Serine/threonine-protein phosphatase

Overview
NameSerine/threonine-protein phosphatase
Smed IDSMED30008233
Length (bp)1116
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein phosphatase (SMED30008233) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase (SMED30008233) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein phosphatase (SMED30008233) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase (SMED30008233) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008233

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30008233SMESG000023415.1 dd_Smed_v4_581_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008233SMESG000023415.1 dd_Smed_v4_581_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30008233SMESG000023415.1 dd_Smed_v4_581_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30008233SMESG000023415.1 dd_Smed_v4_581_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008233SMESG000023415.1 dd_Smed_v4_581_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30008233SMESG000023415.1 SMED30008233smed_20140614PMID:27441386
Arnold et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30008233SMESG000023415.1 SMED30008233smed_20140614PMID:27441386
Arnold et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30008233SMESG000023415.1 SMED30008233smed_20140614PMID:27441386
Arnold et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP6C (protein phosphatase 6 catalytic subunit [Source:HGNC Symbol;Acc:HGNC:9323])

HSP 1 Score: 445.662 bits (1145), Expect = 2.472e-157
Identity = 214/307 (69.71%), Postives = 254/307 (82.74%), Query Frame = 2
Query:   77 MVQMNIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            M  +++D+++E A  CKYLPENDL RLCDYV  LL+EE N+QPVSTPVT+CGDIHGQFYDL ELFRTGG +  TNYIFMGDFVDRGYYSLET T LL LKAK+P++ITLLRGNHESRQITQVYGFYDEC  KYGNA  W+ C K+FD++T+AALID++ILCVHGGLSP+I + DQI+ ++RNQEIP KG FCDLVWSDP+DV   W  SPRGAG+LFG +VT EF+H+N L LICRAHQL+ EG ++ F+ +LVTVWSAPNYCYRCGN+A+++ FK+   R   L F AVPD  R IPPR TTPYFL
Sbjct:    1 MAPLDLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDV-DTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKL-FRAVPDSERVIPPRTTTPYFL 305          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP6C (protein phosphatase 6 catalytic subunit [Source:HGNC Symbol;Acc:HGNC:9323])

HSP 1 Score: 425.246 bits (1092), Expect = 7.635e-149
Identity = 214/344 (62.21%), Postives = 254/344 (73.84%), Query Frame = 2
Query:   77 MVQMNIDEWLEYAYKCKYLPENDLN-------------------------------------RLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            M  +++D+++E A  CKYLPENDL                                      RLCDYV  LL+EE N+QPVSTPVT+CGDIHGQFYDL ELFRTGG +  TNYIFMGDFVDRGYYSLET T LL LKAK+P++ITLLRGNHESRQITQVYGFYDEC  KYGNA  W+ C K+FD++T+AALID++ILCVHGGLSP+I + DQI+ ++RNQEIP KG FCDLVWSDP+DV   W  SPRGAG+LFG +VT EF+H+N L LICRAHQL+ EG ++ F+ +LVTVWSAPNYCYRCGN+A+++ FK+   R   L F AVPD  R IPPR TTPYFL
Sbjct:    1 MAPLDLDKYVEIARLCKYLPENDLKVSPICGLAPSGCGAPAGRPFLSPGPPPVFHFLRFLKERLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDV-DTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKL-FRAVPDSERVIPPRTTTPYFL 342          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP6C (protein phosphatase 6 catalytic subunit [Source:HGNC Symbol;Acc:HGNC:9323])

HSP 1 Score: 398.667 bits (1023), Expect = 3.754e-139
Identity = 197/307 (64.17%), Postives = 236/307 (76.87%), Query Frame = 2
Query:   77 MVQMNIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            M  +++D+++E A  CKYLPENDL RLCDYV  LL+EE N+QPVSTPVT+CGDIHGQ                      GDFVDRGYYSLET T LL LKAK+P++ITLLRGNHESRQITQVYGFYDEC  KYGNA  W+ C K+FD++T+AALID++ILCVHGGLSP+I + DQI+ ++RNQEIP KG FCDLVWSDP+DV   W  SPRGAG+LFG +VT EF+H+N L LICRAHQL+ EG ++ F+ +LVTVWSAPNYCYRCGN+A+++ FK+   R   L F AVPD  R IPPR TTPYFL
Sbjct:    1 MAPLDLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQ----------------------GDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDV-DTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKL-FRAVPDSERVIPPRTTTPYFL 283          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP4C (protein phosphatase 4 catalytic subunit [Source:HGNC Symbol;Acc:HGNC:9319])

HSP 1 Score: 364.77 bits (935), Expect = 1.871e-125
Identity = 172/304 (56.58%), Postives = 223/304 (73.36%), Query Frame = 2
Query:   89 NIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRI-TTPYFL 997
            ++D  +E   +C+ + E+++  LC     +L+EE N+Q V +PVT+CGDIHGQFYDL ELFR GGD+ +TNY+FMGDFVDRG+YS+ET  LLL LK +YP++ITL+RGNHESRQITQVYGFYDECL KYG+   W+ C +IFD ++++A+ID KI CVHGGLSP I + DQI+ +DR QE+P  GP CDL+WSDP+D    W  SPRGAGYLFG  V  +F   N +++ICRAHQL+ EG ++ FN  ++TVWSAPNYCYRCGN+AA+L       + D + F A P E R IP +     YFL
Sbjct:    6 DLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDPEDTT-GWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQK-DFIIFEAAPQETRGIPSKKPVADYFL 307          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP4C (protein phosphatase 4 catalytic subunit [Source:HGNC Symbol;Acc:HGNC:9319])

HSP 1 Score: 364.77 bits (935), Expect = 1.871e-125
Identity = 172/304 (56.58%), Postives = 223/304 (73.36%), Query Frame = 2
Query:   89 NIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRI-TTPYFL 997
            ++D  +E   +C+ + E+++  LC     +L+EE N+Q V +PVT+CGDIHGQFYDL ELFR GGD+ +TNY+FMGDFVDRG+YS+ET  LLL LK +YP++ITL+RGNHESRQITQVYGFYDECL KYG+   W+ C +IFD ++++A+ID KI CVHGGLSP I + DQI+ +DR QE+P  GP CDL+WSDP+D    W  SPRGAGYLFG  V  +F   N +++ICRAHQL+ EG ++ FN  ++TVWSAPNYCYRCGN+AA+L       + D + F A P E R IP +     YFL
Sbjct:    6 DLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDPEDTT-GWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQK-DFIIFEAAPQETRGIPSKKPVADYFL 307          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: pph-6 (Putative serine/threonine-protein phosphatase pph-6 [Source:UniProtKB/Swiss-Prot;Acc:Q09496])

HSP 1 Score: 373.244 bits (957), Expect = 6.814e-129
Identity = 181/301 (60.13%), Postives = 229/301 (76.08%), Query Frame = 2
Query:   95 DEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            ++W+ +A +CKYLPE+D   LC  +   L  E N+ PVS+PVTICGDIHGQFYDLLELF+TGG +  T Y+FMGD+VDRG+YSLET+TLL  L  KYP +ITLLRGNHESR+I+ VYGFYDEC NKYG+    K  CK+FD++ I ALID+ +LCVHGGLSP+I + D + LLDR QE+P KGP CD++WSDPDD +++W  S RGAG++FG +VT+EFL  N L+L+CR+HQL+ EG +Y FN +L TVWSAPNYCYRCGN AAV  F+   +      F+AVPD +R  P R+  PYFL
Sbjct:   33 EQWITWASECKYLPESDAVALCATLIDRLSLEANVVPVSSPVTICGDIHGQFYDLLELFKTGGTVPNTKYVFMGDYVDRGHYSLETVTLLFCLLLKYPNQITLLRGNHESRRISNVYGFYDECQNKYGHGNVHKWFCKVFDVLPIGALIDESVLCVHGGLSPDIRTIDSLMLLDRAQEVPNKGPLCDIMWSDPDDDVEDWVISQRGAGFVFGAKVTEEFLMNNDLSLLCRSHQLVDEGFKYMFNEKLATVWSAPNYCYRCGNAAAV--FEIDGNNRSTKYFNAVPDGSREKPDRVVAPYFL 331          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: pph-4.1 (Serine/threonine-protein phosphatase 4 catalytic subunit 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XW79])

HSP 1 Score: 367.851 bits (943), Expect = 9.162e-127
Identity = 168/300 (56.00%), Postives = 224/300 (74.67%), Query Frame = 2
Query:   77 MVQMNIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPR 976
            +   ++D  +E   +C+ + E D+  LC     +L EE N+Q + +PVTICGDIHGQFYDL+ELF+ GG +  TNY+F+GDFVDRG+YS+ET  LLL LKA+YP+++ L+RGNHESRQITQVYGFYDECL KYGNA  WK C ++FD +++AA+ID K+ CVHGGLSP I++ DQI+++DR QE+P  GP CDL+WSDP++    W  SPRGAGYLFG   +K F   NG++LICRAHQL+ EG ++ FN +++TVWSAPNYCYRCGN+AA+L    + ++ +   F A P ENR  P +
Sbjct:   27 LTTHDLDRHIEKLMRCELIAEQDVKTLCAKAREILAEEGNVQVIDSPVTICGDIHGQFYDLMELFKVGGPVPNTNYLFLGDFVDRGFYSVETFLLLLALKARYPDRMMLIRGNHESRQITQVYGFYDECLRKYGNASVWKHCTEVFDYLSLAAVIDGKVFCVHGGLSPSISTMDQIRVIDRKQEVPHDGPMCDLLWSDPEEGNVGWGLSPRGAGYLFGADASKTFCETNGVDLICRAHQLVMEGYKWHFNEKVLTVWSAPNYCYRCGNVAAILELDENLNK-EFTIFEAAPQENRGAPAK 325          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: pph-4.2 (Serine/threonine-protein phosphatase 4 catalytic subunit 2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTT8])

HSP 1 Score: 340.887 bits (873), Expect = 2.463e-116
Identity = 167/306 (54.58%), Postives = 217/306 (70.92%), Query Frame = 2
Query:   89 NIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAF--KNSTDRPDILQFSAVPDENRTIPPRI-TTPYFL 997
            ++D  +E A +C+ + E  +  +C  V  +LIEE N+Q + TPVTICGDIHGQF+DL+ELFR GG    TNY+F+GD+VDRGY S+ET  LL++LK +YP++ITL+RGNHESRQITQVYGFYDEC+ KYG+ + WK C +IFD +++AA+ID K+ CVHGGLSP I + DQI++LDR  E+P +GP CDL+WSDP++    W  SPRGAGYLFG    + F   N    ICRAHQL+ EG +  F  ++VTVWSAPNYCYRCGN+AA++    +N    P    F A   ENR  P +     YFL
Sbjct:   16 DLDRQIEIAMRCELICETQVKSICAKVREILIEEANVQVIDTPVTICGDIHGQFHDLMELFRVGGSPPNTNYLFLGDYVDRGYNSVETFILLMLLKCRYPDRITLIRGNHESRQITQVYGFYDECVRKYGSGQVWKHCTEIFDYLSLAAVIDGKLFCVHGGLSPSIATLDQIRVLDRKIEVPHEGPMCDLLWSDPEEGCSGWGISPRGAGYLFGGDAAELFCENNDFLRICRAHQLVMEGYKLHFRKRVVTVWSAPNYCYRCGNVAAIMEVTEENIDSDPVFEVFEAATVENRGEPKKQPIAQYFL 321          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: let-92 (Serine/threonine-protein phosphatase 2A catalytic subunit [Source:UniProtKB/Swiss-Prot;Acc:G5EGK8])

HSP 1 Score: 337.421 bits (864), Expect = 5.601e-115
Identity = 165/304 (54.28%), Postives = 216/304 (71.05%), Query Frame = 2
Query:   86 MNIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            +++D+W+E  Y+CK L EN +  LC+    +L +E N+Q V  PVT+CGD+HGQF+DL+ELF+ GG    TNY+FMGD+VDRGYYS+ET++LL+ LK +Y +++TLLRGNHESRQITQVYGFYDECL KYGN+  WK    +FD   + AL+D +I C+HGGLSP I++ D I+ LDR QE+P +GP CDL+WSDPDD    W  SPRGAGY FG+ +++ F H NGL LI RAHQL+ EG  +  +  +VTV+SAPNYCYRCGN AA++   +   +   LQF   P        R T  YFL
Sbjct:   17 VDVDQWIEQLYECKPLSENQVKTLCEKAKEILEKEPNVQEVRCPVTVCGDVHGQFHDLMELFKMGGKSPDTNYLFMGDYVDRGYYSVETVSLLVCLKIRYKDRVTLLRGNHESRQITQVYGFYDECLRKYGNSNVWKYFTDLFDCFPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRIQEVPHEGPMCDLLWSDPDDR-GGWGISPRGAGYTFGQDISETFNHSNGLTLISRAHQLVMEGYNWSHDRNVVTVFSAPNYCYRCGNQAAMVELDDDL-KYSFLQFDPAPRRGEPHVTRRTPDYFL 318          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: let-92 (Serine/threonine-protein phosphatase 2A catalytic subunit [Source:UniProtKB/Swiss-Prot;Acc:G5EGK8])

