FTS and Hook-interacting protein

Overview
NameFTS and Hook-interacting protein
Smed IDSMED30008221
Length (bp)3627
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FTS and Hook-interacting protein (SMED30008221) t-SNE clustered cells

Violin plots show distribution of expression levels for FTS and Hook-interacting protein (SMED30008221) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FTS and Hook-interacting protein (SMED30008221) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FTS and Hook-interacting protein (SMED30008221) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008221

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30008221SMESG000025657.1 dd_Smed_v4_9831_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30008221SMESG000025657.1 dd_Smed_v4_9831_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30008221SMESG000025657.1 dd_Smed_v4_9831_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30008221SMESG000025657.1 dd_Smed_v4_9831_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30008221SMESG000025657.1 dd_Smed_v4_9831_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30008221SMESG000025657.1 dd_Smed_v4_9831_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30008221SMESG000025657.1 dd_Smed_v4_9831_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FTS and Hook-interacting protein vs. Ensembl Human
Match: FAM160A1 (family with sequence similarity 160 member A1 [Source:HGNC Symbol;Acc:HGNC:34237])

HSP 1 Score: 222.631 bits (566), Expect = 7.685e-59
Identity = 133/450 (29.56%), Postives = 242/450 (53.78%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFINNIDDLNSLETIFK------------HIDVMVSIIIKECDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDH-LIKQKWVQLSPVSSVEDISCYA 1372
            + + C+ VF +HW QV+  +   D L + +  +             +++ M+ ++I+E  + +  ++  ILE+    NI + +F      +LR +  +   I QL+MY+ L+       L    ++  ++ LL  CS  ++  +E   V LL QL  ++  D  + E     S ++    F    L+I  IHR+  +G+ +++ALL I + +  E++ +  +I   + F  +L TGLSGLYSS P KL+   ++W  + +     +P L   +  L+FCN  +++ H  I+  +++++Y GFL PV+ P+LH+V                ++EE ++ TAYL+L+LR +  P ++++FL+FIL  + EN  +LD+L +R+N+         + L V++L+LFRT++  H EDV+  LV RYLIPC+H ++ Q+W       +V++  CY+
Sbjct:   21 DPETCMIVFKNHWAQVVKILEKHDPLKNTQAKYGSIPPDEASAVQNYVEHMLFLLIEE--QAKDAAMGPILEFVVSENIMEKLF----LWSLRREFTDETKIEQLKMYEMLVTQSHQPLLHHKPILKPLMMLLSSCSGTTTPTVEEKLVVLLNQLCSILAKDPSILELFFHTSEDQGAANFLIFSLLIPFIHREGSVGQQARDALLFIMSLSA-ENTMVAHHIVENTYFCPVLATGLSGLYSSLPTKLEEKGEEWHCLLKDDWLLLPSLVQFMNSLEFCNAVIQVAHPLIRNQLVNYIYNGFLVPVLAPALHKV----------------TVEEVMTTTAYLDLFLRSISEPALLEIFLRFILLHQHENVHILDTLTSRINTP--------FRLCVVSLALFRTLIGLHCEDVMLQLVLRYLIPCNHMMLSQRW-------AVKERDCYS 432          

HSP 2 Score: 74.7146 bits (182), Expect = 9.248e-13
Identity = 70/254 (27.56%), Postives = 113/254 (44.49%), Query Frame = 2
Query: 2417 NEVIFKRRLQSFDQSIQFSPNISNFSATLGPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHPDGNGEMNQNFEDEFEIRLSTTSSGAVNNSFFDFDXXXXXXXXXXXXKNKEKRTRKTAFGLLKRKKKDNIPQYRFPIQKFCYSKKKPISDYEAQ---RIRNLAYNWILFDEFCKELASLCQEHTQHC 3169
            +E  F  R     QS  F+          GPF+S +  +L  +  N+  +NLL+ GIIT LA+YPQPL++S LL+ +++ QP++  LY +LA VKN + + +S   D+  +L+ A +YL                      F + +S  +  A+                    K+  +   +T  G   +   D  P+    +Q F   + K +++        +RN      LF EF KELA+L QEH+  C
Sbjct:  832 DEAAFASRHPVRTQSTPFT----------GPFISVVLSKLENMLENSLHVNLLLIGIITQLASYPQPLLRSFLLNTNMVFQPSVRSLYQVLASVKNKIEQFASVERDFPGLLIQAQQYLL---------------------FRVDMSDMTPAALT-------------------KDPIQEASRTGSG---KNLLDGPPRV---LQPFLTHRTK-VAEAPPNLPLPVRNPMLAAALFPEFLKELAALAQEHSILC 1028          
BLAST of FTS and Hook-interacting protein vs. Ensembl Human
Match: FAM160A1 (family with sequence similarity 160 member A1 [Source:HGNC Symbol;Acc:HGNC:34237])

HSP 1 Score: 222.631 bits (566), Expect = 7.685e-59
Identity = 133/450 (29.56%), Postives = 242/450 (53.78%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFINNIDDLNSLETIFK------------HIDVMVSIIIKECDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDH-LIKQKWVQLSPVSSVEDISCYA 1372
            + + C+ VF +HW QV+  +   D L + +  +             +++ M+ ++I+E  + +  ++  ILE+    NI + +F      +LR +  +   I QL+MY+ L+       L    ++  ++ LL  CS  ++  +E   V LL QL  ++  D  + E     S ++    F    L+I  IHR+  +G+ +++ALL I + +  E++ +  +I   + F  +L TGLSGLYSS P KL+   ++W  + +     +P L   +  L+FCN  +++ H  I+  +++++Y GFL PV+ P+LH+V                ++EE ++ TAYL+L+LR +  P ++++FL+FIL  + EN  +LD+L +R+N+         + L V++L+LFRT++  H EDV+  LV RYLIPC+H ++ Q+W       +V++  CY+
Sbjct:   21 DPETCMIVFKNHWAQVVKILEKHDPLKNTQAKYGSIPPDEASAVQNYVEHMLFLLIEE--QAKDAAMGPILEFVVSENIMEKLF----LWSLRREFTDETKIEQLKMYEMLVTQSHQPLLHHKPILKPLMMLLSSCSGTTTPTVEEKLVVLLNQLCSILAKDPSILELFFHTSEDQGAANFLIFSLLIPFIHREGSVGQQARDALLFIMSLSA-ENTMVAHHIVENTYFCPVLATGLSGLYSSLPTKLEEKGEEWHCLLKDDWLLLPSLVQFMNSLEFCNAVIQVAHPLIRNQLVNYIYNGFLVPVLAPALHKV----------------TVEEVMTTTAYLDLFLRSISEPALLEIFLRFILLHQHENVHILDTLTSRINTP--------FRLCVVSLALFRTLIGLHCEDVMLQLVLRYLIPCNHMMLSQRW-------AVKERDCYS 432          

HSP 2 Score: 74.7146 bits (182), Expect = 9.248e-13
Identity = 70/254 (27.56%), Postives = 113/254 (44.49%), Query Frame = 2
Query: 2417 NEVIFKRRLQSFDQSIQFSPNISNFSATLGPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHPDGNGEMNQNFEDEFEIRLSTTSSGAVNNSFFDFDXXXXXXXXXXXXKNKEKRTRKTAFGLLKRKKKDNIPQYRFPIQKFCYSKKKPISDYEAQ---RIRNLAYNWILFDEFCKELASLCQEHTQHC 3169
            +E  F  R     QS  F+          GPF+S +  +L  +  N+  +NLL+ GIIT LA+YPQPL++S LL+ +++ QP++  LY +LA VKN + + +S   D+  +L+ A +YL                      F + +S  +  A+                    K+  +   +T  G   +   D  P+    +Q F   + K +++        +RN      LF EF KELA+L QEH+  C
Sbjct:  832 DEAAFASRHPVRTQSTPFT----------GPFISVVLSKLENMLENSLHVNLLLIGIITQLASYPQPLLRSFLLNTNMVFQPSVRSLYQVLASVKNKIEQFASVERDFPGLLIQAQQYLL---------------------FRVDMSDMTPAALT-------------------KDPIQEASRTGSG---KNLLDGPPRV---LQPFLTHRTK-VAEAPPNLPLPVRNPMLAAALFPEFLKELAALAQEHSILC 1028          
BLAST of FTS and Hook-interacting protein vs. Ensembl Human
Match: FAM160A2 (family with sequence similarity 160 member A2 [Source:HGNC Symbol;Acc:HGNC:25378])

HSP 1 Score: 184.496 bits (467), Expect = 7.922e-47
Identity = 133/455 (29.23%), Postives = 228/455 (50.11%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFI---------NNIDDLNSLETIFKHIDVMVSIIIKE-CDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECS--LRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEP-FYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDR 1387
            + + CL VF +HW QV+  +            DDL++   +  H   M++++ ++            +LE+    ++   +    +Q +  G   E     QL++++ L++      L    +   +L LL+ C   + SS  ++   V LL QL V +  +  L EF  +        P       ++  +HR+  +G+ +++ALLL+   +    + +  YI   S F  +L TGLS LYSS PRK++   DDW  + R     VP L   +  L+FCN  +++ H  ++  ++D+++ GFL PV+GP+LH                + S+EE I++TAYLEL+LR +  P +++ FL+F+L  R + + +LD+L+ R+ S +         L +++LSLFRT+L+   EDVL  LV RYL+PC+H      V LS   +V D+  Y    D+
Sbjct:   32 DPETCLMVFKNHWSQVVRILERQGPRAAPGGADDLSA---VRNHTYQMLTLLAEDRAVPSAPTGPGPLLEFALHEDLLTRVLTWQLQWDELGDGVEERRAEQLKLFEMLVSEARQPLLRHGPVREALLTLLDACGRPVPSSPALDEGLVLLLSQLCVCVAQEPSLLEFFLQPPPEPGAAPRLLLFSRLVPFVHREGTLGQQARDALLLLMALSAGSPT-VGRYIADHSYFCPVLATGLSALYSSLPRKIEVPGDDWHCLRREDWLGVPALALFMSSLEFCNAVIQVAHPLVQKQLVDYIHNGFLVPVMGPALH----------------KTSVEEMIASTAYLELFLRSISEPALLRTFLRFLLLHRHDTHTILDTLVARIGSNS--------RLCMVSLSLFRTLLNLSCEDVLLQLVLRYLVPCNH------VMLSQKPAVRDVDLYGRAADK 452          

