Name=Co-chaperone protein HscB|organism=Schmidtea mediterranea sexual|type=transcript|length=1883bp
AAAATATTTTGATCACAATGTATAAATATACGCTATCCAATCAAAAACAG
CTATTATTTTTTCTAACAGAAATATTCTGTGTTCTATTGAAATAAAATTT
TACAGTAGCCATTCCTTAGGCCGATTAAAATTATCGATCTAAGTGGATTT
AAAATGTGTAATTGATAATCTTGCTTGCTCATATAAATTGTATTTTAAAA
TTTTTATAAGTTAGCTTATAATTTCAAATTAAAATTTAAATTAAATGAAT
TAAAATTTTAAACTAAATTAATAGTTACTTTATTTATAAATTGTTCTTGT
TTGAATAATGCATATTATTTTACATTTTTGAAAGGTTAAAGTTATTTAAT
TGTAAATGCGAAAAGTATTTTCCTCATTAAATAAGCAATTATATGATTTC
ATAAGCAATTTGTCTTATAAGAATGATTTACGGAATTGTTTACATTTACA
AGCTTACGTTCACGATTGTAAAACATTAACGAGAAAGTGTTGGAATTGTA
ATGAAAGCTTATGTAAATGCATGTTTTTTTGTAAATGTGGCAAAATCCAA
AAACCGAGTCATCAATGTACATATTTTGACATGTTTGGAATTCCTGAAAA
CGAATTTGACTTAGACCTAAATTTTATTAATAAAAGATGGAAGCAATTTC
AACAAGATCTACATCCTGACAAATATTCGAAATTCAGTGAATATGAAAAA
AAATTATCTGAAGAATCTTCTGCCATAGTTAATGAGGCATATCATACTTT
GAAATACCCACTATTAAGAGCTATTTATATACTTACAATAAAAGGTTATA
AATTGGACGAAGAAGATATTACAATCGATCCTGATTTTTTCGGTGAAATG
ATCGAGTATAACGAGAGGATTGTTGAAATCAATAACGACAAAGATAGAGA
AATTCTAAGAAATGAAATAGATCAAAAATTTAATGATATTTTAAAAAATG
TATCAGGTAGCATTTTAAATACGAGATACGACGAAGCATTCAAACATTTG
AAATTTTTAATTTATTTTAGCAATTTAAAAAATAAATTATAATTTTATTA
TGTAAAAATTTTTGAATTTCGATTATTATGAAAACAATAATCTATTCCGT
ACTTTTTGTTATAAAAAAAAACAATTGTTCAACAAATCCATGCCTTGGAA
ACTACTCGCTGAATTATCTGATTCACTACCATAATTTATGAATTCAAAGA
ATAAACATGATAGTGCTTGGCTTATTGGTATTATATCATAACACAGTTGT
ACCACGAATCGTCTCAAGGTAGTCTCTTATTCTGATAATCATCTATTTTG
TGAGTCATTCGGATTCATCACTCAGAATTTCTGACCTCAACAAAACCTAA
AGAAACTTATCATAAACCATTGTATTGAAGCTCTTATCTGCTGGCTTTGG
AAATTGGTTCTAAAATTATCATTTCAAGTGAGTTAACTCTAGTGAAATTC
TTTCGTTGTTGATAGGATCCTTGACAATTTTAGACGAGTTATCTTTTAGT
TCGGTTCATTCTTGTTGATATCAGTTTGAATAATAAACAAGTAAATGAAA
TCTTTTATTTATGAAGCCTTTTACGTTGCTTTGTTAAGATATTTGAATTC
TTACAAAAATTTTACAGTTTCGTTAAATGTTGACATCTATAACTCTAAAT
TGTGAGTAGGTTGGGGAGCATCCATTATTGACCTATGCCCTGTGTCCCTT
TATGCCTAATATTGTCCTCATGTACCCCATATCTTAGACGACGTCCTTAA
TGGATGCTCCATTGTCAAACAAGTACATCAACATGTAAACTTATTATTAG
CACCTTTTAAAGCTTCATCGAAATCTCTTAATAATTATTCTGATGTAGTT
TTATTTTTCATTTTAAATTATGTCAAAGTCGAT
back to top

protein sequence of SMED30008254-orf-1

>SMED30008254-orf-1 ID=SMED30008254-orf-1|Name=SMED30008254-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=229bp
MRKVFSSLNKQLYDFISNLSYKNDLRNCLHLQAYVHDCKTLTRKCWNCNE
SLCKCMFFCKCGKIQKPSHQCTYFDMFGIPENEFDLDLNFINKRWKQFQQ
DLHPDKYSKFSEYEKKLSEESSAIVNEAYHTLKYPLLRAIYILTIKGYKL
DEEDITIDPDFFGEMIEYNERIVEINNDKDREILRNEIDQKFNDILKNVS
GSILNTRYDEAFKHLKFLIYFSNLKNKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006457protein folding
GO:0051259protein oligomerization
GO:0032781positive regulation of ATPase activity
GO:0097428protein maturation by iron-sulfur cluster transfer
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036386HscB_C_sf
IPR004640HscB
IPR036869J_dom_sf
IPR001623DnaJ_domain
IPR009073HscB_oligo_C
Vocabulary: molecular function
TermDefinition
GO:0001671ATPase activator activity
GO:0051087chaperone binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001623DnaJ domainSMARTSM00271dnaj_3coord: 71..137
e-value: 0.0077
score: 25.3
IPR001623DnaJ domainPROSITEPS50076DNAJ_2coord: 72..145
score: 9.525
IPR009073Co-chaperone HscB, C-terminal oligomerisation domainPFAMPF07743HSCB_Ccoord: 158..228
e-value: 4.4E-7
score: 30.3
IPR036386HscB, C-terminal domain superfamilyGENE3DG3DSA:1.20.1280.20coord: 151..228
e-value: 6.5E-8
score: 34.5
IPR036386HscB, C-terminal domain superfamilySUPERFAMILYSSF47144HSC20 (HSCB), C-terminal oligomerisation domaincoord: 151..228
IPR004640Co-chaperone Hsc20TIGRFAMTIGR00714TIGR00714coord: 84..227
e-value: 3.5E-23
score: 80.4
IPR004640Co-chaperone Hsc20PANTHERPTHR14021FAMILY NOT NAMEDcoord: 34..227
IPR036869Chaperone J-domain superfamilyGENE3DG3DSA:1.10.287.110coord: 34..144
e-value: 4.2E-28
score: 100.0
IPR036869Chaperone J-domain superfamilySUPERFAMILYSSF46565Chaperone J-domaincoord: 72..144