HSP 1 Score: 337.421 bits (864), Expect = 5.601e-115
Identity = 165/304 (54.28%), Postives = 216/304 (71.05%), Query Frame = 2
Query:   86 MNIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            +++D+W+E  Y+CK L EN +  LC+    +L +E N+Q V  PVT+CGD+HGQF+DL+ELF+ GG    TNY+FMGD+VDRGYYS+ET++LL+ LK +Y +++TLLRGNHESRQITQVYGFYDECL KYGN+  WK    +FD   + AL+D +I C+HGGLSP I++ D I+ LDR QE+P +GP CDL+WSDPDD    W  SPRGAGY FG+ +++ F H NGL LI RAHQL+ EG  +  +  +VTV+SAPNYCYRCGN AA++   +   +   LQF   P        R T  YFL
Sbjct:   17 VDVDQWIEQLYECKPLSENQVKTLCEKAKEILEKEPNVQEVRCPVTVCGDVHGQFHDLMELFKMGGKSPDTNYLFMGDYVDRGYYSVETVSLLVCLKIRYKDRVTLLRGNHESRQITQVYGFYDECLRKYGNSNVWKYFTDLFDCFPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRIQEVPHEGPMCDLLWSDPDDR-GGWGISPRGAGYTFGQDISETFNHSNGLTLISRAHQLVMEGYNWSHDRNVVTVFSAPNYCYRCGNQAAMVELDDDL-KYSFLQFDPAPRRGEPHVTRRTPDYFL 318          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: PpV (gene:FBgn0003139 transcript:FBtr0331432)

HSP 1 Score: 430.639 bits (1106), Expect = 7.349e-152
Identity = 207/303 (68.32%), Postives = 252/303 (83.17%), Query Frame = 2
Query:   89 NIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            ++D+W+E   KCKYLPEN+L +LC+ V  +L+EE NI PVSTPVT+CGDIHGQFYDL +LFRTGG +  TNYIFMGDFVDRGYYSLET T LL LKA+YP +ITLLRGNHE+RQIT+VYGF+DEC +KYGNA  WK CCK+FDL+TIAA+ID+++LCVHGGLSPEI + DQI+ +DRN EIP KG FCDLVWSDP+D ++ W  SPRGAG+LFG  VTK+F+ +N LNLICRAHQL+ EGI+Y F+ +LVTVWSAPNYCYRCGN+AA+L+F+ +  R   + F AVPD  R IP + TTPYFL
Sbjct:    3 DVDKWIEDVKKCKYLPENELKKLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDLEQLFRTGGQVPHTNYIFMGDFVDRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFFDECFSKYGNANGWKYCCKVFDLLTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRNGEIPYKGAFCDLVWSDPED-MEYWGQSPRGAGWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKYMFDGKLVTVWSAPNYCYRCGNVAAILSFETAEKRQTKI-FLAVPDAERVIPKQNTTPYFL 303          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: PpV (gene:FBgn0003139 transcript:FBtr0331430)

HSP 1 Score: 430.639 bits (1106), Expect = 7.349e-152
Identity = 207/303 (68.32%), Postives = 252/303 (83.17%), Query Frame = 2
Query:   89 NIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            ++D+W+E   KCKYLPEN+L +LC+ V  +L+EE NI PVSTPVT+CGDIHGQFYDL +LFRTGG +  TNYIFMGDFVDRGYYSLET T LL LKA+YP +ITLLRGNHE+RQIT+VYGF+DEC +KYGNA  WK CCK+FDL+TIAA+ID+++LCVHGGLSPEI + DQI+ +DRN EIP KG FCDLVWSDP+D ++ W  SPRGAG+LFG  VTK+F+ +N LNLICRAHQL+ EGI+Y F+ +LVTVWSAPNYCYRCGN+AA+L+F+ +  R   + F AVPD  R IP + TTPYFL
Sbjct:    3 DVDKWIEDVKKCKYLPENELKKLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDLEQLFRTGGQVPHTNYIFMGDFVDRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFFDECFSKYGNANGWKYCCKVFDLLTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRNGEIPYKGAFCDLVWSDPED-MEYWGQSPRGAGWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKYMFDGKLVTVWSAPNYCYRCGNVAAILSFETAEKRQTKI-FLAVPDAERVIPKQNTTPYFL 303          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: PpV (gene:FBgn0003139 transcript:FBtr0331431)

HSP 1 Score: 430.639 bits (1106), Expect = 7.349e-152
Identity = 207/303 (68.32%), Postives = 252/303 (83.17%), Query Frame = 2
Query:   89 NIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            ++D+W+E   KCKYLPEN+L +LC+ V  +L+EE NI PVSTPVT+CGDIHGQFYDL +LFRTGG +  TNYIFMGDFVDRGYYSLET T LL LKA+YP +ITLLRGNHE+RQIT+VYGF+DEC +KYGNA  WK CCK+FDL+TIAA+ID+++LCVHGGLSPEI + DQI+ +DRN EIP KG FCDLVWSDP+D ++ W  SPRGAG+LFG  VTK+F+ +N LNLICRAHQL+ EGI+Y F+ +LVTVWSAPNYCYRCGN+AA+L+F+ +  R   + F AVPD  R IP + TTPYFL
Sbjct:    3 DVDKWIEDVKKCKYLPENELKKLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDLEQLFRTGGQVPHTNYIFMGDFVDRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFFDECFSKYGNANGWKYCCKVFDLLTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRNGEIPYKGAFCDLVWSDPED-MEYWGQSPRGAGWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKYMFDGKLVTVWSAPNYCYRCGNVAAILSFETAEKRQTKI-FLAVPDAERVIPKQNTTPYFL 303          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: PpV (gene:FBgn0003139 transcript:FBtr0070921)

HSP 1 Score: 430.639 bits (1106), Expect = 7.349e-152
Identity = 207/303 (68.32%), Postives = 252/303 (83.17%), Query Frame = 2
Query:   89 NIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            ++D+W+E   KCKYLPEN+L +LC+ V  +L+EE NI PVSTPVT+CGDIHGQFYDL +LFRTGG +  TNYIFMGDFVDRGYYSLET T LL LKA+YP +ITLLRGNHE+RQIT+VYGF+DEC +KYGNA  WK CCK+FDL+TIAA+ID+++LCVHGGLSPEI + DQI+ +DRN EIP KG FCDLVWSDP+D ++ W  SPRGAG+LFG  VTK+F+ +N LNLICRAHQL+ EGI+Y F+ +LVTVWSAPNYCYRCGN+AA+L+F+ +  R   + F AVPD  R IP + TTPYFL
Sbjct:    3 DVDKWIEDVKKCKYLPENELKKLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDLEQLFRTGGQVPHTNYIFMGDFVDRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFFDECFSKYGNANGWKYCCKVFDLLTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRNGEIPYKGAFCDLVWSDPED-MEYWGQSPRGAGWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKYMFDGKLVTVWSAPNYCYRCGNVAAILSFETAEKRQTKI-FLAVPDAERVIPKQNTTPYFL 303          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: Pp4-19C (gene:FBgn0023177 transcript:FBtr0077325)

HSP 1 Score: 361.303 bits (926), Expect = 2.169e-124
Identity = 173/304 (56.91%), Postives = 222/304 (73.03%), Query Frame = 2
Query:   89 NIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRI-TTPYFL 997
            ++D  +E   +C+ + EN++  LC     +L+EE N+Q V +PVT+CGDIHGQFYDL ELF+ GGD+ + NY+FMGDFVDRGYYS+ET  LLL LK +YP++ITL+RGNHESRQITQVYGFYDECL KYG+   W+ C +IFD ++++A+ID KI CVHGGLSP I   DQI+ +DR QE+P  GP CDL+WSDP+D    W  SPRGAGYLFG  V  +F   N +++ICRAHQL+ EG ++ FN  ++TVWSAPNYCYRCGN+AA+L       R D + F A P E+R IP +     YFL
Sbjct:    6 DLDRQIEQLKRCEIIKENEVKALCAKAREILVEEGNVQRVDSPVTVCGDIHGQFYDLKELFKVGGDVPEKNYLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSTAVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQYLDQIRSIDRKQEVPHDGPMCDLLWSDPEDQT-GWGVSPRGAGYLFGSDVVSQFNRTNDIDMICRAHQLVMEGFKWHFNETVLTVWSAPNYCYRCGNVAAILELNEYLHR-DFVIFEAAPQESRGIPSKKPQADYFL 307          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp6c (protein phosphatase 6, catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-040426-949])

HSP 1 Score: 446.432 bits (1147), Expect = 5.748e-158
Identity = 214/307 (69.71%), Postives = 255/307 (83.06%), Query Frame = 2
Query:   77 MVQMNIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            M  +++D+++E A +CKYLPENDL RLCDYV  LL+EE N+QPVSTPVT+CGDIHGQFYDL ELFRTGG +  TNYIFMGDFVDRGYYSLET T LL LKAK+P++ITLLRGNHESRQITQVYGFYDEC  KYGNA  W+ C K+FD++T+AALID++ILCVHGGLSP+I + DQI+ ++RNQEIP KG FCDLVWSDP+DV   W  SPRGAG+LFG +VT EF+H+N L LICRAHQL+ EG ++ F+ +LVTVWSAPNYCYRCGN+A+++ FK+   R   L F AVPD  R IPPR TTPYFL
Sbjct:    1 MAPLDLDKYVEIARQCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDV-DTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKL-FRAVPDSERVIPPRTTTPYFL 305          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp4cb (protein phosphatase 4, catalytic subunit b [Source:NCBI gene;Acc:562705])

HSP 1 Score: 363.614 bits (932), Expect = 2.728e-125
Identity = 172/304 (56.58%), Postives = 223/304 (73.36%), Query Frame = 2
Query:   89 NIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRI-TTPYFL 997
            ++D  ++   +C+ + EN++  LC     +L+EE N+Q V +PVT+CGDIHGQFYDL ELFR GGD+ +TNY+FMGDFVDRG+YS+ET  LLL LK +YP++ITL+RGNHESRQITQVYGFYDECL KYG+   W+ C +IFD ++++A+ID KI CVHGGLSP I + DQI+ +DR QE+P  GP CDL+WSDP+D    W  SPRGAGYLFG  V  +F   N +++ICRAHQL+ EG ++ FN  ++TVWSAPNYCYRCGN+AA+L       +  I+ F A P E R IP +     YFL
Sbjct:    6 DLDRQIDQLRRCELIKENEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDPEDTT-GWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKEFII-FEAAPQETRGIPSKKPVADYFL 307          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp4ca (protein phosphatase 4, catalytic subunit a [Source:NCBI gene;Acc:100003080])

HSP 1 Score: 360.147 bits (923), Expect = 9.420e-124
Identity = 169/304 (55.59%), Postives = 223/304 (73.36%), Query Frame = 2
Query:   89 NIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRI-TTPYFL 997
            ++D  +E   +C+ + EN++  LC     +L+EE N+Q V +PVT+CGDIHGQFYDL ELFR GG++ +TNY+FMGDFVDRG+YS+ET  LLL LK +YP++ITL+RGNHESRQITQVYGF+DEC  KYG+A  W+ C +IFD ++++A++D KI CVHGGLSP I + DQI+ +DR QE+P  GP CDL+WSDP+D    W  SPRGAGYLFG  V  +F   N +++ICRAHQL+ EG ++ FN  ++TVWSAPNYCYRCGN+AA+L       +  I+ F A P E R +P +     YFL
Sbjct:   10 DLDRQIEQLRRCELIKENEVKALCAKAREILVEESNVQSVDSPVTVCGDIHGQFYDLKELFRVGGEVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFFDECHRKYGSATVWRYCTEIFDYLSLSAIVDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDPEDTT-GWGVSPRGAGYLFGSDVVAQFNAANDISMICRAHQLVMEGYKWHFNDTVLTVWSAPNYCYRCGNVAAILELDEHLQKEFII-FEAAPQETRGLPSKKPVADYFL 311          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp2cb (protein phosphatase 2, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-040426-2487])