HSP 2 Score: 68.9366 bits (167), Expect = 5.016e-11
Identity = 57/226 (25.22%), Postives = 104/226 (46.02%), Query Frame = 2
Query: 2504 GPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHPDGNGEMNQNFEDEFEIRLSTTSSGAVNNSFFDFDXXXXXXXXXXXXKNKEKRTRKTAFGLLKRKK-------KDNIPQYRFPIQKFCYSKKKPISDYEAQRIRNLAYNWILFDEFCKELASLCQEHT 3160
            GPF++ +F +L  +  N+ ++N L+TG++  LA +PQPL++S LL+ +++ QP++  L  +L  VKN +   ++   D+ ++L  A +YL +R +L   +G          +  ++    S G +                     +   R R+ A  +L+  +           P    P+         P    EA R++N  Y  ++F EF KELA++ Q H 
Sbjct:  753 GPFMAVLFAKLENMLQNSVYVNFLLTGLVAQLACHPQPLLRSFLLNTNMVFQPSVKSLLQVLGSVKNKIENFAASQEDFPALLSKAKKYLIARGKLDWAEGPAAGPAPRRSDPLVKSRRPSLGEL----------------LLRHAHSPTRARQAAQLVLQPGRDGAGLGLSGGSPGASTPV--LLTRGGAPERQGEALRVKNAVYCAVIFPEFLKELAAISQAHA 960          
BLAST of FTS and Hook-interacting protein vs. Ensembl Human
Match: FAM160A2 (family with sequence similarity 160 member A2 [Source:HGNC Symbol;Acc:HGNC:25378])

HSP 1 Score: 184.496 bits (467), Expect = 8.527e-47
Identity = 133/455 (29.23%), Postives = 228/455 (50.11%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFI---------NNIDDLNSLETIFKHIDVMVSIIIKE-CDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECS--LRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEP-FYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDR 1387
            + + CL VF +HW QV+  +            DDL++   +  H   M++++ ++            +LE+    ++   +    +Q +  G   E     QL++++ L++      L    +   +L LL+ C   + SS  ++   V LL QL V +  +  L EF  +        P       ++  +HR+  +G+ +++ALLL+   +    + +  YI   S F  +L TGLS LYSS PRK++   DDW  + R     VP L   +  L+FCN  +++ H  ++  ++D+++ GFL PV+GP+LH                + S+EE I++TAYLEL+LR +  P +++ FL+F+L  R + + +LD+L+ R+ S +         L +++LSLFRT+L+   EDVL  LV RYL+PC+H      V LS   +V D+  Y    D+
Sbjct:   32 DPETCLMVFKNHWSQVVRILERQGPRAAPGGADDLSA---VRNHTYQMLTLLAEDRAVPSAPTGPGPLLEFALHEDLLTRVLTWQLQWDELGDGVEERRAEQLKLFEMLVSEARQPLLRHGPVREALLTLLDACGRPVPSSPALDEGLVLLLSQLCVCVAQEPSLLEFFLQPPPEPGAAPRLLLFSRLVPFVHREGTLGQQARDALLLLMALSAGSPT-VGRYIADHSYFCPVLATGLSALYSSLPRKIEVPGDDWHCLRREDWLGVPALALFMSSLEFCNAVIQVAHPLVQKQLVDYIHNGFLVPVMGPALH----------------KTSVEEMIASTAYLELFLRSISEPALLRTFLRFLLLHRHDTHTILDTLVARIGSNS--------RLCMVSLSLFRTLLNLSCEDVLLQLVLRYLVPCNH------VMLSQKPAVRDVDLYGRAADK 452          

HSP 2 Score: 69.3218 bits (168), Expect = 4.244e-11
Identity = 57/226 (25.22%), Postives = 104/226 (46.02%), Query Frame = 2
Query: 2504 GPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHPDGNGEMNQNFEDEFEIRLSTTSSGAVNNSFFDFDXXXXXXXXXXXXKNKEKRTRKTAFGLLKRKK-------KDNIPQYRFPIQKFCYSKKKPISDYEAQRIRNLAYNWILFDEFCKELASLCQEHT 3160
            GPF++ +F +L  +  N+ ++N L+TG++  LA +PQPL++S LL+ +++ QP++  L  +L  VKN +   ++   D+ ++L  A +YL +R +L   +G          +  ++    S G +                     +   R R+ A  +L+  +           P    P+         P    EA R++N  Y  ++F EF KELA++ Q H 
Sbjct:  739 GPFMAVLFAKLENMLQNSVYVNFLLTGLVAQLACHPQPLLRSFLLNTNMVFQPSVKSLLQVLGSVKNKIENFAASQEDFPALLSKAKKYLIARGKLDWAEGPAAGPAPRRSDPLVKSRRPSLGEL----------------LLRHAHSPTRARQAAQLVLQPGRDGAGLGLSGGSPGASTPV--LLTRGGAPERQGEALRVKNAVYCAVIFPEFLKELAAISQAHA 946          
BLAST of FTS and Hook-interacting protein vs. Ensembl Human
Match: FAM160A2 (family with sequence similarity 160 member A2 [Source:HGNC Symbol;Acc:HGNC:25378])

HSP 1 Score: 182.185 bits (461), Expect = 2.073e-46
Identity = 133/455 (29.23%), Postives = 228/455 (50.11%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFI---------NNIDDLNSLETIFKHIDVMVSIIIKE-CDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECS--LRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEP-FYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDR 1387
            + + CL VF +HW QV+  +            DDL++   +  H   M++++ ++            +LE+    ++   +    +Q +  G   E     QL++++ L++      L    +   +L LL+ C   + SS  ++   V LL QL V +  +  L EF  +        P       ++  +HR+  +G+ +++ALLL+   +    + +  YI   S F  +L TGLS LYSS PRK++   DDW  + R     VP L   +  L+FCN  +++ H  ++  ++D+++ GFL PV+GP+LH                + S+EE I++TAYLEL+LR +  P +++ FL+F+L  R + + +LD+L+ R+ S +         L +++LSLFRT+L+   EDVL  LV RYL+PC+H      V LS   +V D+  Y    D+
Sbjct:   32 DPETCLMVFKNHWSQVVRILERQGPRAAPGGADDLSA---VRNHTYQMLTLLAEDRAVPSAPTGPGPLLEFALHEDLLTRVLTWQLQWDELGDGVEERRAEQLKLFEMLVSEARQPLLRHGPVREALLTLLDACGRPVPSSPALDEGLVLLLSQLCVCVAQEPSLLEFFLQPPPEPGAAPRLLLFSRLVPFVHREGTLGQQARDALLLLMALSAGSPT-VGRYIADHSYFCPVLATGLSALYSSLPRKIEVPGDDWHCLRREDWLGVPALALFMSSLEFCNAVIQVAHPLVQKQLVDYIHNGFLVPVMGPALH----------------KTSVEEMIASTAYLELFLRSISEPALLRTFLRFLLLHRHDTHTILDTLVARIGSNS--------RLCMVSLSLFRTLLNLSCEDVLLQLVLRYLVPCNH------VMLSQKPAVRDVDLYGRAADK 452          
BLAST of FTS and Hook-interacting protein vs. Ensembl Celegans
Match: C05D11.8 (UPF0518 protein C05D11.8 [Source:UniProtKB/Swiss-Prot;Acc:Q11187])

HSP 1 Score: 105.916 bits (263), Expect = 8.479e-23
Identity = 88/302 (29.14%), Postives = 141/302 (46.69%), Query Frame = 2
Query:  440 RSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHE-PFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPV 1342
            + + + E + V LL Q+   +  D  L  F        FH   F     +I  ++   D G+L+++A+LLI + +  ED  + +Y+  R+ F  +L TGLS  +S  PR +  L D  +++            HS   L FCN   +  H+++  +I  F YTGFL+ VI P+                  QN  E   ++  YL++ L  +  P++++  +Q ILTER +N  +          I +  V+G     V +LSL  + L    EDV+ ALVFR L+  +H   +K  QLS V
Sbjct:  168 KKTSEAEKMFVLLLNQICTKLVEDRTLLHFF-------FHSNQFVVFTELIPFLYSAGDTGQLARDAVLLILSVSA-EDKSIAEYVTERTSFCQVLTTGLSACFSQLPRII--LGDGGERLVEDEYRDFLADYHS--ALLFCNAIAQTAHSEVVGNIASFFYTGFLTNVIKPAF----------------LQNDREYIGASMVYLQMCLETIVEPVLVRSIVQMILTERDDNGTL-------FYEIVISYVKGGDKTSVTSLSLIDSFLKLACEDVMLALVFRPLL-TNHSATKK--QLSVV 431          
BLAST of FTS and Hook-interacting protein vs. Ensembl Fly
Match: CG3558 (gene:FBgn0025681 transcript:FBtr0273230)

HSP 1 Score: 169.859 bits (429), Expect = 1.952e-42
Identity = 125/449 (27.84%), Postives = 221/449 (49.22%), Query Frame = 2
Query:   68 KICLDVFIDHWQQVLYFINNI-----DDLNSLETIFKHIDVMVSIIIKE---CD-------EEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSV---KIEHLSVHLLYQLTVLITSDVQLFEFI---------KEISTNEFHEP-------FYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFIL-TERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHL 1309
            + C D F  HWQQ    I +      DD+     +  H+D MV++++ E   C+       E         LE+    N+   +++        G+      + QL++Y+ L++      L     +  +L +L   S +  +    +E   V LL QL V++  +V L +           ++I       P       F    L+I  +HR+  +G  +++ALLL    ++ ++S++  YI   S    +LVTGL GLYS  P  ++    DW +IT   +  +PEL   +  L+FCN  +++ H  IK  +LDF+Y GF+ PV+GP++ Q   +  +H  T ++ Q      ISA +YL+L LR +  P +++ F++F+L TE+ +   +LD+L+ RLNS   +       L ++T++LF T+L  H ED++  L+ ++++P  H+
Sbjct:   34 RACYDSFCKHWQQAFEIIQHSAPPSHDDVLG---VVSHLDYMVTLLLVELHHCNKVSLPAAEASGPPAAPCLEFLLSENLLDKLYEWACTT---GRYANAVRLEQLKLYELLVSHSRHQLLCHEPFLRPLLKIL--ASSQGEIFPPDLEKRLVILLNQLCVVLMQNVHLLDLFFFSAQTQVQEQILNGNVAPPKSGTTTNFIIFSLLIPYVHREGSLGHQARDALLLCMALSQ-KNSNIGTYIAQYSSICPLLVTGLGGLYSRLPNSIEISSIDWHRITPDDVTEIPELTLFMNALEFCNAVVQVAHEMIKQQLLDFMYQGFIVPVLGPAILQT--LKGKHFQTNIDSQ------ISAMSYLDLILRSITEPGLLRAFVRFLLDTEKFDGERILDALVERLNSPDAN-------LCMVTMALFDTLLGLHCEDLMLELLLKFMLPGKHV 458          
BLAST of FTS and Hook-interacting protein vs. Ensembl Fly
Match: CG3558 (gene:FBgn0025681 transcript:FBtr0331653)

HSP 1 Score: 169.859 bits (429), Expect = 1.993e-42
Identity = 125/449 (27.84%), Postives = 221/449 (49.22%), Query Frame = 2
Query:   68 KICLDVFIDHWQQVLYFINNI-----DDLNSLETIFKHIDVMVSIIIKE---CD-------EEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSV---KIEHLSVHLLYQLTVLITSDVQLFEFI---------KEISTNEFHEP-------FYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFIL-TERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHL 1309
            + C D F  HWQQ    I +      DD+     +  H+D MV++++ E   C+       E         LE+    N+   +++        G+      + QL++Y+ L++      L     +  +L +L   S +  +    +E   V LL QL V++  +V L +           ++I       P       F    L+I  +HR+  +G  +++ALLL    ++ ++S++  YI   S    +LVTGL GLYS  P  ++    DW +IT   +  +PEL   +  L+FCN  +++ H  IK  +LDF+Y GF+ PV+GP++ Q   +  +H  T ++ Q      ISA +YL+L LR +  P +++ F++F+L TE+ +   +LD+L+ RLNS   +       L ++T++LF T+L  H ED++  L+ ++++P  H+
Sbjct:   34 RACYDSFCKHWQQAFEIIQHSAPPSHDDVLG---VVSHLDYMVTLLLVELHHCNKVSLPAAEASGPPAAPCLEFLLSENLLDKLYEWACTT---GRYANAVRLEQLKLYELLVSHSRHQLLCHEPFLRPLLKIL--ASSQGEIFPPDLEKRLVILLNQLCVVLMQNVHLLDLFFFSAQTQVQEQILNGNVAPPKSGTTTNFIIFSLLIPYVHREGSLGHQARDALLLCMALSQ-KNSNIGTYIAQYSSICPLLVTGLGGLYSRLPNSIEISSIDWHRITPDDVTEIPELTLFMNALEFCNAVVQVAHEMIKQQLLDFMYQGFIVPVLGPAILQT--LKGKHFQTNIDSQ------ISAMSYLDLILRSITEPGLLRAFVRFLLDTEKFDGERILDALVERLNSPDAN-------LCMVTMALFDTLLGLHCEDLMLELLLKFMLPGKHV 458          
BLAST of FTS and Hook-interacting protein vs. Ensembl Fly
Match: CG3558 (gene:FBgn0025681 transcript:FBtr0077645)

HSP 1 Score: 166.777 bits (421), Expect = 1.855e-41
Identity = 122/449 (27.17%), Postives = 217/449 (48.33%), Query Frame = 2
Query:   68 KICLDVFIDHWQQVLYFINNI-----DDLNSLETIFKHIDVMVSIIIKE---CD-------EEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSV---KIEHLSVHLLYQLTVLITSDVQLFEFI---------KEISTNEFHEP-------FYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFIL-TERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHL 1309
            + C D F  HWQQ    I +      DD+     +  H+D MV++++ E   C+       E         LE+    N+   +++        G+      + QL++Y+ L++      L     +  +L +L   S +  +    +E   V LL QL V++  +V L +           ++I       P       F    L+I  +HR+  +G  +++ALLL    ++ ++S++  YI   S    +LVTGL GLYS  P  ++    DW +IT   +  +PEL   +  L+FCN  +++ H  IK  +LDF+Y GF+ PV+GP++                 Q +++  ISA +YL+L LR +  P +++ F++F+L TE+ +   +LD+L+ RLNS   +       L ++T++LF T+L  H ED++  L+ ++++P  H+
Sbjct:   34 RACYDSFCKHWQQAFEIIQHSAPPSHDDVLG---VVSHLDYMVTLLLVELHHCNKVSLPAAEASGPPAAPCLEFLLSENLLDKLYEWACTT---GRYANAVRLEQLKLYELLVSHSRHQLLCHEPFLRPLLKIL--ASSQGEIFPPDLEKRLVILLNQLCVVLMQNVHLLDLFFFSAQTQVQEQILNGNVAPPKSGTTTNFIIFSLLIPYVHREGSLGHQARDALLLCMALSQ-KNSNIGTYIAQYSSICPLLVTGLGGLYSRLPNSIEISSIDWHRITPDDVTEIPELTLFMNALEFCNAVVQVAHEMIKQQLLDFMYQGFIVPVLGPAI----------------LQTNIDSQISAMSYLDLILRSITEPGLLRAFVRFLLDTEKFDGERILDALVERLNSPDAN-------LCMVTMALFDTLLGLHCEDLMLELLLKFMLPGKHV 450          
BLAST of FTS and Hook-interacting protein vs. Ensembl Fly
Match: CG3558 (gene:FBgn0025681 transcript:FBtr0077644)

HSP 1 Score: 166.777 bits (421), Expect = 1.879e-41
Identity = 122/449 (27.17%), Postives = 217/449 (48.33%), Query Frame = 2
Query:   68 KICLDVFIDHWQQVLYFINNI-----DDLNSLETIFKHIDVMVSIIIKE---CD-------EEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSV---KIEHLSVHLLYQLTVLITSDVQLFEFI---------KEISTNEFHEP-------FYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFIL-TERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHL 1309
            + C D F  HWQQ    I +      DD+     +  H+D MV++++ E   C+       E         LE+    N+   +++        G+      + QL++Y+ L++      L     +  +L +L   S +  +    +E   V LL QL V++  +V L +           ++I       P       F    L+I  +HR+  +G  +++ALLL    ++ ++S++  YI   S    +LVTGL GLYS  P  ++    DW +IT   +  +PEL   +  L+FCN  +++ H  IK  +LDF+Y GF+ PV+GP++                 Q +++  ISA +YL+L LR +  P +++ F++F+L TE+ +   +LD+L+ RLNS   +       L ++T++LF T+L  H ED++  L+ ++++P  H+
Sbjct:   34 RACYDSFCKHWQQAFEIIQHSAPPSHDDVLG---VVSHLDYMVTLLLVELHHCNKVSLPAAEASGPPAAPCLEFLLSENLLDKLYEWACTT---GRYANAVRLEQLKLYELLVSHSRHQLLCHEPFLRPLLKIL--ASSQGEIFPPDLEKRLVILLNQLCVVLMQNVHLLDLFFFSAQTQVQEQILNGNVAPPKSGTTTNFIIFSLLIPYVHREGSLGHQARDALLLCMALSQ-KNSNIGTYIAQYSSICPLLVTGLGGLYSRLPNSIEISSIDWHRITPDDVTEIPELTLFMNALEFCNAVVQVAHEMIKQQLLDFMYQGFIVPVLGPAI----------------LQTNIDSQISAMSYLDLILRSITEPGLLRAFVRFLLDTEKFDGERILDALVERLNSPDAN-------LCMVTMALFDTLLGLHCEDLMLELLLKFMLPGKHV 450          
BLAST of FTS and Hook-interacting protein vs. Ensembl Zebrafish
Match: fam160a1a (family with sequence similarity 160 member A1a [Source:ZFIN;Acc:ZDB-GENE-090312-132])

HSP 1 Score: 207.994 bits (528), Expect = 1.870e-54
Identity = 130/445 (29.21%), Postives = 222/445 (49.89%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFINNIDDLNS------LETIFKHIDVMVSIIIKECDEEETHSLEDILEY---------CSQNNIFKTIFDHFIQEN---------LRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLR----SSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLI 1312
            + + C+ VF +HW QV+  +   D L S                + S        +E  ++++ +E+         C QN     I +  + EN         LR +  +   + QL+MY+ LI       L    ++  ++ LL  CS      SS  +E   V LL QL  ++  D  + E     S ++    F    L+I  IHR+  +G+ +++ALLLI   +  E+  +  +I   + F  +L TGLSGLYSS P KLD   ++W  + R     +P L   L  L+FCN  +++ H  I+  ++ +++ GFL PV+ P+LH++                +LEE ++ TAYL+L++R +  P ++  FL FIL  R ++  +LD+L++R+N+         + LG ++L+LFRT++  + EDV+  L+F+YLIPC+H++
Sbjct:   21 DPETCMIVFKNHWAQVVKILEKHDPLRSNTGGLGGGHGLAGGGGLGSFRFGPIPGDEASAVQNYVEHMLFLLMEEECGQNGAMGPILEFVVMENVLERLFIWSLRREFTDDMKLEQLKMYEMLIGQARQPLLHHKPVLKPLMMLLSSCSGSPTGPSSPAVETELVLLLNQLCCVLAKDPSVLELFFHTSEDQGAANFLIFSLLIPFIHREGSVGQQARDALLLIMALSA-ENHVVAKHIAENTYFCPVLATGLSGLYSSLPTKLDVPSEEWHCLHRDDWQQLPALVQFLNSLEFCNAVIQVAHPSIRDQLVGYIHNGFLVPVLAPALHKL----------------TLEEVMTTTAYLDLFIRSVSEPALLHTFLSFILLHRHDSVHILDTLVSRINTP--------FQLGTVSLALFRTLIGLYCEDVMLQLIFKYLIPCNHMM 440          