HSP 1 Score: 344.739 bits (883), Expect = 1.073e-117
Identity = 168/302 (55.63%), Postives = 216/302 (71.52%), Query Frame = 2
Query:   92 IDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            +D+W+E   +CK L EN +  LC+    +L +E N+Q V  PVT+CGD+HGQF+DL+ELFR GG    TNY+FMGD+VDRGYYS+ET+TLL+ LK +YPE+IT+LRGNHESRQITQVYGFYDECL KYGNA  WK    +FD + + AL+D +I C+HGGLSP I++ D I+ LDR QE+P +GP CDL+WSDPDD    W  SPRGAGY FG+ +++ F H NGL L+ RAHQL+ EG  +  +  +VT++SAPNYCYRCGN AA++   + T +   LQF   P        R T  YFL
Sbjct:   10 LDQWVEQLNECKQLTENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDR-GGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMEL-DDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL 309          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp2cb (protein phosphatase 2, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-040426-2487])

HSP 1 Score: 344.739 bits (883), Expect = 1.073e-117
Identity = 168/302 (55.63%), Postives = 216/302 (71.52%), Query Frame = 2
Query:   92 IDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            +D+W+E   +CK L EN +  LC+    +L +E N+Q V  PVT+CGD+HGQF+DL+ELFR GG    TNY+FMGD+VDRGYYS+ET+TLL+ LK +YPE+IT+LRGNHESRQITQVYGFYDECL KYGNA  WK    +FD + + AL+D +I C+HGGLSP I++ D I+ LDR QE+P +GP CDL+WSDPDD    W  SPRGAGY FG+ +++ F H NGL L+ RAHQL+ EG  +  +  +VT++SAPNYCYRCGN AA++   + T +   LQF   P        R T  YFL
Sbjct:   10 LDQWVEQLNECKQLTENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDR-GGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMEL-DDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL 309          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp6c (uncharacterized loc100216173 [Source:Xenbase;Acc:XB-GENE-5997771])

HSP 1 Score: 446.432 bits (1147), Expect = 8.191e-158
Identity = 214/307 (69.71%), Postives = 255/307 (83.06%), Query Frame = 2
Query:   77 MVQMNIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            M  +++D+++E A +CKYLPENDL RLCDYV  LL+EE N+QPVSTPVT+CGDIHGQFYDL ELFRTGG +  TNYIFMGDFVDRGYYSLET T LL LKAK+P++ITLLRGNHESRQITQVYGFYDEC  KYGNA  W+ C K+FD++T+AALID++ILCVHGGLSP+I + DQI+ ++RNQEIP KG FCDLVWSDP+DV   W  SPRGAG+LFG +VT EF+H+N L LICRAHQL+ EG ++ F+ +LVTVWSAPNYCYRCGN+A+++ FK+   R   L F AVPD  R IPPR TTPYFL
Sbjct:    1 MAPLDLDKYVEIARQCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDV-DTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKL-FRAVPDSERVIPPRTTTPYFL 305          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp6c (uncharacterized loc100216173 [Source:Xenbase;Acc:XB-GENE-5997771])

HSP 1 Score: 400.208 bits (1027), Expect = 8.679e-140
Identity = 197/307 (64.17%), Postives = 237/307 (77.20%), Query Frame = 2
Query:   77 MVQMNIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            M  +++D+++E A +CKYLPENDL RLCDYV  LL+EE N+QPVSTPVT+CGDIHGQ                      GDFVDRGYYSLET T LL LKAK+P++ITLLRGNHESRQITQVYGFYDEC  KYGNA  W+ C K+FD++T+AALID++ILCVHGGLSP+I + DQI+ ++RNQEIP KG FCDLVWSDP+DV   W  SPRGAG+LFG +VT EF+H+N L LICRAHQL+ EG ++ F+ +LVTVWSAPNYCYRCGN+A+++ FK+   R   L F AVPD  R IPPR TTPYFL
Sbjct:    1 MAPLDLDKYVEIARQCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQ----------------------GDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDV-DTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKL-FRAVPDSERVIPPRTTTPYFL 283          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: f2 (coagulation factor II, thrombin [Source:Xenbase;Acc:XB-GENE-481539])

HSP 1 Score: 363.999 bits (933), Expect = 3.194e-125
Identity = 172/304 (56.58%), Postives = 223/304 (73.36%), Query Frame = 2
Query:   89 NIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRI-TTPYFL 997
            ++D  +E   +C+ + E+++  LC     +L+EE N+Q V +PVT+CGDIHGQFYDL ELFR GGD+ +TNY+FMGDFVDRG+YS+ET  LLL LK +YP++ITL+RGNHESRQITQVYGFYDECL KYG+   W+ C +IFD ++++A+ID KI CVHGGLSP I + DQI+ +DR QE+P  GP CDL+WSDP+D    W  SPRGAGYLFG  V  +F   N +++ICRAHQL+ EG ++ FN  ++TVWSAPNYCYRCGN+AA+L       +  I+ F A P E R IP +     YFL
Sbjct:    6 DLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDPEDTT-GWGVSPRGAGYLFGSDVVAQFNAANNIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKEFII-FEAAPQETRGIPSKKPVADYFL 307          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: atp13a5 (ATPase type 13A5 [Source:Xenbase;Acc:XB-GENE-12441880])

HSP 1 Score: 342.043 bits (876), Expect = 1.509e-116
Identity = 167/302 (55.30%), Postives = 215/302 (71.19%), Query Frame = 2
Query:   92 IDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            +D+W+E   +CK L EN +  LC+    +L +E N+Q V  PVT+CGD+HGQF+DL+ELFR GG    TNY+FMGD+VDRGYYS+ET+TLL+ LK +Y E+IT+LRGNHESRQITQVYGFYDECL KYGNA  WK    +FD + + AL+D +I C+HGGLSP I++ D I+ LDR QE+P +GP CDL+WSDPDD    W  SPRGAGY FG+ +++ F H NGL L+ RAHQL+ EG  +  +  +VT++SAPNYCYRCGN AA++   + T +   LQF   P        R T  YFL
Sbjct:   10 LDQWIEQLNECKQLSENQVKTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDR-GGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMEL-DDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL 309          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: atp13a5 (ATPase type 13A5 [Source:Xenbase;Acc:XB-GENE-12441880])

HSP 1 Score: 252.292 bits (643), Expect = 1.224e-82
Identity = 121/204 (59.31%), Postives = 154/204 (75.49%), Query Frame = 2
Query:   89 NIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRP 700
             +D+W+E   +CK L EN +  LC+    +L +E N+Q V  PVT+CGD+HGQF+DL+ELFR GG    TNY+FMGD+VDRGYYS+ET+TLL+ LK +Y E+IT+LRGNHESRQITQVYGFYDECL KYGNA  WK    +FD + + AL+D +I C+HGGLSP I++ D I+ LDR QE+P +GP CDL+WSDPDD    W P
Sbjct:    9 ELDQWIEQLNECKQLSENQVKTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDR-GGWEP 211          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp6c (protein phosphatase 6, catalytic subunit [Source:MGI Symbol;Acc:MGI:1915107])

HSP 1 Score: 446.432 bits (1147), Expect = 6.204e-158
Identity = 214/307 (69.71%), Postives = 255/307 (83.06%), Query Frame = 2
Query:   77 MVQMNIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            M  +++D+++E A +CKYLPENDL RLCDYV  LL+EE N+QPVSTPVT+CGDIHGQFYDL ELFRTGG +  TNYIFMGDFVDRGYYSLET T LL LKAK+P++ITLLRGNHESRQITQVYGFYDEC  KYGNA  W+ C K+FD++T+AALID++ILCVHGGLSP+I + DQI+ ++RNQEIP KG FCDLVWSDP+DV   W  SPRGAG+LFG +VT EF+H+N L LICRAHQL+ EG ++ F+ +LVTVWSAPNYCYRCGN+A+++ FK+   R   L F AVPD  R IPPR TTPYFL
Sbjct:    1 MAPLDLDKYVEIARQCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDV-DTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKL-FRAVPDSERVIPPRTTTPYFL 305          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp6c (protein phosphatase 6, catalytic subunit [Source:MGI Symbol;Acc:MGI:1915107])

HSP 1 Score: 400.208 bits (1027), Expect = 6.573e-140
Identity = 197/307 (64.17%), Postives = 237/307 (77.20%), Query Frame = 2
Query:   77 MVQMNIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            M  +++D+++E A +CKYLPENDL RLCDYV  LL+EE N+QPVSTPVT+CGDIHGQ                      GDFVDRGYYSLET T LL LKAK+P++ITLLRGNHESRQITQVYGFYDEC  KYGNA  W+ C K+FD++T+AALID++ILCVHGGLSP+I + DQI+ ++RNQEIP KG FCDLVWSDP+DV   W  SPRGAG+LFG +VT EF+H+N L LICRAHQL+ EG ++ F+ +LVTVWSAPNYCYRCGN+A+++ FK+   R   L F AVPD  R IPPR TTPYFL
Sbjct:    1 MAPLDLDKYVEIARQCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQ----------------------GDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDV-DTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKL-FRAVPDSERVIPPRTTTPYFL 283          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp4c (protein phosphatase 4, catalytic subunit [Source:MGI Symbol;Acc:MGI:1891763])

HSP 1 Score: 364.77 bits (935), Expect = 1.285e-125
Identity = 172/304 (56.58%), Postives = 223/304 (73.36%), Query Frame = 2
Query:   89 NIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRI-TTPYFL 997
            ++D  +E   +C+ + E+++  LC     +L+EE N+Q V +PVT+CGDIHGQFYDL ELFR GGD+ +TNY+FMGDFVDRG+YS+ET  LLL LK +YP++ITL+RGNHESRQITQVYGFYDECL KYG+   W+ C +IFD ++++A+ID KI CVHGGLSP I + DQI+ +DR QE+P  GP CDL+WSDP+D    W  SPRGAGYLFG  V  +F   N +++ICRAHQL+ EG ++ FN  ++TVWSAPNYCYRCGN+AA+L       + D + F A P E R IP +     YFL
Sbjct:    6 DLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDPEDTT-GWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQK-DFIIFEAAPQETRGIPSKKPVADYFL 307          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp4c (protein phosphatase 4, catalytic subunit [Source:MGI Symbol;Acc:MGI:1891763])

HSP 1 Score: 364.77 bits (935), Expect = 1.285e-125
Identity = 172/304 (56.58%), Postives = 223/304 (73.36%), Query Frame = 2
Query:   89 NIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRI-TTPYFL 997
            ++D  +E   +C+ + E+++  LC     +L+EE N+Q V +PVT+CGDIHGQFYDL ELFR GGD+ +TNY+FMGDFVDRG+YS+ET  LLL LK +YP++ITL+RGNHESRQITQVYGFYDECL KYG+   W+ C +IFD ++++A+ID KI CVHGGLSP I + DQI+ +DR QE+P  GP CDL+WSDP+D    W  SPRGAGYLFG  V  +F   N +++ICRAHQL+ EG ++ FN  ++TVWSAPNYCYRCGN+AA+L       + D + F A P E R IP +     YFL
Sbjct:    6 DLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDPEDTT-GWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQK-DFIIFEAAPQETRGIPSKKPVADYFL 307          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp2cb (protein phosphatase 2 (formerly 2A), catalytic subunit, beta isoform [Source:MGI Symbol;Acc:MGI:1321161])

HSP 1 Score: 343.969 bits (881), Expect = 1.976e-117
Identity = 168/302 (55.63%), Postives = 216/302 (71.52%), Query Frame = 2
Query:   92 IDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            +D+W+E   +CK L EN +  LC+    +L +E N+Q V  PVT+CGD+HGQF+DL+ELFR GG    TNY+FMGD+VDRGYYS+ET+TLL+ LK +YPE+IT+LRGNHESRQITQVYGFYDECL KYGNA  WK    +FD + + AL+D +I C+HGGLSP I++ D I+ LDR QE+P +GP CDL+WSDPDD    W  SPRGAGY FG+ +++ F H NGL L+ RAHQL+ EG  +  +  +VT++SAPNYCYRCGN AA++   + T +   LQF   P        R T  YFL
Sbjct:   10 LDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDR-GGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMEL-DDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL 309          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|Q64620|PPP6_RAT (Serine/threonine-protein phosphatase 6 catalytic subunit OS=Rattus norvegicus OX=10116 GN=Ppp6c PE=2 SV=2)