HSP 2 Score: 71.633 bits (174), Expect = 5.246e-12
Identity = 42/93 (45.16%), Postives = 61/93 (65.59%), Query Frame = 2
Query: 2504 GPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSR 2782
            GPF+S +  RL  +P+NT  +NLL+TGI+  LAAYPQPL++S LL+ +++ QP++  LY +LA VKN +   SS   D   +L  A   L +R
Sbjct:  812 GPFVSVLLSRLENMPSNTLHVNLLLTGILAQLAAYPQPLLRSFLLNTNLVFQPSVRSLYQVLASVKNQIDVWSSKNKDSSELLTAAQHCLLAR 904          
BLAST of FTS and Hook-interacting protein vs. Ensembl Zebrafish
Match: fam160a1a (family with sequence similarity 160 member A1a [Source:ZFIN;Acc:ZDB-GENE-090312-132])

HSP 1 Score: 207.994 bits (528), Expect = 1.870e-54
Identity = 130/445 (29.21%), Postives = 222/445 (49.89%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFINNIDDLNS------LETIFKHIDVMVSIIIKECDEEETHSLEDILEY---------CSQNNIFKTIFDHFIQEN---------LRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLR----SSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLI 1312
            + + C+ VF +HW QV+  +   D L S                + S        +E  ++++ +E+         C QN     I +  + EN         LR +  +   + QL+MY+ LI       L    ++  ++ LL  CS      SS  +E   V LL QL  ++  D  + E     S ++    F    L+I  IHR+  +G+ +++ALLLI   +  E+  +  +I   + F  +L TGLSGLYSS P KLD   ++W  + R     +P L   L  L+FCN  +++ H  I+  ++ +++ GFL PV+ P+LH++                +LEE ++ TAYL+L++R +  P ++  FL FIL  R ++  +LD+L++R+N+         + LG ++L+LFRT++  + EDV+  L+F+YLIPC+H++
Sbjct:   21 DPETCMIVFKNHWAQVVKILEKHDPLRSNTGGLGGGHGLAGGGGLGSFRFGPIPGDEASAVQNYVEHMLFLLMEEECGQNGAMGPILEFVVMENVLERLFIWSLRREFTDDMKLEQLKMYEMLIGQARQPLLHHKPVLKPLMMLLSSCSGSPTGPSSPAVETELVLLLNQLCCVLAKDPSVLELFFHTSEDQGAANFLIFSLLIPFIHREGSVGQQARDALLLIMALSA-ENHVVAKHIAENTYFCPVLATGLSGLYSSLPTKLDVPSEEWHCLHRDDWQQLPALVQFLNSLEFCNAVIQVAHPSIRDQLVGYIHNGFLVPVLAPALHKL----------------TLEEVMTTTAYLDLFIRSVSEPALLHTFLSFILLHRHDSVHILDTLVSRINTP--------FQLGTVSLALFRTLIGLYCEDVMLQLIFKYLIPCNHMM 440          

HSP 2 Score: 71.633 bits (174), Expect = 5.246e-12
Identity = 42/93 (45.16%), Postives = 61/93 (65.59%), Query Frame = 2
Query: 2504 GPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSR 2782
            GPF+S +  RL  +P+NT  +NLL+TGI+  LAAYPQPL++S LL+ +++ QP++  LY +LA VKN +   SS   D   +L  A   L +R
Sbjct:  812 GPFVSVLLSRLENMPSNTLHVNLLLTGILAQLAAYPQPLLRSFLLNTNLVFQPSVRSLYQVLASVKNQIDVWSSKNKDSSELLTAAQHCLLAR 904          
BLAST of FTS and Hook-interacting protein vs. Ensembl Zebrafish
Match: fam160a1b (family with sequence similarity 160 member A1b [Source:ZFIN;Acc:ZDB-GENE-110411-10])

HSP 1 Score: 186.422 bits (472), Expect = 2.210e-49
Identity = 167/588 (28.40%), Postives = 263/588 (44.73%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFINNIDDLNSLETIFKHIDVMVSIIIKECDEEET--HSLEDIL-----EYCSQNNIFKTIFDHFIQEN---------LRGQIKEYGIINQLRMYDNLIN-----FLPCTQLMRSNLIITVLHLLEECSLRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDRPTFKCPPTXXXXXXXXX----XXXXXAEQFLKLSLGIYSEDQNILPTFPMSNKKLDSITLEQRRASQSPVVINNLQRFSLYCPFHSYLHSAALFVNRRILASHGWQFSYDGINPSTKIFEEINNS 1750
            + + C+ VF +HW QVL  +   D + +           +       DE     + +E +L     E C Q+    TI +  + EN         LR +  +   + QLRMY  L+       L    +++  +++         +  SS  +E   V LL QL  ++  D  + E     S ++    F    L+I  IHRD  +G  +++AL LI + +  ++S +  +I   + F  +L TGLSGLYS  P KL+   D W  +       VP L   L  L FC+   K+         L ++Y GFL PV+ P+LH++                +LEE ++ TAYLEL+LR +  P +++ FL FIL  R +N  +LD+L++R+N+         + LG ++L+LFRT++  + EDV+  L+ RYL+PC HL   +  +L+       IS  A     P+F  P  S       +      S   E  L+ SLG+  ED      F +S    D++    R A   PV+  N         +  YL+ A   V   + A   W   YDG+NPS    E+ N +
Sbjct:    2 DPETCMIVFRNHWTQVLRILEKHDPVRTAGIGLSRSGSGLRFGPIPGDEASAVQNYVEHMLFLLMEEECGQSGAMGTILEFVVVENVMEKLFLWSLRREFTDDMKLEQLRMYKMLVAQAKQPLLHHKPILKPLMMLLSACSSSSTATISSSAVETELVSLLNQLCRVLVKDASVLELFFHSSQDQGAANFLIFSLLIPFIHRDGMVGTQARDALTLIMSLSA-QNSLVAKHIVENTYFCPVLATGLSGLYSGLPAKLEVYSDGWFCLEEQDWLQVPALLQFLNSLHFCSTVCKL---------LGYIYNGFLVPVLAPALHKL----------------TLEEVMTTTAYLELFLRSISDPALLQTFLIFILRHRHDNVNILDTLVSRINT--------PFQLGTVSLALFRTLIGLYCEDVMLQLILRYLVPCAHLSCSERQRLTH-RDCYSISASALLSITPSFFIPKPSSSPAPAPKPDYILWSKVTESLLRGSLGM--ED-----LFSVS----DTVGF-SRIAVSEPVMDRN---------YLQYLYDARRSVCTAVHACSVWSAPYDGLNPSPDQCEDENEN 533          
BLAST of FTS and Hook-interacting protein vs. Ensembl Zebrafish
Match: fam160a2 (family with sequence similarity 160 member A2 [Source:NCBI gene;Acc:100001896])

HSP 1 Score: 192.586 bits (488), Expect = 2.251e-49
Identity = 134/455 (29.45%), Postives = 232/455 (50.99%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFINNIDD-----LNSLETIFKHIDVMVSIIIKE---CDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEEC---SLRSSVKIEHLSVHLLYQLTVLITSDVQLFEFI-KEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITR-IYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDR 1387
            + + CL VF +HW+QV   +   +       + L  +  H D M+ ++ +E     + ++ ++  ILE     NI + +    +   L    +    +  L++++ LI       L+ S ++  +L LL  C    +     +E   V LL Q+ V +  +  + E + +  S  +         L++  IHRD  +G+ +++ALLL+   T   +  +  +I   S F  +L TGLSGLYSS PRK++   DDW  + R  +IG V  L   +  L+FCN  +++ H  ++  +LD+L+ GFL PV+GP+LH                ++S++E I++TAYL+L+LR +    ++K FL+FIL    +N  +LD+L+ R++S +         L +++LSLF+T+LS + ED++  LV RYL+PC H      V LS   +V +   Y    D+
Sbjct:   29 DPETCLMVFENHWRQVSGVLKQRESSVGGFADDLTAVRNHTDQMLCLLAEERPAGGDIDSPAMGPILEMVVAENILEELVQWHVCRGLDPDSQ----LELLKLFEMLIGQSHQPLLLHSAVLQPLLSLLGACVDPQMGCPPALESSLVLLLNQVCVSMAKETAVLELLFRCGSVQQGPTNLLIFSLLVPFIHRDGALGQQARDALLLVMA-TSASNHAVARHITENSYFCPVLATGLSGLYSSLPRKIEVRGDDWHALRREDWIG-VSSLVLFMNSLEFCNAVVQVAHPLVRCQLLDYLHNGFLVPVMGPALH----------------KSSVDEMIASTAYLDLFLRCITETSLLKTFLRFILLHHHDNDTILDTLLTRISSNS--------RLCMVSLSLFKTLLSLNCEDLMLQLVLRYLLPCTH------VMLSQRRAVRETDLYGKSADK 447          

HSP 2 Score: 73.559 bits (179), Expect = 1.238e-12
Identity = 60/220 (27.27%), Postives = 103/220 (46.82%), Query Frame = 2
Query: 2504 GPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHPDGNGEMNQNFEDEFEIRLSTTSSGAVNNSFFDFDXXXXXXXXXXXXKNKEKRTRKTAFGLLKRKKKDNIPQYRFPIQKFCYSKKKPI-SDYEAQRIRNLAYNWILFDEFCKELASLCQEHT 3160
            GPF++ +F +L  +  N+ ++N+L+TG++  LA YPQPL++S LL+ +++ QP++  L  +L  VKN +   ++   D+ ++L  A  +L +R +L   D    +         +R S +   +   S  D               N   R R  A   L   +      +    +    S    +    EA R++N  Y  ++F EF KELA+L QEH 
Sbjct:  908 GPFITVLFSKLENMMQNSLYVNILLTGVVFQLACYPQPLLRSFLLNANMVFQPSVKSLIQVLGTVKNRIEVFAAAHEDFPAMLRKARRFLVARGKLDWSDSAMGVPS-------LRRSDSLIKSRKPSLGDL---------ILRHTNSPTRARHAAQLALAHVRDGGQSLHSALFRGSAASGASGLEKQAEALRVKNAVYCAVIFSEFLKELAALAQEHA 1111          
BLAST of FTS and Hook-interacting protein vs. Ensembl Zebrafish
Match: fam160a1a (family with sequence similarity 160 member A1a [Source:ZFIN;Acc:ZDB-GENE-090312-132])

HSP 1 Score: 168.318 bits (425), Expect = 6.244e-42
Identity = 121/445 (27.19%), Postives = 206/445 (46.29%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFINNIDDLNS------LETIFKHIDVMVSIIIKECDEEETHSLEDILEY---------CSQNNIFKTIFDHFIQEN---------LRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLR----SSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLI 1312
            + + C+ VF +HW QV+  +   D L S                + S        +E  ++++ +E+         C QN     I +  + EN         LR +  +   + QL+MY+ LI       L    ++  ++ LL  CS      SS  +E   V LL QL  ++  D  + E     S ++    F    L+I  IHR+  +G+ +++ALLLI   +  E+  +  +I   + F  +L TGLSGLYSS P KLD   ++W  + R     +P L   L  L+FCN  +++ H  I+  ++ +++ GFL PV+ P+LH++                +LEE ++ TAYL+L++R +  P ++  FL FIL  R ++  +LD+L++R+N+                   F+   +  + D       RYLIPC+H++
Sbjct:   21 DPETCMIVFKNHWAQVVKILEKHDPLRSNTGGLGGGHGLAGGGGLGSFRFGPIPGDEASAVQNYVEHMLFLLMEEECGQNGAMGPILEFVVMENVLERLFIWSLRREFTDDMKLEQLKMYEMLIGQARQPLLHHKPVLKPLMMLLSSCSGSPTGPSSPAVETELVLLLNQLCCVLAKDPSVLELFFHTSEDQGAANFLIFSLLIPFIHREGSVGQQARDALLLIMALSA-ENHVVAKHIAENTYFCPVLATGLSGLYSSLPTKLDVPSEEWHCLHRDDWQQLPALVQFLNSLEFCNAVIQVAHPSIRDQLVGYIHNGFLVPVLAPALHKL----------------TLEEVMTTTAYLDLFIRSVSEPALLHTFLSFILLHRHDSVHILDTLVSRINTP------------------FQYNWTLCTPD-------RYLIPCNHMM 423          

HSP 2 Score: 72.0182 bits (175), Expect = 4.371e-12
Identity = 42/93 (45.16%), Postives = 61/93 (65.59%), Query Frame = 2
Query: 2504 GPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSR 2782
            GPF+S +  RL  +P+NT  +NLL+TGI+  LAAYPQPL++S LL+ +++ QP++  LY +LA VKN +   SS   D   +L  A   L +R
Sbjct:  774 GPFVSVLLSRLENMPSNTLHVNLLLTGILAQLAAYPQPLLRSFLLNTNLVFQPSVRSLYQVLASVKNQIDVWSSKNKDSSELLTAAQHCLLAR 866          
BLAST of FTS and Hook-interacting protein vs. Ensembl Xenopus
Match: FAM160A1 (family with sequence similarity 160 member A1 [Source:NCBI gene;Acc:100486834])

HSP 1 Score: 223.402 bits (568), Expect = 2.755e-59
Identity = 137/449 (30.51%), Postives = 236/449 (52.56%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFINNIDDLNSLETIFKHIDV------------MVSIIIKECDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYA 1372
            +S+ C  VF +HW QV   + + D   + +  ++ I              M+ ++I+E  E    ++  ILEY    NI + +F      +LR +  +     QL+MY+ L+       L    ++  ++ LL  CS  S+  +E     LL QL  ++  D  + E     S ++    F    L+I  IHR+  +G+ +++ALL I + +  E++ +  +I   + F  +L TGLSGLYSS P KLD+  +DW  + +     +PEL      L+FCN  +++ H  I+  ++D+++ GFL PV+ P+LH+V                ++EE ++ TAYL+L+LR +  P ++K+FL+FIL  + E   +LD+L++R+N+         + L V++L+LFRT++  H EDV+  L+ RYLIPC+H      V ++  S+V +  CY+
Sbjct:   20 DSETCTMVFKNHWNQVQRILESHDPFKNTQAKYRSISADEVSAVQNYVEHMLMLLIEE--EVTDAAMGPILEYVVSENIMEKLF----LWSLRREFTDETKYEQLKMYELLVTQSHQPLLHHKPILKPLMMLLSACSGTSTAVVETKLAVLLNQLCSILAKDPSILELFFHTSEDQGAANFLIFSLLIPFIHREGTVGQQARDALLFIMSLSA-ENNVVAKHIVEGTFFCPVLATGLSGLYSSLPTKLDDKGEDWHCLLKEDCLQIPELIQFQNSLEFCNAVIQVAHPLIRAQLVDYIFNGFLLPVVAPALHKV----------------TVEEVMTTTAYLDLFLRSVSEPTLLKIFLRFILIHQHEKVHILDTLVSRINT--------PFRLCVVSLALFRTLIGLHCEDVMLQLILRYLIPCNH------VMVTQRSAVREQDCYS 431          

HSP 2 Score: 70.8626 bits (172), Expect = 1.291e-11
Identity = 69/233 (29.61%), Postives = 106/233 (45.49%), Query Frame = 2
Query: 2474 PNISNFSATLGPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHPDGN----GEMNQNFEDEFEIRLSTTSSGAVNNSFFDFDXXXXXXXXXXXXKNKEKRTRKTAFGLLKRKKKDNIPQYRFPIQKFCYSKKKPISDYEAQRIRNLAYNWILFDEFCKELASLCQEHT 3160
            P  + F+   GPF+S +  +L  +  N+  +NLL+ GIIT LA YPQPLI+S LL+ +I+ QP++  LY +LA VK  + + ++   ++  +LV A  YL  R+++ +   +      +  N E +     +    G V                    K KE R    A  LL                        P+S  E++ I+N      LF EF KELA+L QEH+
Sbjct:  793 PQTAPFT---GPFISVVLSKLENMLENSLHVNLLLIGIITQLATYPQPLIRSFLLNTNIVFQPSVRSLYQVLASVKQKIEQLAATQQNFPVLLVEAQRYLLCRMDMPNQSADTFTKDNIAANTERKPAAAAAEAPRGVVQ-------------------KAKEHR----ANPLL------------------------PLSG-ESKHIQNAMLAAALFPEFLKELAALAQEHS 974          
BLAST of FTS and Hook-interacting protein vs. Ensembl Xenopus
Match: kmt2d (lysine methyltransferase 2D [Source:Xenbase;Acc:XB-GENE-855725])

HSP 1 Score: 169.474 bits (428), Expect = 3.976e-42
Identity = 130/424 (30.66%), Postives = 217/424 (51.18%), Query Frame = 2
Query:  125 NIDDLNSLETIFKHIDVMVSIIIKECDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSVKIEHLSVHLLYQLTV--LITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRI-YIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDR 1387
            + DDL+S   +  +   MVS++ +E  ++       IL Y +   I + I    +Q + R +  E   + QL++Y+ LI+      L    ++  ++ LL   S   +  +   ++ LL       L      L  F +  S ++         L++  IH +  IG+ +++ALLLI   +  E+  +  YI   S F  IL TGLS LYSS PRK++   DDW  + R  +IG V  L   +  L+FCN   ++ H  ++  ++++++ GFL PV+GP+LH+                 S+EE I++TAYLEL+LR +    ++K FL+FIL  R ++  +L +LI+R+ S +         L +++L+LFRT+L+   ED L  LV RYLIPC+H      V LS   +++D+  Y+   D+
Sbjct:   33 SADDLSS---VRNNTYQMVSLLAEELPQD-GDGPGPILAYMASEGIMERI----LQWHRRREFTEDKKVEQLKLYEMLISQSRQPLLRYQPILRPLVTLLSTFSPGPAAPVLENNLVLLLNQLCVSLAREPSTLELFFQGPSGSDGPANLLIFSLLVPFIHHEGVIGQQARDALLLIMAMS-SENPTMAKYITENSFFCPILATGLSALYSSLPRKIEVRGDDWHFLRREDWIG-VSSLVLFMNSLEFCNAVTQVAHPLVQNQLVEYIHNGFLVPVMGPALHKT----------------SIEEMIASTAYLELFLRSISETPLLKTFLRFILLHRHDSSTILQTLISRIASNS--------RLCMVSLTLFRTLLNITCEDFLLQLVLRYLIPCNH------VMLSQRRAIKDLDLYSKTADK 416          

HSP 2 Score: 78.9518 bits (193), Expect = 4.332e-14
Identity = 62/219 (28.31%), Postives = 106/219 (48.40%), Query Frame = 2
Query: 2504 GPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHPDGNGEMNQNFEDEFEIRLSTTSSGAVNNSFFDFDXXXXXXXXXXXXKNKEKRTRKTAFGLLKRKKKDNIPQYRFPIQKFCYSKKKPISDYEAQRIRNLAYNWILFDEFCKELASLCQEHT 3160
            GPF+  +F +L  +  N+ ++N L+TGIIT LA +PQPL++S LL+ +++ QP++  L  +L  VKN +   ++   D+ ++L  A ++L +R       G  + ++N      +R S T   +   S  +               N   R R+ A    +  +   +         F  S +K     EA R++N  Y  ++F EF KELA++ QEH 
Sbjct:  709 GPFIGVLFAKLETMLQNSLYVNFLLTGIITQLACHPQPLLRSFLLNTNMVFQPSVKSLVQVLGSVKNKIEAFAASQEDFPTLLFKAKKFLIAR-------GKLDWSENQMSVPALRRSDTLVKSRKPSIGEL---------ILRHTNSPTRARQAAQMAFQHVRDGQVLHALSGSSIFKSSAEK---QNEALRVKNAVYCAVIFTEFMKELAAIAQEHA 908          
BLAST of FTS and Hook-interacting protein vs. Ensembl Xenopus
Match: kmt2d (lysine methyltransferase 2D [Source:Xenbase;Acc:XB-GENE-855725])