HSP 1 Score: 446.432 bits (1147), Expect = 4.339e-157
Identity = 214/307 (69.71%), Postives = 255/307 (83.06%), Query Frame = 2
Query:   77 MVQMNIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            M  +++D+++E A +CKYLPENDL RLCDYV  LL+EE N+QPVSTPVT+CGDIHGQFYDL ELFRTGG +  TNYIFMGDFVDRGYYSLET T LL LKAK+P++ITLLRGNHESRQITQVYGFYDEC  KYGNA  W+ C K+FD++T+AALID++ILCVHGGLSP+I + DQI+ ++RNQEIP KG FCDLVWSDP+DV   W  SPRGAG+LFG +VT EF+H+N L LICRAHQL+ EG ++ F+ +LVTVWSAPNYCYRCGN+A+++ FK+   R   L F AVPD  R IPPR TTPYFL
Sbjct:    1 MAPLDLDKYVEIARQCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDV-DTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKL-FRAVPDSERVIPPRTTTPYFL 305          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|Q9CQR6|PPP6_MOUSE (Serine/threonine-protein phosphatase 6 catalytic subunit OS=Mus musculus OX=10090 GN=Ppp6c PE=1 SV=1)

HSP 1 Score: 446.432 bits (1147), Expect = 4.339e-157
Identity = 214/307 (69.71%), Postives = 255/307 (83.06%), Query Frame = 2
Query:   77 MVQMNIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            M  +++D+++E A +CKYLPENDL RLCDYV  LL+EE N+QPVSTPVT+CGDIHGQFYDL ELFRTGG +  TNYIFMGDFVDRGYYSLET T LL LKAK+P++ITLLRGNHESRQITQVYGFYDEC  KYGNA  W+ C K+FD++T+AALID++ILCVHGGLSP+I + DQI+ ++RNQEIP KG FCDLVWSDP+DV   W  SPRGAG+LFG +VT EF+H+N L LICRAHQL+ EG ++ F+ +LVTVWSAPNYCYRCGN+A+++ FK+   R   L F AVPD  R IPPR TTPYFL
Sbjct:    1 MAPLDLDKYVEIARQCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDV-DTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKL-FRAVPDSERVIPPRTTTPYFL 305          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|O00743|PPP6_HUMAN (Serine/threonine-protein phosphatase 6 catalytic subunit OS=Homo sapiens OX=9606 GN=PPP6C PE=1 SV=1)

HSP 1 Score: 445.662 bits (1145), Expect = 1.187e-156
Identity = 214/307 (69.71%), Postives = 254/307 (82.74%), Query Frame = 2
Query:   77 MVQMNIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            M  +++D+++E A  CKYLPENDL RLCDYV  LL+EE N+QPVSTPVT+CGDIHGQFYDL ELFRTGG +  TNYIFMGDFVDRGYYSLET T LL LKAK+P++ITLLRGNHESRQITQVYGFYDEC  KYGNA  W+ C K+FD++T+AALID++ILCVHGGLSP+I + DQI+ ++RNQEIP KG FCDLVWSDP+DV   W  SPRGAG+LFG +VT EF+H+N L LICRAHQL+ EG ++ F+ +LVTVWSAPNYCYRCGN+A+++ FK+   R   L F AVPD  R IPPR TTPYFL
Sbjct:    1 MAPLDLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDV-DTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKL-FRAVPDSERVIPPRTTTPYFL 305          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|Q27884|PPP6_DROME (Serine/threonine-protein phosphatase 6 catalytic subunit OS=Drosophila melanogaster OX=7227 GN=PpV PE=2 SV=1)

HSP 1 Score: 430.639 bits (1106), Expect = 7.367e-151
Identity = 207/303 (68.32%), Postives = 252/303 (83.17%), Query Frame = 2
Query:   89 NIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            ++D+W+E   KCKYLPEN+L +LC+ V  +L+EE NI PVSTPVT+CGDIHGQFYDL +LFRTGG +  TNYIFMGDFVDRGYYSLET T LL LKA+YP +ITLLRGNHE+RQIT+VYGF+DEC +KYGNA  WK CCK+FDL+TIAA+ID+++LCVHGGLSPEI + DQI+ +DRN EIP KG FCDLVWSDP+D ++ W  SPRGAG+LFG  VTK+F+ +N LNLICRAHQL+ EGI+Y F+ +LVTVWSAPNYCYRCGN+AA+L+F+ +  R   + F AVPD  R IP + TTPYFL
Sbjct:    3 DVDKWIEDVKKCKYLPENELKKLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDLEQLFRTGGQVPHTNYIFMGDFVDRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFFDECFSKYGNANGWKYCCKVFDLLTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRNGEIPYKGAFCDLVWSDPED-MEYWGQSPRGAGWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKYMFDGKLVTVWSAPNYCYRCGNVAAILSFETAEKRQTKI-FLAVPDAERVIPKQNTTPYFL 303          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|Q9U9A3|PPP6_DICDI (Serine/threonine-protein phosphatase 6 catalytic subunit OS=Dictyostelium discoideum OX=44689 GN=ppp6c PE=2 SV=2)

HSP 1 Score: 430.639 bits (1106), Expect = 7.408e-151
Identity = 207/302 (68.54%), Postives = 248/302 (82.12%), Query Frame = 2
Query:   92 IDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            +DEW+E A +CKYLPENDL +LC+ V  LL+EE N+QPV +PVTICGDIHGQFYDLLELF+TGG++  TNY+FMGDFVDRGYYSLET T LL LKA+YP+KITLLRGNHESRQITQVYGFYDEC  KYGN   WK C  +FD +T+AA+ID K+LCVHGGLSP++ + DQI+++ RN EIP +GPFCDL+WSDP+D I+ W+PSPRGAG+LFG +VT EF H+NGLNLICRAHQL+QEG RY F+  LVTVWSAPNYCYRCGN+A++L+   + DR D   F AV +E R IP R T  YF 
Sbjct:    7 LDEWVETARQCKYLPENDLKKLCERVKELLLEESNVQPVRSPVTICGDIHGQFYDLLELFKTGGEVPDTNYVFMGDFVDRGYYSLETFTYLLALKARYPDKITLLRGNHESRQITQVYGFYDECQQKYGNVNAWKYCTSVFDFLTLAAIIDGKVLCVHGGLSPKVRTLDQIRIISRNLEIPHEGPFCDLMWSDPED-IEQWQPSPRGAGWLFGSKVTAEFEHINGLNLICRAHQLVQEGYRYMFDNSLVTVWSAPNYCYRCGNVASILSLNENLDR-DFKIFQAVQEE-RNIPTRPTMQYFF 305          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: T2MIT7 (Serine/threonine-protein phosphatase (Fragment) OS=Hydra vulgaris OX=6087 GN=PPP6C PE=2 SV=1)

HSP 1 Score: 458.373 bits (1178), Expect = 3.028e-159
Identity = 223/302 (73.84%), Postives = 252/302 (83.44%), Query Frame = 2
Query:   92 IDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            ID+WLE A  CKYLPE DL RLCDYVS LLIEE N+QPVSTPVT+CGDIHGQFYDL ELFRT G +  TNYIFMGDFVDRGYYSLET T LL LKAKYP+ ITLLRGNHESRQITQVYGFYDEC++KYGNA  W+ CC++FDL+TIAALIDD++LCVHGGLSPEI + DQI+ +DRN EIP KG FCDLVWSDP+DV Q+W  SPRGAG+LFG +VT EF+ +N L LICRAHQL+QEG +Y F  +LVTVWSAPNYCYRCGN+AA LAF ++  R   L F AVPDE R +PPR T PYFL
Sbjct:    6 IDQWLEIAKDCKYLPETDLKRLCDYVSELLIEESNVQPVSTPVTVCGDIHGQFYDLEELFRTSGKVPDTNYIFMGDFVDRGYYSLETWTRLLTLKAKYPKHITLLRGNHESRQITQVYGFYDECMSKYGNANAWRNCCRVFDLLTIAALIDDEVLCVHGGLSPEIRTLDQIRTIDRNMEIPHKGAFCDLVWSDPEDV-QSWSISPRGAGWLFGSKVTHEFMALNNLELICRAHQLVQEGYKYMFGEKLVTVWSAPNYCYRCGNIAATLAFTDARTREAKL-FRAVPDEERVVPPRQTIPYFL 305          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A4D5RXF2 (Serine/threonine-protein phosphatase (Fragment) OS=Ixodes scapularis OX=6945 PE=3 SV=1)

HSP 1 Score: 453.751 bits (1166), Expect = 1.706e-157
Identity = 216/304 (71.05%), Postives = 256/304 (84.21%), Query Frame = 2
Query:   86 MNIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            +++D+W+E A +CKYLPENDL +LC  V  LL+EECNIQPVSTPVT+CGDIHGQFYDL ELFRTGG + +TNYIF+GDFVDRGYYSLET T LL LKAK+P++ITLLRGNHESRQITQVYGFYDEC  KYGNA  WK CCK+FDL+T+AA+ID+++LCVHGGLSP+I + DQ++ ++RNQEIP KG FCDLVWSDP+DV + W  SPRGAG+LFG +VT EF+H+N L LICRAHQL+ EG +Y F+ +LVTVWSAPNYCYRCGN+AAVLAF +   R   L F AVPD  R IPPR TTPYFL
Sbjct:    2 LDVDKWIEIAKECKYLPENDLKKLCSMVCRLLLEECNIQPVSTPVTVCGDIHGQFYDLEELFRTGGQVPETNYIFLGDFVDRGYYSLETFTRLLTLKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWKYCCKVFDLLTVAAIIDEQVLCVHGGLSPQIKTLDQVRTIERNQEIPHKGAFCDLVWSDPEDV-ETWSVSPRGAGWLFGAKVTHEFMHLNNLKLICRAHQLVHEGYKYMFDDKLVTVWSAPNYCYRCGNIAAVLAFTDVNTRTAKL-FHAVPDTERVIPPRNTTPYFL 303          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A1I8GU07 (Serine/threonine-protein phosphatase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005896g1 PE=3 SV=1)

HSP 1 Score: 453.366 bits (1165), Expect = 2.586e-157
Identity = 220/303 (72.61%), Postives = 257/303 (84.82%), Query Frame = 2
Query:   89 NIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            ++D+W+E A  CKYLPE DL +LC+YVS LLIEECN+QPVSTPVT+CGDIHGQFYDLLELFRTGG++  TNY+F+GDFVDRG+YSLET T L+ LKAKYP++ITLLRGNHESRQIT VYGFYDEC+NKYGNA PWK CC++FDL+TIAALID+ ILCVHGGLSPEI + DQI+ +DR QEIP KGPFCDLVWSDPDDV   +  SPRGAGYLFG +VT EF+  N L LICRAHQL+QEG ++ FN  LVTVWSAPNYCYRCGN+AAVLA  ++  R   L F+AVPD+ RT+P + TTPYFL
Sbjct:    3 DLDKWIEIARDCKYLPEGDLYKLCNYVSDLLIEECNVQPVSTPVTVCGDIHGQFYDLLELFRTGGELPDTNYVFLGDFVDRGHYSLETWTYLMALKAKYPDRITLLRGNHESRQITTVYGFYDECINKYGNANPWKACCRVFDLLTIAALIDESILCVHGGLSPEIRTLDQIRTIDRQQEIPHKGPFCDLVWSDPDDV-DGFAMSPRGAGYLFGPRVTAEFMSANQLKLICRAHQLVQEGYKFVFNDALVTVWSAPNYCYRCGNVAAVLALDSAGGREPKL-FNAVPDDQRTVPDKTTTPYFL 303          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A1W4W2P9 (Serine/threonine-protein phosphatase OS=Agrilus planipennis OX=224129 GN=LOC108732248 PE=3 SV=1)

HSP 1 Score: 451.44 bits (1160), Expect = 1.597e-156
Identity = 214/302 (70.86%), Postives = 253/302 (83.77%), Query Frame = 2
Query:   92 IDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            +DEW+E A  CKYLPENDL +LCD V+ LL+EE N+QPVSTPVT+CGDIHGQFYDL ELFR GG +  TNYIF+GDFVDRGYYSLET T LL LKAKYP KITLLRGNHESRQITQVYGFYDECL+KYGN   WK CC +FDL+T+AALID+KILCVHGGLSPEI + DQI+ L+RNQEIP KG FCDLVWSDP++ I+NW  SPRGAGYLFG +VT +F+H+N L LICRAHQL+ EG +Y F+ +L+T+WSAPNYCYRCGN+A++L F+ + D+ +   F+AVPD +R IP R  TPYFL
Sbjct:    9 LDEWIEIARDCKYLPENDLKKLCDIVAELLLEESNVQPVSTPVTVCGDIHGQFYDLEELFRQGGQVPDTNYIFLGDFVDRGYYSLETFTRLLTLKAKYPNKITLLRGNHESRQITQVYGFYDECLSKYGNVNAWKYCCNVFDLLTVAALIDEKILCVHGGLSPEIKTVDQIRCLERNQEIPHKGAFCDLVWSDPEE-IENWATSPRGAGYLFGAKVTHDFMHINSLTLICRAHQLVHEGYKYMFDDKLITIWSAPNYCYRCGNIASILEFQ-AADKAEAKLFNAVPDSDRVIPNRTVTPYFL 308          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A131YIP6 (Serine/threonine-protein phosphatase OS=Rhipicephalus appendiculatus OX=34631 PE=3 SV=1)