HSP 1 Score: 169.088 bits (427), Expect = 4.663e-42
Identity = 130/424 (30.66%), Postives = 217/424 (51.18%), Query Frame = 2
Query:  125 NIDDLNSLETIFKHIDVMVSIIIKECDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSVKIEHLSVHLLYQLTV--LITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRI-YIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDR 1387
            + DDL+S   +  +   MVS++ +E  ++       IL Y +   I + I    +Q + R +  E   + QL++Y+ LI+      L    ++  ++ LL   S   +  +   ++ LL       L      L  F +  S ++         L++  IH +  IG+ +++ALLLI   +  E+  +  YI   S F  IL TGLS LYSS PRK++   DDW  + R  +IG V  L   +  L+FCN   ++ H  ++  ++++++ GFL PV+GP+LH+                 S+EE I++TAYLEL+LR +    ++K FL+FIL  R ++  +L +LI+R+ S +         L +++L+LFRT+L+   ED L  LV RYLIPC+H      V LS   +++D+  Y+   D+
Sbjct:   34 SADDLSS---VRNNTYQMVSLLAEELPQD-GDGPGPILAYMASEGIMERI----LQWHRRREFTEDKKVEQLKLYEMLISQSRQPLLRYQPILRPLVTLLSTFSPGPAAPVLENNLVLLLNQLCVSLAREPSTLELFFQGPSGSDGPANLLIFSLLVPFIHHEGVIGQQARDALLLIMAMS-SENPTMAKYITENSFFCPILATGLSALYSSLPRKIEVRGDDWHFLRREDWIG-VSSLVLFMNSLEFCNAVTQVAHPLVQNQLVEYIHNGFLVPVMGPALHKT----------------SIEEMIASTAYLELFLRSISETPLLKTFLRFILLHRHDSSTILQTLISRIASNS--------RLCMVSLTLFRTLLNITCEDFLLQLVLRYLIPCNH------VMLSQRRAIKDLDLYSKTADK 417          

HSP 2 Score: 79.337 bits (194), Expect = 3.288e-14
Identity = 62/219 (28.31%), Postives = 106/219 (48.40%), Query Frame = 2
Query: 2504 GPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHPDGNGEMNQNFEDEFEIRLSTTSSGAVNNSFFDFDXXXXXXXXXXXXKNKEKRTRKTAFGLLKRKKKDNIPQYRFPIQKFCYSKKKPISDYEAQRIRNLAYNWILFDEFCKELASLCQEHT 3160
            GPF+  +F +L  +  N+ ++N L+TGIIT LA +PQPL++S LL+ +++ QP++  L  +L  VKN +   ++   D+ ++L  A ++L +R       G  + ++N      +R S T   +   S  +               N   R R+ A    +  +   +         F  S +K     EA R++N  Y  ++F EF KELA++ QEH 
Sbjct:  710 GPFIGVLFAKLETMLQNSLYVNFLLTGIITQLACHPQPLLRSFLLNTNMVFQPSVKSLVQVLGSVKNKIEAFAASQEDFPTLLFKAKKFLIAR-------GKLDWSENQMSVPALRRSDTLVKSRKPSIGEL---------ILRHTNSPTRARQAAQMAFQHVRDGQVLHALSGSSIFKSSAEK---QNEALRVKNAVYCAVIFTEFMKELAAIAQEHA 909          
BLAST of FTS and Hook-interacting protein vs. Ensembl Xenopus
Match: kmt2d (lysine methyltransferase 2D [Source:Xenbase;Acc:XB-GENE-855725])

HSP 1 Score: 169.088 bits (427), Expect = 5.360e-42
Identity = 130/424 (30.66%), Postives = 217/424 (51.18%), Query Frame = 2
Query:  125 NIDDLNSLETIFKHIDVMVSIIIKECDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSVKIEHLSVHLLYQLTV--LITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRI-YIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDR 1387
            + DDL+S   +  +   MVS++ +E  ++       IL Y +   I + I    +Q + R +  E   + QL++Y+ LI+      L    ++  ++ LL   S   +  +   ++ LL       L      L  F +  S ++         L++  IH +  IG+ +++ALLLI   +  E+  +  YI   S F  IL TGLS LYSS PRK++   DDW  + R  +IG V  L   +  L+FCN   ++ H  ++  ++++++ GFL PV+GP+LH+                 S+EE I++TAYLEL+LR +    ++K FL+FIL  R ++  +L +LI+R+ S +         L +++L+LFRT+L+   ED L  LV RYLIPC+H      V LS   +++D+  Y+   D+
Sbjct:   33 SADDLSS---VRNNTYQMVSLLAEELPQD-GDGPGPILAYMASEGIMERI----LQWHRRREFTEDKKVEQLKLYEMLISQSRQPLLRYQPILRPLVTLLSTFSPGPAAPVLENNLVLLLNQLCVSLAREPSTLELFFQGPSGSDGPANLLIFSLLVPFIHHEGVIGQQARDALLLIMAMS-SENPTMAKYITENSFFCPILATGLSALYSSLPRKIEVRGDDWHFLRREDWIG-VSSLVLFMNSLEFCNAVTQVAHPLVQNQLVEYIHNGFLVPVMGPALHKT----------------SIEEMIASTAYLELFLRSISETPLLKTFLRFILLHRHDSSTILQTLISRIASNS--------RLCMVSLTLFRTLLNITCEDFLLQLVLRYLIPCNH------VMLSQRRAIKDLDLYSKTADK 416          

HSP 2 Score: 79.337 bits (194), Expect = 3.538e-14
Identity = 62/219 (28.31%), Postives = 106/219 (48.40%), Query Frame = 2
Query: 2504 GPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHPDGNGEMNQNFEDEFEIRLSTTSSGAVNNSFFDFDXXXXXXXXXXXXKNKEKRTRKTAFGLLKRKKKDNIPQYRFPIQKFCYSKKKPISDYEAQRIRNLAYNWILFDEFCKELASLCQEHT 3160
            GPF+  +F +L  +  N+ ++N L+TGIIT LA +PQPL++S LL+ +++ QP++  L  +L  VKN +   ++   D+ ++L  A ++L +R       G  + ++N      +R S T   +   S  +               N   R R+ A    +  +   +         F  S +K     EA R++N  Y  ++F EF KELA++ QEH 
Sbjct:  709 GPFIGVLFAKLETMLQNSLYVNFLLTGIITQLACHPQPLLRSFLLNTNMVFQPSVKSLVQVLGSVKNKIEAFAASQEDFPTLLFKAKKFLIAR-------GKLDWSENQMSVPALRRSDTLVKSRKPSIGEL---------ILRHTNSPTRARQAAQMAFQHVRDGQVLHALSGSSIFKSSAEK---QNEALRVKNAVYCAVIFTEFMKELAAIAQEHA 908          
BLAST of FTS and Hook-interacting protein vs. Ensembl Xenopus
Match: kmt2d (lysine methyltransferase 2D [Source:Xenbase;Acc:XB-GENE-855725])

HSP 1 Score: 168.703 bits (426), Expect = 8.524e-42
Identity = 130/424 (30.66%), Postives = 217/424 (51.18%), Query Frame = 2
Query:  125 NIDDLNSLETIFKHIDVMVSIIIKECDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSVKIEHLSVHLLYQLTV--LITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRI-YIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDR 1387
            + DDL+S   +  +   MVS++ +E  ++       IL Y +   I + I    +Q + R +  E   + QL++Y+ LI+      L    ++  ++ LL   S   +  +   ++ LL       L      L  F +  S ++         L++  IH +  IG+ +++ALLLI   +  E+  +  YI   S F  IL TGLS LYSS PRK++   DDW  + R  +IG V  L   +  L+FCN   ++ H  ++  ++++++ GFL PV+GP+LH+                 S+EE I++TAYLEL+LR +    ++K FL+FIL  R ++  +L +LI+R+ S +         L +++L+LFRT+L+   ED L  LV RYLIPC+H      V LS   +++D+  Y+   D+
Sbjct:   30 SADDLSS---VRNNTYQMVSLLAEELPQD-GDGPGPILAYMASEGIMERI----LQWHRRREFTEDKKVEQLKLYEMLISQSRQPLLRYQPILRPLVTLLSTFSPGPAAPVLENNLVLLLNQLCVSLAREPSTLELFFQGPSGSDGPANLLIFSLLVPFIHHEGVIGQQARDALLLIMAMS-SENPTMAKYITENSFFCPILATGLSALYSSLPRKIEVRGDDWHFLRREDWIG-VSSLVLFMNSLEFCNAVTQVAHPLVQNQLVEYIHNGFLVPVMGPALHKT----------------SIEEMIASTAYLELFLRSISETPLLKTFLRFILLHRHDSSTILQTLISRIASNS--------RLCMVSLTLFRTLLNITCEDFLLQLVLRYLIPCNH------VMLSQRRAIKDLDLYSKTADK 413          

HSP 2 Score: 77.7962 bits (190), Expect = 8.520e-14
Identity = 62/219 (28.31%), Postives = 106/219 (48.40%), Query Frame = 2
Query: 2504 GPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHPDGNGEMNQNFEDEFEIRLSTTSSGAVNNSFFDFDXXXXXXXXXXXXKNKEKRTRKTAFGLLKRKKKDNIPQYRFPIQKFCYSKKKPISDYEAQRIRNLAYNWILFDEFCKELASLCQEHT 3160
            GPF+  +F +L  +  N+ ++N L+TGIIT LA +PQPL++S LL+ +++ QP++  L  +L  VKN +   ++   D+ ++L  A ++L +R       G  + ++N      +R S T   +   S  +               N   R R+ A    +  +   +         F  S +K     EA R++N  Y  ++F EF KELA++ QEH 
Sbjct:  805 GPFIGVLFAKLETMLQNSLYVNFLLTGIITQLACHPQPLLRSFLLNTNMVFQPSVKSLVQVLGSVKNKIEAFAASQEDFPTLLFKAKKFLIAR-------GKLDWSENQMSVPALRRSDTLVKSRKPSIGEL---------ILRHTNSPTRARQAAQMAFQHVRDGQVLHALSGSSIFKSSAEK---QNEALRVKNAVYCAVIFTEFMKELAAIAQEHA 1004          
BLAST of FTS and Hook-interacting protein vs. Ensembl Mouse
Match: Fam160a1 (family with sequence similarity 160, member A1 [Source:MGI Symbol;Acc:MGI:2444746])