HSP 1 Score: 451.055 bits (1159), Expect = 1.915e-156
Identity = 214/304 (70.39%), Postives = 255/304 (83.88%), Query Frame = 2
Query:   86 MNIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            +++D W++ A +CKYLPENDL +LC  V  LL+EECNIQPVSTPVT+CGDIHGQFYDL ELFRTGG + +TNYIF+GDFVDRGYYSLET T LL LKAK+P++ITLLRGNHESRQITQVYGFYDEC  KYGNA  WK CCK+FDL+T+AA+ID+++LCVHGGLSP+I + DQ++ ++RNQEIP KG FCDLVWSDP+DV + W  SPRGAG+LFG +VT EF+H+N L LICRAHQL+ EG +Y F+ +LVTVWSAPNYCYRCGN+AAVLAF +   R   L + AVPD  R IPPR TTPYFL
Sbjct:    2 LDVDRWIDIAKECKYLPENDLKKLCSIVCRLLLEECNIQPVSTPVTVCGDIHGQFYDLEELFRTGGQVPETNYIFLGDFVDRGYYSLETFTRLLTLKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWKYCCKVFDLLTVAAIIDEQVLCVHGGLSPQIKTLDQVRTIERNQEIPHKGAFCDLVWSDPEDV-ETWSVSPRGAGWLFGAKVTHEFMHLNNLKLICRAHQLVHEGYKYMFDDKLVTVWSAPNYCYRCGNIAAVLAFSDVNSRTAKL-YHAVPDSERVIPPRNTTPYFL 303          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp6c (protein phosphatase 6 catalytic subunit [Source:NCBI gene;Acc:103047394])

HSP 1 Score: 446.047 bits (1146), Expect = 8.795e-158
Identity = 214/307 (69.71%), Postives = 255/307 (83.06%), Query Frame = 2
Query:   77 MVQMNIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            M  +++D+++E A +CKYLPENDL RLCDYV  LL+EE N+QPVSTPVT+CGDIHGQFYDL ELFRTGG +  TNYIFMGDFVDRGYYSLET T LL LKAK+P++ITLLRGNHESRQITQVYGFYDEC  KYGNA  W+ C K+FD++T+AALID++ILCVHGGLSP+I + DQI+ ++RNQEIP KG FCDLVWSDP+DV   W  SPRGAG+LFG +VT EF+H+N L LICRAHQL+ EG ++ F+ +LVTVWSAPNYCYRCGN+A+++ FK+   R   L F AVPD  R IPPR TTPYFL
Sbjct:    1 MAPLDLDKYVEIARQCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDV-DTWAISPRGAGWLFGAKVTNEFVHINNLRLICRAHQLVHEGYKFMFDDRLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKL-FRAVPDSERVIPPRTTTPYFL 305          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp6c (protein phosphatase 6 catalytic subunit [Source:NCBI gene;Acc:103047394])

HSP 1 Score: 399.438 bits (1025), Expect = 9.519e-140
Identity = 197/307 (64.17%), Postives = 237/307 (77.20%), Query Frame = 2
Query:   77 MVQMNIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            M  +++D+++E A +CKYLPENDL RLCDYV  LL+EE N+QPVSTPVT+CGDIHGQ                      GDFVDRGYYSLET T LL LKAK+P++ITLLRGNHESRQITQVYGFYDEC  KYGNA  W+ C K+FD++T+AALID++ILCVHGGLSP+I + DQI+ ++RNQEIP KG FCDLVWSDP+DV   W  SPRGAG+LFG +VT EF+H+N L LICRAHQL+ EG ++ F+ +LVTVWSAPNYCYRCGN+A+++ FK+   R   L F AVPD  R IPPR TTPYFL
Sbjct:    1 MAPLDLDKYVEIARQCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQ----------------------GDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDV-DTWAISPRGAGWLFGAKVTNEFVHINNLRLICRAHQLVHEGYKFMFDDRLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKL-FRAVPDSERVIPPRTTTPYFL 283          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp4cb (protein phosphatase 4 catalytic subunit [Source:NCBI gene;Acc:103024225])

HSP 1 Score: 363.614 bits (932), Expect = 2.814e-125
Identity = 172/304 (56.58%), Postives = 223/304 (73.36%), Query Frame = 2
Query:   89 NIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRI-TTPYFL 997
            ++D  ++   +C+ + EN++  LC     +L+EE N+Q V +PVT+CGDIHGQFYDL ELFR GGD+ +TNY+FMGDFVDRG+YS+ET  LLL LK +YP++ITL+RGNHESRQITQVYGFYDECL KYG+   W+ C +IFD ++++A+ID KI CVHGGLSP I + DQI+ +DR QE+P  GP CDL+WSDP+D    W  SPRGAGYLFG  V  +F   N +++ICRAHQL+ EG ++ FN  ++TVWSAPNYCYRCGN+AA+L       +  I+ F A P E R IP +     YFL
Sbjct:    6 DLDRQIDQLRRCELIKENEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDPEDTT-GWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKEFII-FEAAPQETRGIPSKKPVADYFL 307          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp4cb (protein phosphatase 4 catalytic subunit [Source:NCBI gene;Acc:103024225])

HSP 1 Score: 363.614 bits (932), Expect = 2.814e-125
Identity = 172/304 (56.58%), Postives = 223/304 (73.36%), Query Frame = 2
Query:   89 NIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRI-TTPYFL 997
            ++D  ++   +C+ + EN++  LC     +L+EE N+Q V +PVT+CGDIHGQFYDL ELFR GGD+ +TNY+FMGDFVDRG+YS+ET  LLL LK +YP++ITL+RGNHESRQITQVYGFYDECL KYG+   W+ C +IFD ++++A+ID KI CVHGGLSP I + DQI+ +DR QE+P  GP CDL+WSDP+D    W  SPRGAGYLFG  V  +F   N +++ICRAHQL+ EG ++ FN  ++TVWSAPNYCYRCGN+AA+L       +  I+ F A P E R IP +     YFL
Sbjct:    6 DLDRQIDQLRRCELIKENEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDPEDTT-GWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKEFII-FEAAPQETRGIPSKKPVADYFL 307          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp2cb (protein phosphatase 2, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-040426-2487])

HSP 1 Score: 343.584 bits (880), Expect = 2.348e-117
Identity = 167/302 (55.30%), Postives = 216/302 (71.52%), Query Frame = 2
Query:   92 IDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            +D+W+E   +CK L EN +  LC+    +L +E N+Q V  PVT+CGD+HGQF+DL+ELFR GG    TNY+FMGD+VDRGYYS+ET+TLL+ LK ++PE+IT+LRGNHESRQITQVYGFYDECL KYGNA  WK    +FD + + AL+D +I C+HGGLSP I++ D I+ LDR QE+P +GP CDL+WSDPDD    W  SPRGAGY FG+ +++ F H NGL L+ RAHQL+ EG  +  +  +VT++SAPNYCYRCGN AA++   + T +   LQF   P        R T  YFL
Sbjct:   10 LDQWVEQLNECKQLTENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKGRFPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDR-GGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMEL-DDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL 309          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp1cab (protein phosphatase 1, catalytic subunit, alpha isozyme b [Source:ZFIN;Acc:ZDB-GENE-030131-5512])

HSP 1 Score: 233.032 bits (593), Expect = 7.862e-75
Identity = 119/256 (46.48%), Postives = 169/256 (66.02%), Query Frame = 2
Query:  131 LPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLA 898
            L E ++  LC     + + +  +  +  P+ ICGDIHGQ+YDLL LF  GG   ++NY+F+GD+VDRG  SLET+ LLL  K KYPE   LLRGNHE+  I ++YGFYDEC  +Y N + WK     F+ + IAA++D+KI C HGGLSP++ S +QI+ + R  ++P +G  CDL+WSDPD     W  + RG  + FG +V  +FLH + L+LICRAHQ++++G  +    QLVT++SAPNYC    N  A+++
Sbjct:   12 LTEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHEA-SINRIYGFYDECKRRY-NIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMS 265          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010086.1 (pep scaffold:Pmarinus_7.0:GL479411:90249:92178:-1 gene:ENSPMAG00000009123.1 transcript:ENSPMAT00000010086.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 212.616 bits (540), Expect = 2.139e-67
Identity = 113/266 (42.48%), Postives = 161/266 (60.53%), Query Frame = 2
Query:  230 GDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGP---FCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNS----------TDRPDILQFSAVPDENRTIPPRITTP 988
            GDIHGQ+ DLL LF  GG   + NY+F+GD+VDRG  SLET+ LLL  K KYPE   LLRGNHE   I ++YGFYDEC  ++ N + WK     F+ + IAA++D+KI C HGGLSP++ S +QI+ + R  ++P  G     CDL+WSDPD  +Q W  + RG  + FG  V  +FL+ + L+LICRAHQ++++G  +    QLVT++SAPNYC    N   +++   +          +++    Q+  +       PP+   P
Sbjct:    1 GDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRF-NIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGDAGLLCDLLWSDPDKDVQGWGENDRGVSFTFGGDVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGMNSGRPVTPPKAAVP 265          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005238.1 (pep scaffold:Pmarinus_7.0:GL487052:8065:11513:-1 gene:ENSPMAG00000004764.1 transcript:ENSPMAT00000005238.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 201.83 bits (512), Expect = 1.489e-64
Identity = 96/154 (62.34%), Postives = 122/154 (79.22%), Query Frame = 2
Query:  176 LLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQ 637
            +L +E N+Q V  PVT+CGD+HGQF+DL+ELF  GG    TNY+FMGD+VDRGYYS+ET++LL+ LK +Y E+IT+LRGNHESRQITQVYGFYDECL KYGNA  WK    +FD + + AL+D +I C+HGGLSP I++ D I+ LDR QE+P 
Sbjct:   18 ILTKESNVQEVRCPVTVCGDVHGQFHDLIELFNIGGKSPDTNYLFMGDYVDRGYYSVETVSLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDFLPLTALVDRQIFCLHGGLSPSIDTLDHIRALDRLQEVPH 171          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp3cb (protein phosphatase 3, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-050417-406])

HSP 1 Score: 199.904 bits (507), Expect = 6.829e-60
Identity = 115/276 (41.67%), Postives = 160/276 (57.97%), Query Frame = 2
Query:  161 DYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRP-------SPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQ------LVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVP 949
            D  S+L  E+  I  +  PVT+CGDIHGQF+DL++LF  GG    T Y+F+GD+VDRGY+S+E +  L  LK  YP  + LLRGNHE R +T+ + F  EC  KY     +  C   FD + +AAL++ + LCVHGGLSPE+++ + I+ LDR +E P  GP CDL+WSDP +   N +        + RG  Y +      +FL  N L  + RAH+    G R     Q      L+T++SAPNY     N AAVL ++N+    +I QF+  P
Sbjct:   50 DGASILRREKTMID-IEAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPTTLFLLRGNHECRHLTEYFTFKQECKIKYTETV-YDACMDAFDCLPLAALMNQQFLCVHGGLSPEVHNLEDIRKLDRFKEPPAFGPMCDLLWSDPSEDFGNEKTQEYFCHNTVRGCSYFYSYPAVCDFLQNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNV--MNIRQFNCSP 321          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-030616-609])

HSP 1 Score: 184.111 bits (466), Expect = 6.313e-57
Identity = 95/211 (45.02%), Postives = 134/211 (63.51%), Query Frame = 2
Query:  119 KCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEF 751
            K  ++ E ++  LC     + + +  +  +  P+ ICGDIHGQ+ DLL LF  GG   ++NY+F+GD+VDRG  SLET+ LLL  K KYPE   LLRGNHE   I ++YGFYDEC  ++ N + WK     F+ + IAA++D+KI C HGGLSP++ S +QI+ + R  ++P  G  CDL+WSDPD  +Q W  + RG  + FG  V  +F
Sbjct:   12 KTVHMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRF-NIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKF 221          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: SIT4 (Ceramide-activated, type 2A-related serine-threonine phosphatase; functions in G1/S transition of mitotic cycle; controls lifespan, mitochondrial function, cell cycle progression by regulating HXK2 phosphorylation; regulator of COPII coat dephosphorylation; required for ER to Golgi traffic; interacts with Hrr25p kinase; cytoplasmic and nuclear protein that modulates functions mediated by Pkc1p including cell wall and actin cytoskeleton organization; similar to human PP6 [Source:SGD;Acc:S000002205])

HSP 1 Score: 383.645 bits (984), Expect = 5.185e-134
Identity = 192/295 (65.08%), Postives = 230/295 (77.97%), Query Frame = 2
Query:   77 MVQMNIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQ-TNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQF-NFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDE 955
            MV    DEWLE   KC+ L EN++ +LC+ V  LL+EE NIQPV TPVT+CGDIHGQF+DLLELFRT G      NYIF+GD+VDRGYYSLET TLL+ LK KYP KITL+RGNHESRQITQVYGFY+ECLNKYG+   WK CC++FD +T+AA+ID KILCVHGGLSPEI   DQI++L R QE+P +G F DL+WSDPD+V + W+ SPRGAG+LFG +V +EF HVNGLNLI RAHQL+ EG +Y F    +VTVWSAPNYCYRCGN+A+V+      + P    FSAVPD+
Sbjct:    1 MVSRGPDEWLETIKKCQALTENEMKQLCEMVKELLMEESNIQPVQTPVTVCGDIHGQFHDLLELFRTAGGFPDDINYIFLGDYVDRGYYSLETFTLLMCLKVKYPAKITLVRGNHESRQITQVYGFYEECLNKYGSTTVWKYCCQVFDFLTLAAIIDGKILCVHGGLSPEIRMLDQIRVLSRAQEVPHEGGFSDLLWSDPDNV-EAWQVSPRGAGWLFGSKVAREFNHVNGLNLIARAHQLVMEGFKYHFPEKDVVTVWSAPNYCYRCGNVASVMKVDEDLE-PTFKIFSAVPDD 293          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPH21 (Catalytic subunit of protein phosphatase 2A (PP2A); functionally redundant with Pph22p; methylated at C terminus; forms alternate complexes with several regulatory subunits; involved in signal transduction and regulation of mitosis; forms nuclear foci upon DNA replication stress; PPH21 has a paralog, PPH22, that arose from the whole genome duplication [Source:SGD;Acc:S000002292])

HSP 1 Score: 337.806 bits (865), Expect = 4.083e-115
Identity = 163/302 (53.97%), Postives = 216/302 (71.52%), Query Frame = 2
Query:   92 IDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            +D+W+E+  KC+ L E+D+ RLC     +L  E N++P++ PVTICGD+HGQF+DLLELF+ GG    TNY+FMGD+VDRGYYS+ET++ L+ +K +YP +IT+LRGNHESRQITQVYGFYDECL KYG+A  WK    +FD   I AL+D+KI C+HGGLSP I + DQ++ L+R QE+P +GP CDL+WSDPDD    W  SPRGAG+ FG+ V+++F H N L+LI RAHQL+ EG  +     +VT++SAPNYCYRCGN AA++    + +R   LQ+            R T  YFL
Sbjct:   70 LDQWIEHLSKCEPLSEDDVARLCKMAVDVLQFEENVKPINVPVTICGDVHGQFHDLLELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPITALVDNKIFCLHGGLSPMIETIDQVRELNRIQEVPHEGPMCDLLWSDPDDR-GGWGISPRGAGFTFGQDVSEQFNHTNDLSLIARAHQLVMEGYAWSHQQNVVTIFSAPNYCYRCGNQAAIMEVDENHNR-QFLQYDPSVRPGEPSVSRKTPDYFL 369          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPH22 (Catalytic subunit of protein phosphatase 2A (PP2A); functionally redundant with Pph21p; methylated at C terminus; forms alternate complexes with several regulatory subunits; involved in signal transduction and regulation of mitosis; protein abundance increases in response to DNA replication stress; dephosphorylates Tel1p/Mec1p-phosphorylated Cdc13p to promote telomerase release from telomeres at G2/M; PPH22 has a paralog, PPH21, that arose from the whole genome duplication [Source:SGD;Acc:S000002347])

HSP 1 Score: 336.65 bits (862), Expect = 1.239e-114
Identity = 161/302 (53.31%), Postives = 216/302 (71.52%), Query Frame = 2
Query:   92 IDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            +D+W+E+  KC+ L E+D+ RLC     +L  E N++P++ PVTICGD+HGQF+DLLELF+ GG    TNY+FMGD+VDRGYYS+ET++ L+ +K +YP +IT+LRGNHESRQITQVYGFYDECL KYG+A  WK    +FD   + AL+D+KI C+HGGLSP I + DQ++ L+R QE+P +GP CDL+WSDPDD    W  SPRGAG+ FG+ ++++F H N L+LI RAHQL+ EG  +     +VT++SAPNYCYRCGN AA++    + +R   LQ+            R T  YFL
Sbjct:   78 LDQWIEHLSKCEPLSEDDVARLCKMAVDVLQFEENVKPINVPVTICGDVHGQFHDLLELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPVTALVDNKIFCLHGGLSPMIETIDQVRDLNRIQEVPHEGPMCDLLWSDPDDR-GGWGISPRGAGFTFGQDISEQFNHTNDLSLIARAHQLVMEGYSWSHQQNVVTIFSAPNYCYRCGNQAAIMEVDENHNR-QFLQYDPSVRPGEPTVTRKTPDYFL 377          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPH3 (Catalytic subunit of protein phosphatase PP4 complex; Pph3p and Psy2p form active complex, Psy4p may provide substrate specificity; regulates recovery from the DNA damage checkpoint, the gene conversion- and single-strand annealing-mediated pathways of meiotic double-strand break repair and efficient Non-Homologous End-Joining (NHEJ) pathway; involved in activation of Gln3p to alleviate nitrogen catabolite repression; Pph3p and Psy2p localize to foci on meiotic chromosomes [Source:SGD;Acc:S000002482])

HSP 1 Score: 327.791 bits (839), Expect = 4.419e-112
Identity = 161/309 (52.10%), Postives = 218/309 (70.55%), Query Frame = 2
Query:   86 MNIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRT----IPPRIT-TPYFL 997
            M++D+ +      K++PE  + RLC     LL+ E N+  V TPVTICGDIHGQ +DLL LF   G + +T YIF+GDFVDRG+YSLE+  LLL  K +YP++ITL+RGNHE+RQIT+VYGFYDE + KYGN+  W+ CC++FD +++ A+I++ I CVHGGLSP++ + D+I+ +DR QE+P +G  CDL+WSDP+DV   W  SPRGAG+LFG++   +FL  N + LI RAHQL+ EG +  F+  LVTVWSAPNYCYRCGN+AAVL   +  +R   + F AV  +N      IP + +   YFL
Sbjct:    2 MDLDKIIASLRDGKHIPEETVFRLCLNSQELLMNEGNVTQVDTPVTICGDIHGQLHDLLTLFEKSGGVEKTRYIFLGDFVDRGFYSLESFLLLLCYKLRYPDRITLIRGNHETRQITKVYGFYDEVVRKYGNSNVWRYCCEVFDYLSLGAIINNSIFCVHGGLSPDMTTVDEIRTIDRKQEVPHEGAMCDLLWSDPEDV-DTWSLSPRGAGFLFGKREVDQFLEKNNVELIARAHQLVMEGYKEMFDGGLVTVWSAPNYCYRCGNVAAVLKIDDDLNREYTI-FEAVQAQNEVGNAIIPTKKSQMDYFL 308          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPG1 (Putative serine/threonine protein phosphatase; putative phosphatase of the type 2A-like phosphatase family, required for glycogen accumulation; interacts with Tap42p, which binds to and regulates other protein phosphatases [Source:SGD;Acc:S000005315])

HSP 1 Score: 302.753 bits (774), Expect = 2.146e-101
Identity = 151/282 (53.55%), Postives = 200/282 (70.92%), Query Frame = 2
Query:   86 MNIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKY-GNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSD-----------PDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVL 895
            M +DE LE  YK + LPE  +  LC  +  +L++E N+  + TPVT+ GD+HGQF+D+LE+F+ GG +  TNY+F+GD+VDRG YS+ET+ LL+VLK +YP +I LLRGNHESRQITQ YGFY ECLNKY GN+  W+    IFD + +  +IDD+I CVHGGLSP + + DQI+++DR +EIP  G   DLVWSD           PD+  Q+++ SPRGAGY FG  V ++FL +N +N I RAHQL  EG +  F+  + TVWSAPNYCYRCGN A++L
Sbjct:    1 MELDECLERLYKAQLLPEVTVRALCFKLKEMLVKESNVIHIQTPVTVVGDMHGQFHDMLEIFQIGGPVPDTNYLFLGDYVDRGLYSVETIMLLIVLKLRYPSRIHLLRGNHESRQITQSYGFYTECLNKYGGNSRVWQYLTDIFDYLVLCCIIDDEIFCVHGGLSPNVQTIDQIKIIDRFREIPHDGAMADLVWSDPEENNNPTLDHPDNSGQHFQVSPRGAGYTFGRSVVEKFLRMNDMNRIYRAHQLCNEGYQIYFDGLVTTVWSAPNYCYRCGNKASIL 282          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO49936 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RFC7])

HSP 1 Score: 358.221 bits (918), Expect = 1.309e-123
Identity = 170/306 (55.56%), Postives = 223/306 (72.88%), Query Frame = 2
Query:   89 NIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTP---YFL 997
            ++D  +E    C+ + E ++ +LC     +L+EE N+Q V +PVT+CGDIHGQFYDL ELF+ GGD+  TNY+FMGDFVDRG+YS+ET  LLL LK +YP++ITL+RGNHESRQITQVYGFYDECL KYG+   W+ C +IFD ++++A+ID+++ CVHGGLSP I++ DQI+ +DR QE+P  GP CDL+WSDP+D IQ W  SPRGAGYLFG  V  ++   N ++LICRAHQL+ EG ++ FN  ++TVWSAPNYCYRCGN+AA+L       R +   F A P + R  P     P   YFL
Sbjct:    6 DLDRQIEKLRNCELITEKEVKQLCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFKVGGDVPDTNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLKKYGSITVWRYCAEIFDYLSLSAIIDNRVFCVHGGLSPSISTLDQIRSIDRKQEVPHDGPMCDLLWSDPED-IQGWGVSPRGAGYLFGSDVVAQYNAANDIDLICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLKR-EFTIFEAAPQDVRGTPSIAKKPSADYFL 309          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO30146 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7T1L8])

HSP 1 Score: 351.673 bits (901), Expect = 7.980e-122
Identity = 177/303 (58.42%), Postives = 216/303 (71.29%), Query Frame = 2
Query:   89 NIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            ++D W++ A +C+YLPENDL +LCDYV  LL+EE N+QPVS+PVT+CGDIHGQFYDL ELFRTGG +  T+Y+FMGDFVDRGYYSLET T LL LKAK+P++ITLLRGNHESRQITQVYGFYDEC +KYGNA  W+ CCK+FDL+T+AA+ID ++LCVHGGLSP+I + DQ                                                 F+H+N L LICRAHQL+ EG +Y F+ +LVTVWSAPNYCYRCGN+A++LAF ++ +R   L F AVPD  R IPPR TTPYFL
Sbjct:    3 DLDRWIDIAKECEYLPENDLKKLCDYVCELLLEESNVQPVSSPVTVCGDIHGQFYDLEELFRTGGQVPNTSYVFMGDFVDRGYYSLETFTRLLTLKAKWPDRITLLRGNHESRQITQVYGFYDECQSKYGNANAWRYCCKVFDLLTVAAIIDGQVLCVHGGLSPDIKTIDQ-------------------------------------------------FVHINNLKLICRAHQLVHEGYKYMFDEKLVTVWSAPNYCYRCGNIASILAFSDADNREPKL-FQAVPDYERVIPPRTTTPYFL 255          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO29759 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7T2Q5])

HSP 1 Score: 335.88 bits (860), Expect = 9.290e-115
Identity = 163/303 (53.80%), Postives = 214/303 (70.63%), Query Frame = 2
Query:   89 NIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            +++ W+E   +CK L E  +  LC+    +L +E N+Q V  PVT+CGD+HGQF+DL+ELFR GG    TNY+FMGD+VDRGYYS+ET+TLL+ LK ++P +I +LRGNHESRQITQVYGFYDECL KYGNA  WK    +FD + + AL+D++I C+HGGLSP I++ D I+ LDR QE+P +GP CDL+WSDPDD    W  SPRGAGY FG+ +++ F H NGL LI RAHQL+ EG  +  +  +VT++SAPNYCYRCGN AA++   ++  +   LQF   P        R T  YFL
Sbjct:   10 DLEVWIEQLMECKQLTEAQVKTLCEKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVTLKVRFPHRICILRGNHESRQITQVYGFYDECLRKYGNASVWKYFTDLFDYLPLTALVDNQIFCLHGGLSPSIDTLDHIRALDRIQEVPHEGPMCDLLWSDPDDR-GGWGISPRGAGYTFGQDISETFNHTNGLTLITRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDAL-KYSFLQFDPAPRRGEPHVTRRTPDYFL 310          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO38434 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7SD13])