HSP 1 Score: 225.713 bits (574), Expect = 8.141e-60
Identity = 135/450 (30.00%), Postives = 242/450 (53.78%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFINNIDDLNSLETIFK------------HIDVMVSIIIKECDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDH-LIKQKWVQLSPVSSVEDISCYA 1372
            + + C+ VF +HW QV+  +   D L + +  +             +++ M+ ++I+E  + +  ++  ILE+    NI + +F      +LR +  +   + QL+MY+ L+       L    ++  ++ LL  CS  ++  +E   V LL QL  ++  D  + E     S ++    F    L+I  IHR+  +G+ +++ALL I + +  E+S + ++I   + F  +L TGLSGLYSS P KL+   +DW  I +     +P L   +  L+FCN  +++ H  I+  ++ ++Y GFL PV+ P+LH+V                ++EE ++ TAYL+L+LR +  P ++++FL+FIL  R EN  +LD+L +R+N+         + L V++L+LFRT++  H EDV+  LV RYL+PC+H ++ Q+W       +V++  CY+
Sbjct:   21 DPETCMIVFKNHWAQVVKILEKHDPLKNTQAKYGSIPPDEASAVQNYVEHMLFLLIEE--QAKDAAMGPILEFVVCENIMEKLFLW----SLRREFTDETKLEQLKMYEMLVTQSYQPLLHHKPILKPLMMLLSSCSGTATPAVEGKLVVLLNQLCSILAKDPSILELFFHTSEDQGAANFLIFSLLIPFIHREGTVGQQARDALLFIMSLSA-ENSMVANHIVENTYFCPVLATGLSGLYSSLPTKLEEKGEDWHCILKDDWLLLPALVQFMNSLEFCNAVIQVAHPLIRTQLVSYIYNGFLVPVLAPALHKV----------------TVEEVMTTTAYLDLFLRSISEPALLEIFLRFILLHRHENVHILDTLTSRINT--------PFRLCVVSLALFRTLIGLHCEDVMLQLVLRYLVPCNHMMLSQRW-------AVKERDCYS 432          

HSP 2 Score: 70.8626 bits (172), Expect = 9.181e-12
Identity = 39/97 (40.21%), Postives = 67/97 (69.07%), Query Frame = 2
Query: 2504 GPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELT 2794
            GPF+S +  +L  +  N+  +NLL+ GIIT LA+YPQPL++S LL+ +++ QP++  LY +LA VKN + + +S   D+  +L+ A +YL  R++++
Sbjct:  892 GPFISVVLSKLENMLENSLHVNLLLIGIITQLASYPQPLLRSFLLNTNMVFQPSVRSLYQVLASVKNKIEQFASVERDFPGLLIQAQQYLLFRVDMS 988          
BLAST of FTS and Hook-interacting protein vs. Ensembl Mouse
Match: Fam160a1 (family with sequence similarity 160, member A1 [Source:MGI Symbol;Acc:MGI:2444746])

HSP 1 Score: 225.713 bits (574), Expect = 8.141e-60
Identity = 135/450 (30.00%), Postives = 242/450 (53.78%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFINNIDDLNSLETIFK------------HIDVMVSIIIKECDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDH-LIKQKWVQLSPVSSVEDISCYA 1372
            + + C+ VF +HW QV+  +   D L + +  +             +++ M+ ++I+E  + +  ++  ILE+    NI + +F      +LR +  +   + QL+MY+ L+       L    ++  ++ LL  CS  ++  +E   V LL QL  ++  D  + E     S ++    F    L+I  IHR+  +G+ +++ALL I + +  E+S + ++I   + F  +L TGLSGLYSS P KL+   +DW  I +     +P L   +  L+FCN  +++ H  I+  ++ ++Y GFL PV+ P+LH+V                ++EE ++ TAYL+L+LR +  P ++++FL+FIL  R EN  +LD+L +R+N+         + L V++L+LFRT++  H EDV+  LV RYL+PC+H ++ Q+W       +V++  CY+
Sbjct:   21 DPETCMIVFKNHWAQVVKILEKHDPLKNTQAKYGSIPPDEASAVQNYVEHMLFLLIEE--QAKDAAMGPILEFVVCENIMEKLFLW----SLRREFTDETKLEQLKMYEMLVTQSYQPLLHHKPILKPLMMLLSSCSGTATPAVEGKLVVLLNQLCSILAKDPSILELFFHTSEDQGAANFLIFSLLIPFIHREGTVGQQARDALLFIMSLSA-ENSMVANHIVENTYFCPVLATGLSGLYSSLPTKLEEKGEDWHCILKDDWLLLPALVQFMNSLEFCNAVIQVAHPLIRTQLVSYIYNGFLVPVLAPALHKV----------------TVEEVMTTTAYLDLFLRSISEPALLEIFLRFILLHRHENVHILDTLTSRINT--------PFRLCVVSLALFRTLIGLHCEDVMLQLVLRYLVPCNHMMLSQRW-------AVKERDCYS 432          

HSP 2 Score: 70.8626 bits (172), Expect = 9.181e-12
Identity = 39/97 (40.21%), Postives = 67/97 (69.07%), Query Frame = 2
Query: 2504 GPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELT 2794
            GPF+S +  +L  +  N+  +NLL+ GIIT LA+YPQPL++S LL+ +++ QP++  LY +LA VKN + + +S   D+  +L+ A +YL  R++++
Sbjct:  892 GPFISVVLSKLENMLENSLHVNLLLIGIITQLASYPQPLLRSFLLNTNMVFQPSVRSLYQVLASVKNKIEQFASVERDFPGLLIQAQQYLLFRVDMS 988          
BLAST of FTS and Hook-interacting protein vs. Ensembl Mouse
Match: Fam160a2 (family with sequence similarity 160, member A2 [Source:MGI Symbol;Acc:MGI:1921599])

HSP 1 Score: 197.593 bits (501), Expect = 1.003e-51
Identity = 137/456 (30.04%), Postives = 233/456 (51.10%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFI---------NNIDDLNSLETIFKHIDVMVSIIIKECDEEETHSLED-ILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECS--LRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEP-FYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRI-YIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDR 1387
            + + CL VF +HW QV+  +            DDL++   +  H   M++++ ++       S    +LE+  + ++   +    +Q +  G   E     QL++++ L++      L    +   +L LL+ C   + SS  ++   V LL QL V +  +  L EF  +        P       ++  +HR+  +G+ +++ALLL+   + D    +  YI   S F  +L TGLS LYSS PRK++   DDW  + R  +IG VP L   +  L+FCN  +++ H  ++  ++D+++ GFL PV+GP+LH                + S+EE I++TAYLEL+LR +  P +++ FL+F+L  R + + +LD+L+ R+ S +         L +++LSLFRT+L+   EDVL  LV RYL+PC+H      V LS   +V D+  Y    D+
Sbjct:   32 DPETCLMVFKNHWSQVVRILERQGPRAATGGADDLSA---VRNHTYQMLTLLAEDRAVPSAPSGPGPLLEFALREDLLSRVLTWQLQWDEFGDGVEERRAEQLKLFEMLVSEARQPLLRHGPVREALLALLDACGRPVPSSPALDEGLVLLLSQLCVCVAREPSLLEFFLQPPPEPGAAPRLLLFSRLVPFVHREGTLGQQARDALLLLMALS-DGSPTVGRYIADHSYFCPVLATGLSALYSSLPRKIEVPGDDWHCLRREDWIG-VPALALFMSSLEFCNAVIQVAHPLVQKQLVDYIHNGFLVPVMGPALH----------------KTSVEEMIASTAYLELFLRSISEPALLRTFLRFLLLHRHDTHTILDTLVARIGSNS--------RLCMVSLSLFRTLLNLSCEDVLLQLVLRYLVPCNH------VMLSQKPAVRDVDLYGRAADK 452          

HSP 2 Score: 62.003 bits (149), Expect = 4.370e-9
Identity = 34/101 (33.66%), Postives = 65/101 (64.36%), Query Frame = 2
Query: 2504 GPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHPDG 2806
            GPF++ +F +L  +  N+ ++N L+TG++  LA +PQPL++S LL+ +++ QP++  L  +L  VKN +   ++   D+ ++L  A +YL +R +L   +G
Sbjct:  559 GPFMAVLFAKLENMLQNSVYVNFLLTGLVAQLACHPQPLLRSFLLNTNMVFQPSVKSLLQVLGSVKNKIESFAASQEDFPALLSKAKKYLIARGKLDWAEG 659          
BLAST of FTS and Hook-interacting protein vs. Ensembl Mouse
Match: Fam160a2 (family with sequence similarity 160, member A2 [Source:MGI Symbol;Acc:MGI:1921599])

HSP 1 Score: 197.978 bits (502), Expect = 2.722e-51
Identity = 137/456 (30.04%), Postives = 233/456 (51.10%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFI---------NNIDDLNSLETIFKHIDVMVSIIIKECDEEETHSLED-ILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECS--LRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEP-FYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRI-YIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDR 1387
            + + CL VF +HW QV+  +            DDL++   +  H   M++++ ++       S    +LE+  + ++   +    +Q +  G   E     QL++++ L++      L    +   +L LL+ C   + SS  ++   V LL QL V +  +  L EF  +        P       ++  +HR+  +G+ +++ALLL+   + D    +  YI   S F  +L TGLS LYSS PRK++   DDW  + R  +IG VP L   +  L+FCN  +++ H  ++  ++D+++ GFL PV+GP+LH                + S+EE I++TAYLEL+LR +  P +++ FL+F+L  R + + +LD+L+ R+ S +         L +++LSLFRT+L+   EDVL  LV RYL+PC+H      V LS   +V D+  Y    D+
Sbjct:   32 DPETCLMVFKNHWSQVVRILERQGPRAATGGADDLSA---VRNHTYQMLTLLAEDRAVPSAPSGPGPLLEFALREDLLSRVLTWQLQWDEFGDGVEERRAEQLKLFEMLVSEARQPLLRHGPVREALLALLDACGRPVPSSPALDEGLVLLLSQLCVCVAREPSLLEFFLQPPPEPGAAPRLLLFSRLVPFVHREGTLGQQARDALLLLMALS-DGSPTVGRYIADHSYFCPVLATGLSALYSSLPRKIEVPGDDWHCLRREDWIG-VPALALFMSSLEFCNAVIQVAHPLVQKQLVDYIHNGFLVPVMGPALH----------------KTSVEEMIASTAYLELFLRSISEPALLRTFLRFLLLHRHDTHTILDTLVARIGSNS--------RLCMVSLSLFRTLLNLSCEDVLLQLVLRYLVPCNH------VMLSQKPAVRDVDLYGRAADK 452          