HSP 1 Score: 261.922 bits (668), Expect = 1.331e-87
Identity = 123/175 (70.29%), Postives = 152/175 (86.86%), Query Frame = 2
Query:   89 NIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLL 613
            ++D W++ A +C+YLPENDL +LCDYV  LL+EE N+QPVS+PVT+CGDIHGQFYDL ELFRTGG +  T+Y+FMGDFVDRGYYSLET T LL LKAK+P++ITLLRGNHESRQITQVYGFYDEC +KYGNA  W+ CCK+FDL+T+AA+ID ++LCVHGGLSP+I + DQ+  +
Sbjct:    3 DLDRWIDIAKECEYLPENDLKKLCDYVCELLLEESNVQPVSSPVTVCGDIHGQFYDLEELFRTGGQVPNTSYVFMGDFVDRGYYSLETFTRLLTLKAKWPDRITLLRGNHESRQITQVYGFYDECQSKYGNANAWRYCCKVFDLLTVAAIIDGQVLCVHGGLSPDIKTIDQVSAI 177          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO44648 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RVJ0])

HSP 1 Score: 236.113 bits (601), Expect = 1.721e-75
Identity = 118/256 (46.09%), Postives = 169/256 (66.02%), Query Frame = 2
Query:  131 LPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLA 898
            L E ++  LC     + + +  +  +  P+ ICGDIHGQ+YDLL LF  GG   ++NY+F+GD+VDRG  SLET+ LLL  K KYPE   LLRGNHE   I ++YGFYDEC  +Y N + WK     F+ + +AA++D+KI C HGGLSP++ S +QI+ + R  ++P +G  CDL+WSDPD  +Q W  + RG  + FG  +  +FLH + L+LICRAHQ++++G  +    QLVT++SAPNYC    N  A+++
Sbjct:   30 LTEAEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRY-NIKLWKTFTDCFNCLPVAAILDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGPDIVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMS 284          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: PPP6C (serine/threonine-protein phosphatase 6 catalytic subunit [Source:NCBI gene;Acc:101168723])

HSP 1 Score: 446.432 bits (1147), Expect = 5.284e-158
Identity = 213/307 (69.38%), Postives = 255/307 (83.06%), Query Frame = 2
Query:   77 MVQMNIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            M  +++D+++E A  CKYLPENDL RLCDYV  LL+EE N+QPV+TPVT+CGDIHGQFYDL ELFRTGG +  TNYIFMGDFVDRGYYSLET T LL LKAK+P++ITLLRGNHESRQITQVYGFYDEC  KYGNA  W+ C K+FD++T+AALID++ILCVHGGLSP+I + DQI+ ++RNQEIP KG FCDLVWSDP+DV   W  SPRGAG+LFG +VT EF+H+N L LICRAHQL+ EG ++ F+ +LVTVWSAPNYCYRCGN+A+++ FK+ + R   L F AVPD  R IPPR TTPYFL
Sbjct:    1 MAPLDLDKYVEIAKHCKYLPENDLKRLCDYVCDLLLEESNVQPVATPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCAKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDV-DTWAISPRGAGWLFGSKVTNEFVHINSLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVSRREPKL-FRAVPDSERVIPPRTTTPYFL 305          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: PPP6C (serine/threonine-protein phosphatase 6 catalytic subunit [Source:NCBI gene;Acc:101168723])

HSP 1 Score: 400.208 bits (1027), Expect = 5.019e-140
Identity = 196/307 (63.84%), Postives = 237/307 (77.20%), Query Frame = 2
Query:   77 MVQMNIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            M  +++D+++E A  CKYLPENDL RLCDYV  LL+EE N+QPV+TPVT+CGDIHGQ                      GDFVDRGYYSLET T LL LKAK+P++ITLLRGNHESRQITQVYGFYDEC  KYGNA  W+ C K+FD++T+AALID++ILCVHGGLSP+I + DQI+ ++RNQEIP KG FCDLVWSDP+DV   W  SPRGAG+LFG +VT EF+H+N L LICRAHQL+ EG ++ F+ +LVTVWSAPNYCYRCGN+A+++ FK+ + R   L F AVPD  R IPPR TTPYFL
Sbjct:    1 MAPLDLDKYVEIAKHCKYLPENDLKRLCDYVCDLLLEESNVQPVATPVTVCGDIHGQ----------------------GDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCAKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDV-DTWAISPRGAGWLFGSKVTNEFVHINSLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVSRREPKL-FRAVPDSERVIPPRTTTPYFL 283          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ppp6c (serine/threonine-protein phosphatase 6 catalytic subunit [Source:NCBI gene;Acc:101171716])

HSP 1 Score: 398.282 bits (1022), Expect = 2.148e-139
Identity = 196/307 (63.84%), Postives = 237/307 (77.20%), Query Frame = 2
Query:   77 MVQMNIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            M  +++D++ E A  CKYLPENDL RLCDYV  LL+EE N+QPVSTPVT+CGDIHGQ                      GDFVDRGYYSLET T LLVLKAK+P++ITLLRGNHESRQITQVYGFYDEC  KYGNA  W+ C K+FD++T+AAL+D+++LCVHGGLSP+I + DQI+ ++RNQEIP KG FCDLVWSDP+DV   W  SPRGAG+LFG +VT EF+H+N L LICRAHQL+ EG ++ F+ +LVTVWSAPNYCYRCGN+A+++ FK++  R   L F AVPD  R IPPR TTPYFL
Sbjct:    1 MAPLDLDKYAEIAKVCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQ----------------------GDFVDRGYYSLETFTYLLVLKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALMDEQVLCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDV-DTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDAATREPKL-FRAVPDSERVIPPRTTTPYFL 283          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ppp4cb (protein phosphatase 4 catalytic subunit [Source:NCBI gene;Acc:101159020])

HSP 1 Score: 365.925 bits (938), Expect = 3.740e-126
Identity = 174/304 (57.24%), Postives = 223/304 (73.36%), Query Frame = 2
Query:   89 NIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRI-TTPYFL 997
            ++D  +E   +C+ + EN++  LC     +L+EE N+Q V +PVT+CGDIHGQFYDL ELFR GGD+ +TNY+FMGDFVDRG+YS+ET  LLL LK +YP++ITL+RGNHESRQITQVYGFYDECL KYG+   W+ C +IFD ++++A+ID KI CVHGGLSP I + DQI+ +DR QE+P  GP CDL+WSDP+D    W  SPRGAGYLFG  V  +F   N +++ICRAHQL+ EG ++ FN  ++TVWSAPNYCYRCGN+AA+L       R  I+ F A P E R IP +     YFL
Sbjct:   10 DLDRQIEQLRRCELIKENEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDPEDTT-GWGVSPRGAGYLFGSDVVAQFNAANDIHMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQREFII-FEAAPQETRGIPSKKPVADYFL 311          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ENSORLT00000041911.1 (protein phosphatase 2 catalytic subunit beta [Source:NCBI gene;Acc:101157601])

HSP 1 Score: 343.969 bits (881), Expect = 1.836e-117
Identity = 166/302 (54.97%), Postives = 216/302 (71.52%), Query Frame = 2
Query:   92 IDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            +D+W+E   +CK L EN +  LC+    +L +E N+Q V  PVT+CGD+HGQF+DL+ELF+ GG    TNY+FMGD+VDRGYYS+ET+TLL+ LK ++PE+IT+LRGNHESRQITQVYGFYDECL KYGNA  WK    +FD + + AL+D +I C+HGGLSP I++ D I+ LDR QE+P +GP CDL+WSDPDD    W  SPRGAGY FG+ +++ F H NGL L+ RAHQL+ EG  +  +  +VT++SAPNYCYRCGN AA++   + T +   LQF   P        R T  YFL
Sbjct:   10 LDQWIEQLNECKQLTENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFKIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVTLKVRFPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDR-GGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWGHDKNVVTIFSAPNYCYRCGNQAAIMEL-DDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL 309          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000023415.1 (SMESG000023415.1)

HSP 1 Score: 618.231 bits (1593), Expect = 0.000e+0
Identity = 307/307 (100.00%), Postives = 307/307 (100.00%), Query Frame = 2
Query:   77 MVQMNIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            MVQMNIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSLETLTLLLVLKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL
Sbjct:    1 MVQMNIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSLETLTLLLVLKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 307          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000080901.1 (SMESG000080901.1)

HSP 1 Score: 372.474 bits (955), Expect = 6.732e-129
Identity = 173/304 (56.91%), Postives = 227/304 (74.67%), Query Frame = 2
Query:   89 NIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTP-YFL 997
            ++D  +E   +CK + E ++  LC     +L+EE N+Q V +PVT+CGDIHGQFYDLLELF+ GGDI  TNY+F+GDFVDRG+YS+ET  LLL  K +YP++ITL+RGNHESRQITQVYGFYDEC+ KYG+A  W+ C +IFD ++++A+ID +I CVHGGLSP I++ DQI+ LDR QE+P  GP CDL+WSDP+D  Q W  SPRGAG+LFG  V ++F H N L +ICRAHQL+ EG ++ FN  ++TVWSAPNYCYRCGN+AA++       +P+ + F A P + R IP +   P YFL
Sbjct:    7 DLDRQIEQLKQCKLISEMEVKILCSKAKEILMEESNVQIVESPVTVCGDIHGQFYDLLELFKNGGDIPNTNYLFLGDFVDRGFYSVETFLLLLAYKVRYPDRITLIRGNHESRQITQVYGFYDECMRKYGSAVVWRYCTEIFDHLSLSAVIDGQIFCVHGGLSPSISTLDQIRALDRKQEVPHDGPMCDLLWSDPEDT-QGWGVSPRGAGFLFGSDVVEKFNHDNNLEMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAIMQLHEGQRKPEFIIFEAAPQDVRNIPAKQAVPDYFL 309          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000009093.1 (SMESG000009093.1)

HSP 1 Score: 332.798 bits (852), Expect = 2.720e-113
Identity = 161/303 (53.14%), Postives = 213/303 (70.30%), Query Frame = 2
Query:   89 NIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            ++D+W+E  Y  K L E+ +  LC+    +L +E N+QPV  PVT+CGD+HGQF+DL+ELF+ GG    TNY+FMGD+VDRGYYS+ET+TLL+ LK ++ ++IT+LRGNHESRQITQVYGFYDECL KY NA  WK    +FD + + AL+++ I C+HGGLSP I++ D I+ LDR QE+P +GP CDL+WSDPDD    W  SPRGAGY FG  +++ F H N L L+ RAHQL+ EG  +  +  +VT++SAPNYCYRCGN AA++   +S  +   LQF   P        R T  YFL
Sbjct:    8 DLDQWIEQLYDNKQLTESQVKVLCETAKEILAKESNVQPVKCPVTVCGDVHGQFHDLMELFKIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRFKDRITILRGNHESRQITQVYGFYDECLRKYTNANVWKYFTDLFDYLPLTALVENSIFCLHGGLSPSIDTLDHIKALDRIQEVPHEGPMCDLLWSDPDDR-NGWGISPRGAGYTFGLDISETFNHSNNLTLVSRAHQLVMEGYNWSHDKNVVTIFSAPNYCYRCGNQAAIMELDDSL-KYTFLQFDPAPRRGEPHVTRRTPDYFL 308          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000010596.1 (SMESG000010596.1)

HSP 1 Score: 329.331 bits (843), Expect = 6.623e-112
Identity = 158/302 (52.32%), Postives = 211/302 (69.87%), Query Frame = 2
Query:   92 IDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPRITTPYFL 997
            +D+W++  Y+CK L E  +  LC+    +L +E N+Q V  PVT+CGD+HGQF+DL+ELF+ GG    TNY+FMGD+VDRGYYS+ET+TLL+ LK +Y ++IT+LRGNHESRQITQVYGFYDECL KY NA  W+    +FD + + AL++  I C+HGGLSP I++ D I+ LDR QE+P +GP CDL+WSDPDD    W  SPRGAGY FG+ + + F H N L L+ RAHQL+ EG  +  +  +VT++SAPNYCYRCGN A+++   ++  +   LQF   P        R T  YFL
Sbjct:    9 LDDWIQQLYECKQLSEAQVKLLCEKAKEILEKEGNVQLVKCPVTVCGDVHGQFHDLMELFKIGGKAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYKDRITILRGNHESRQITQVYGFYDECLRKYTNANVWRYFTDLFDYLPLTALVEGSIFCLHGGLSPSIDTLDHIKALDRIQEVPHEGPMCDLLWSDPDDR-SGWGISPRGAGYTFGQDIAETFTHSNNLTLVSRAHQLVMEGYNWSHDRNVVTIFSAPNYCYRCGNQASIMELDDNL-KYTFLQFDPAPRRGEPQISRRTPDYFL 308          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000075857.1 (SMESG000075857.1)

HSP 1 Score: 237.654 bits (605), Expect = 8.565e-76
Identity = 126/283 (44.52%), Postives = 177/283 (62.54%), Query Frame = 2
Query:  131 LPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSXXXXXXXXXXKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMTIAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPDDVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFNFQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAV-PDENRTIPPR 976
            L E ++  LC     + + +  +  +  P+ ICGDIHGQ+YDLL LF  GG   ++NY+F+GD+VDRG  SLET+ LLL  K KYPE   LLRGNHE   I ++YGFYDEC  +Y N + WK     F+ + IAA+ID+KI C HGGLSP++ S +QI+ + R  ++P +G  CDL+WSDPD     W  + RG  + FG +V  +FLH + L+LICRAHQ++++G  +    QLVT++SAPNYC    N  A++    S D   +  F  + P + +  P R
Sbjct:   30 LSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRY-NIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMM----SVDETLMCSFQILKPADKKKFPYR 307          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP6C2.472e-15769.71protein phosphatase 6 catalytic subunit [Source:HG... [more]
PPP6C7.635e-14962.21protein phosphatase 6 catalytic subunit [Source:HG... [more]
PPP6C3.754e-13964.17protein phosphatase 6 catalytic subunit [Source:HG... [more]
PPP4C1.871e-12556.58protein phosphatase 4 catalytic subunit [Source:HG... [more]
PPP4C1.871e-12556.58protein phosphatase 4 catalytic subunit [Source:HG... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pph-66.814e-12960.13Putative serine/threonine-protein phosphatase pph-... [more]
pph-4.19.162e-12756.00Serine/threonine-protein phosphatase 4 catalytic s... [more]
pph-4.22.463e-11654.58Serine/threonine-protein phosphatase 4 catalytic s... [more]
let-925.601e-11554.28Serine/threonine-protein phosphatase 2A catalytic ... [more]
let-925.601e-11554.28Serine/threonine-protein phosphatase 2A catalytic ... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PpV7.349e-15268.32gene:FBgn0003139 transcript:FBtr0331432[more]
PpV7.349e-15268.32gene:FBgn0003139 transcript:FBtr0331430[more]
PpV7.349e-15268.32gene:FBgn0003139 transcript:FBtr0331431[more]
PpV7.349e-15268.32gene:FBgn0003139 transcript:FBtr0070921[more]
Pp4-19C2.169e-12456.91gene:FBgn0023177 transcript:FBtr0077325[more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp6c5.748e-15869.71protein phosphatase 6, catalytic subunit [Source:Z... [more]
ppp4cb2.728e-12556.58protein phosphatase 4, catalytic subunit b [Source... [more]
ppp4ca9.420e-12455.59protein phosphatase 4, catalytic subunit a [Source... [more]
ppp2cb1.073e-11755.63protein phosphatase 2, catalytic subunit, beta iso... [more]
ppp2cb1.073e-11755.63protein phosphatase 2, catalytic subunit, beta iso... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp6c8.191e-15869.71uncharacterized loc100216173 [Source:Xenbase;Acc:X... [more]
ppp6c8.679e-14064.17uncharacterized loc100216173 [Source:Xenbase;Acc:X... [more]
f23.194e-12556.58coagulation factor II, thrombin [Source:Xenbase;Ac... [more]
atp13a51.509e-11655.30ATPase type 13A5 [Source:Xenbase;Acc:XB-GENE-12441... [more]
atp13a51.224e-8259.31ATPase type 13A5 [Source:Xenbase;Acc:XB-GENE-12441... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppp6c6.204e-15869.71protein phosphatase 6, catalytic subunit [Source:M... [more]
Ppp6c6.573e-14064.17protein phosphatase 6, catalytic subunit [Source:M... [more]
Ppp4c1.285e-12556.58protein phosphatase 4, catalytic subunit [Source:M... [more]
Ppp4c1.285e-12556.58protein phosphatase 4, catalytic subunit [Source:M... [more]
Ppp2cb1.976e-11755.63protein phosphatase 2 (formerly 2A), catalytic sub... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q64620|PPP6_RAT4.339e-15769.71Serine/threonine-protein phosphatase 6 catalytic s... [more]
sp|Q9CQR6|PPP6_MOUSE4.339e-15769.71Serine/threonine-protein phosphatase 6 catalytic s... [more]
sp|O00743|PPP6_HUMAN1.187e-15669.71Serine/threonine-protein phosphatase 6 catalytic s... [more]
sp|Q27884|PPP6_DROME7.367e-15168.32Serine/threonine-protein phosphatase 6 catalytic s... [more]
sp|Q9U9A3|PPP6_DICDI7.408e-15168.54Serine/threonine-protein phosphatase 6 catalytic s... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T2MIT73.028e-15973.84Serine/threonine-protein phosphatase (Fragment) OS... [more]
A0A4D5RXF21.706e-15771.05Serine/threonine-protein phosphatase (Fragment) OS... [more]
A0A1I8GU072.586e-15772.61Serine/threonine-protein phosphatase OS=Macrostomu... [more]
A0A1W4W2P91.597e-15670.86Serine/threonine-protein phosphatase OS=Agrilus pl... [more]
A0A131YIP61.915e-15670.39Serine/threonine-protein phosphatase OS=Rhipicepha... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp6c8.795e-15869.71protein phosphatase 6 catalytic subunit [Source:NC... [more]
ppp6c9.519e-14064.17protein phosphatase 6 catalytic subunit [Source:NC... [more]
ppp4cb2.814e-12556.58protein phosphatase 4 catalytic subunit [Source:NC... [more]
ppp4cb2.814e-12556.58protein phosphatase 4 catalytic subunit [Source:NC... [more]
ppp2cb2.348e-11755.30protein phosphatase 2, catalytic subunit, beta iso... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1cab7.862e-7546.48protein phosphatase 1, catalytic subunit, alpha is... [more]
ENSPMAT00000010086.12.139e-6742.48pep scaffold:Pmarinus_7.0:GL479411:90249:92178:-1 ... [more]
ENSPMAT00000005238.11.489e-6462.34pep scaffold:Pmarinus_7.0:GL487052:8065:11513:-1 g... [more]
ppp3cb6.829e-6041.67protein phosphatase 3, catalytic subunit, beta iso... [more]
ppp1cb6.313e-5745.02protein phosphatase 1, catalytic subunit, beta iso... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SIT45.185e-13465.08Ceramide-activated, type 2A-related serine-threoni... [more]
PPH214.083e-11553.97Catalytic subunit of protein phosphatase 2A (PP2A)... [more]
PPH221.239e-11453.31Catalytic subunit of protein phosphatase 2A (PP2A)... [more]
PPH34.419e-11252.10Catalytic subunit of protein phosphatase PP4 compl... [more]
PPG12.146e-10153.55Putative serine/threonine protein phosphatase; put... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO499361.309e-12355.56Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO301467.980e-12258.42Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO297599.290e-11553.80Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO384341.331e-8770.29Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO446481.721e-7546.09Serine/threonine-protein phosphatase [Source:UniP... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP6C5.284e-15869.38serine/threonine-protein phosphatase 6 catalytic s... [more]
PPP6C5.019e-14063.84serine/threonine-protein phosphatase 6 catalytic s... [more]
ppp6c2.148e-13963.84serine/threonine-protein phosphatase 6 catalytic s... [more]
ppp4cb3.740e-12657.24protein phosphatase 4 catalytic subunit [Source:NC... [more]
ENSORLT00000041911.11.836e-11754.97protein phosphatase 2 catalytic subunit beta [Sour... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023415.10.000e+0100.00SMESG000023415.1[more]
SMESG000080901.16.732e-12956.91SMESG000080901.1[more]
SMESG000009093.12.720e-11353.14SMESG000009093.1[more]
SMESG000010596.16.623e-11252.32SMESG000010596.1[more]
SMESG000075857.18.565e-7644.52SMESG000075857.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008233 ID=SMED30008233|Name=Serine/threonine-protein phosphatase|organism=Schmidtea mediterranea sexual|type=transcript|length=1116bp
CGATTATATTTGATACTTTTAGTTGCGCAAATACGATTTCAGGATATTTG
GAAAACTTTGTAAATATTAATAAAATATGGTTCAAATGAATATAGATGAA
TGGCTAGAATATGCTTATAAATGTAAATATCTTCCAGAAAATGATTTGAA
TAGACTTTGCGATTATGTCAGCTTACTATTAATTGAAGAATGCAACATTC
AGCCAGTGAGTACTCCGGTCACTATTTGTGGTGACATTCATGGACAATTT
TATGATTTGTTGGAACTCTTCAGAACTGGTGGTGATATAGTTCAAACAAA
TTACATATTTATGGGAGATTTCGTTGATCGTGGATATTACAGTCTTGAAA
CGTTGACACTATTATTAGTATTGAAAGCAAAATATCCAGAAAAGATAACT
TTGTTAAGAGGAAATCATGAAAGTAGACAAATTACACAAGTTTACGGATT
TTATGATGAATGCCTAAATAAATATGGGAATGCTGAACCGTGGAAACGTT
GTTGCAAAATTTTTGATTTAATGACCATAGCAGCTTTGATCGATGATAAA
ATTCTTTGTGTTCATGGTGGTTTGTCGCCAGAAATAAATTCATGCGATCA
AATCCAATTGTTGGATCGCAACCAAGAAATACCACAAAAAGGGCCATTTT
GCGATTTAGTGTGGTCAGATCCCGACGATGTCATTCAAAATTGGCGACCA
AGTCCCCGAGGTGCAGGCTATCTGTTTGGAGAACAGGTAACTAAAGAATT
TCTTCACGTGAACGGATTGAATTTGATCTGTCGTGCACATCAACTGATTC
AAGAAGGCATCCGGTATCAGTTCAACTTTCAGTTGGTCACTGTGTGGTCA
GCACCGAATTACTGTTACCGATGCGGCAACATGGCTGCTGTATTAGCTTT
TAAGAACAGTACAGACCGACCAGATATTTTACAATTCAGTGCAGTACCTG
ATGAAAATAGAACCATTCCGCCTCGTATCACTACGCCATATTTCTTATGA
GTCACAAAAAAATGAAACTATTAATAAATTTGTGTACAATATATATTTAC
ATTTGTTAGATTTTTCTCAAATTTTAATGGAATTTAAATAAAAAGTTGAT
AATTTTTTAAAAAAAA
back to top

protein sequence of SMED30008233-orf-1

>SMED30008233-orf-1 ID=SMED30008233-orf-1|Name=SMED30008233-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=308bp
MVQMNIDEWLEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTI
CGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSLETLTLLLVLK
AKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNAEPWKRCCKIFDLMT
IAALIDDKILCVHGGLSPEINSCDQIQLLDRNQEIPQKGPFCDLVWSDPD
DVIQNWRPSPRGAGYLFGEQVTKEFLHVNGLNLICRAHQLIQEGIRYQFN
FQLVTVWSAPNYCYRCGNMAAVLAFKNSTDRPDILQFSAVPDENRTIPPR
ITTPYFL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000142posterior region of the whole animal
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR006186Ser/Thr-sp_prot-phosphatase
IPR004843Calcineurin-like_PHP_ApaH
IPR029052Metallo-depent_PP-like
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0004721phosphoprotein phosphatase activity
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatasePRINTSPR00114STPHPHTASEcoord: 109..133
score: 68.12
coord: 144..170
score: 51.34
coord: 252..268
score: 63.9
coord: 173..200
score: 48.06
coord: 230..250
score: 40.57
coord: 47..74
score: 59.13
coord: 76..103
score: 61.16
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphataseSMARTSM00156pp2a_7coord: 19..291
e-value: 9.9E-132
score: 453.6
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatasePROSITEPS00125SER_THR_PHOSPHATASEcoord: 110..115
IPR004843Calcineurin-like phosphoesterase domain, ApaH typePFAMPF00149Metallophoscoord: 47..239
e-value: 4.8E-38
score: 131.7
IPR029052Metallo-dependent phosphatase-likeGENE3DG3DSA:3.60.21.10coord: 1..301
e-value: 1.3E-122
score: 411.3
NoneNo IPR availablePANTHERPTHR45619FAMILY NOT NAMEDcoord: 4..307
NoneNo IPR availablePANTHERPTHR45619:SF10SERINE/THREONINE-PROTEIN PHOSPHATASE 6 CATALYTIC SUBUNITcoord: 4..307
NoneNo IPR availableCDDcd07415MPP_PP2A_PP4_PP6coord: 5..291
e-value: 1.37616E-180
score: 497.494
NoneNo IPR availableSUPERFAMILYSSF56300Metallo-dependent phosphatasescoord: 3..295