HSP 2 Score: 61.2326 bits (147), Expect = 7.908e-9
Identity = 34/101 (33.66%), Postives = 65/101 (64.36%), Query Frame = 2
Query: 2504 GPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHPDG 2806
            GPF++ +F +L  +  N+ ++N L+TG++  LA +PQPL++S LL+ +++ QP++  L  +L  VKN +   ++   D+ ++L  A +YL +R +L   +G
Sbjct:  743 GPFMAVLFAKLENMLQNSVYVNFLLTGLVAQLACHPQPLLRSFLLNTNMVFQPSVKSLLQVLGSVKNKIESFAASQEDFPALLSKAKKYLIARGKLDWAEG 843          
BLAST of FTS and Hook-interacting protein vs. Ensembl Mouse
Match: Fam160a2 (family with sequence similarity 160, member A2 [Source:MGI Symbol;Acc:MGI:1921599])

HSP 1 Score: 197.978 bits (502), Expect = 2.722e-51
Identity = 137/456 (30.04%), Postives = 233/456 (51.10%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFI---------NNIDDLNSLETIFKHIDVMVSIIIKECDEEETHSLED-ILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECS--LRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEP-FYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRI-YIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDR 1387
            + + CL VF +HW QV+  +            DDL++   +  H   M++++ ++       S    +LE+  + ++   +    +Q +  G   E     QL++++ L++      L    +   +L LL+ C   + SS  ++   V LL QL V +  +  L EF  +        P       ++  +HR+  +G+ +++ALLL+   + D    +  YI   S F  +L TGLS LYSS PRK++   DDW  + R  +IG VP L   +  L+FCN  +++ H  ++  ++D+++ GFL PV+GP+LH                + S+EE I++TAYLEL+LR +  P +++ FL+F+L  R + + +LD+L+ R+ S +         L +++LSLFRT+L+   EDVL  LV RYL+PC+H      V LS   +V D+  Y    D+
Sbjct:   32 DPETCLMVFKNHWSQVVRILERQGPRAATGGADDLSA---VRNHTYQMLTLLAEDRAVPSAPSGPGPLLEFALREDLLSRVLTWQLQWDEFGDGVEERRAEQLKLFEMLVSEARQPLLRHGPVREALLALLDACGRPVPSSPALDEGLVLLLSQLCVCVAREPSLLEFFLQPPPEPGAAPRLLLFSRLVPFVHREGTLGQQARDALLLLMALS-DGSPTVGRYIADHSYFCPVLATGLSALYSSLPRKIEVPGDDWHCLRREDWIG-VPALALFMSSLEFCNAVIQVAHPLVQKQLVDYIHNGFLVPVMGPALH----------------KTSVEEMIASTAYLELFLRSISEPALLRTFLRFLLLHRHDTHTILDTLVARIGSNS--------RLCMVSLSLFRTLLNLSCEDVLLQLVLRYLVPCNH------VMLSQKPAVRDVDLYGRAADK 452          

HSP 2 Score: 61.2326 bits (147), Expect = 7.908e-9
Identity = 34/101 (33.66%), Postives = 65/101 (64.36%), Query Frame = 2
Query: 2504 GPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHPDG 2806
            GPF++ +F +L  +  N+ ++N L+TG++  LA +PQPL++S LL+ +++ QP++  L  +L  VKN +   ++   D+ ++L  A +YL +R +L   +G
Sbjct:  743 GPFMAVLFAKLENMLQNSVYVNFLLTGLVAQLACHPQPLLRSFLLNTNMVFQPSVKSLLQVLGSVKNKIESFAASQEDFPALLSKAKKYLIARGKLDWAEG 843          
BLAST of FTS and Hook-interacting protein vs. UniProt/SwissProt
Match: sp|Q505K2|F16A1_MOUSE (Protein FAM160A1 OS=Mus musculus OX=10090 GN=Fam160a1 PE=1 SV=2)

HSP 1 Score: 225.713 bits (574), Expect = 5.694e-59
Identity = 135/450 (30.00%), Postives = 242/450 (53.78%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFINNIDDLNSLETIFK------------HIDVMVSIIIKECDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDH-LIKQKWVQLSPVSSVEDISCYA 1372
            + + C+ VF +HW QV+  +   D L + +  +             +++ M+ ++I+E  + +  ++  ILE+    NI + +F      +LR +  +   + QL+MY+ L+       L    ++  ++ LL  CS  ++  +E   V LL QL  ++  D  + E     S ++    F    L+I  IHR+  +G+ +++ALL I + +  E+S + ++I   + F  +L TGLSGLYSS P KL+   +DW  I +     +P L   +  L+FCN  +++ H  I+  ++ ++Y GFL PV+ P+LH+V                ++EE ++ TAYL+L+LR +  P ++++FL+FIL  R EN  +LD+L +R+N+         + L V++L+LFRT++  H EDV+  LV RYL+PC+H ++ Q+W       +V++  CY+
Sbjct:   21 DPETCMIVFKNHWAQVVKILEKHDPLKNTQAKYGSIPPDEASAVQNYVEHMLFLLIEE--QAKDAAMGPILEFVVCENIMEKLFLW----SLRREFTDETKLEQLKMYEMLVTQSYQPLLHHKPILKPLMMLLSSCSGTATPAVEGKLVVLLNQLCSILAKDPSILELFFHTSEDQGAANFLIFSLLIPFIHREGTVGQQARDALLFIMSLSA-ENSMVANHIVENTYFCPVLATGLSGLYSSLPTKLEEKGEDWHCILKDDWLLLPALVQFMNSLEFCNAVIQVAHPLIRTQLVSYIYNGFLVPVLAPALHKV----------------TVEEVMTTTAYLDLFLRSISEPALLEIFLRFILLHRHENVHILDTLTSRINT--------PFRLCVVSLALFRTLIGLHCEDVMLQLVLRYLVPCNHMMLSQRW-------AVKERDCYS 432          

HSP 2 Score: 70.8626 bits (172), Expect = 6.422e-11
Identity = 39/97 (40.21%), Postives = 67/97 (69.07%), Query Frame = 2
Query: 2504 GPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELT 2794
            GPF+S +  +L  +  N+  +NLL+ GIIT LA+YPQPL++S LL+ +++ QP++  LY +LA VKN + + +S   D+  +L+ A +YL  R++++
Sbjct:  892 GPFISVVLSKLENMLENSLHVNLLLIGIITQLASYPQPLLRSFLLNTNMVFQPSVRSLYQVLASVKNKIEQFASVERDFPGLLIQAQQYLLFRVDMS 988          
BLAST of FTS and Hook-interacting protein vs. UniProt/SwissProt
Match: sp|Q05DH4|F16A1_HUMAN (Protein FAM160A1 OS=Homo sapiens OX=9606 GN=FAM160A1 PE=2 SV=2)

HSP 1 Score: 222.631 bits (566), Expect = 3.690e-58
Identity = 133/450 (29.56%), Postives = 242/450 (53.78%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFINNIDDLNSLETIFK------------HIDVMVSIIIKECDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDH-LIKQKWVQLSPVSSVEDISCYA 1372
            + + C+ VF +HW QV+  +   D L + +  +             +++ M+ ++I+E  + +  ++  ILE+    NI + +F      +LR +  +   I QL+MY+ L+       L    ++  ++ LL  CS  ++  +E   V LL QL  ++  D  + E     S ++    F    L+I  IHR+  +G+ +++ALL I + +  E++ +  +I   + F  +L TGLSGLYSS P KL+   ++W  + +     +P L   +  L+FCN  +++ H  I+  +++++Y GFL PV+ P+LH+V                ++EE ++ TAYL+L+LR +  P ++++FL+FIL  + EN  +LD+L +R+N+         + L V++L+LFRT++  H EDV+  LV RYLIPC+H ++ Q+W       +V++  CY+
Sbjct:   21 DPETCMIVFKNHWAQVVKILEKHDPLKNTQAKYGSIPPDEASAVQNYVEHMLFLLIEE--QAKDAAMGPILEFVVSENIMEKLF----LWSLRREFTDETKIEQLKMYEMLVTQSHQPLLHHKPILKPLMMLLSSCSGTTTPTVEEKLVVLLNQLCSILAKDPSILELFFHTSEDQGAANFLIFSLLIPFIHREGSVGQQARDALLFIMSLSA-ENTMVAHHIVENTYFCPVLATGLSGLYSSLPTKLEEKGEEWHCLLKDDWLLLPSLVQFMNSLEFCNAVIQVAHPLIRNQLVNYIYNGFLVPVLAPALHKV----------------TVEEVMTTTAYLDLFLRSISEPALLEIFLRFILLHQHENVHILDTLTSRINTP--------FRLCVVSLALFRTLIGLHCEDVMLQLVLRYLIPCNHMMLSQRW-------AVKERDCYS 432          

HSP 2 Score: 74.7146 bits (182), Expect = 4.441e-12
Identity = 70/254 (27.56%), Postives = 113/254 (44.49%), Query Frame = 2
Query: 2417 NEVIFKRRLQSFDQSIQFSPNISNFSATLGPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHPDGNGEMNQNFEDEFEIRLSTTSSGAVNNSFFDFDXXXXXXXXXXXXKNKEKRTRKTAFGLLKRKKKDNIPQYRFPIQKFCYSKKKPISDYEAQ---RIRNLAYNWILFDEFCKELASLCQEHTQHC 3169
            +E  F  R     QS  F+          GPF+S +  +L  +  N+  +NLL+ GIIT LA+YPQPL++S LL+ +++ QP++  LY +LA VKN + + +S   D+  +L+ A +YL                      F + +S  +  A+                    K+  +   +T  G   +   D  P+    +Q F   + K +++        +RN      LF EF KELA+L QEH+  C
Sbjct:  832 DEAAFASRHPVRTQSTPFT----------GPFISVVLSKLENMLENSLHVNLLLIGIITQLASYPQPLLRSFLLNTNMVFQPSVRSLYQVLASVKNKIEQFASVERDFPGLLIQAQQYLL---------------------FRVDMSDMTPAALT-------------------KDPIQEASRTGSG---KNLLDGPPRV---LQPFLTHRTK-VAEAPPNLPLPVRNPMLAAALFPEFLKELAALAQEHSILC 1028          
BLAST of FTS and Hook-interacting protein vs. UniProt/SwissProt
Match: sp|Q66H54|F16A2_RAT (FTS and Hook-interacting protein OS=Rattus norvegicus OX=10116 GN=Fam160a2 PE=1 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 7.338e-51
Identity = 137/456 (30.04%), Postives = 233/456 (51.10%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFI---------NNIDDLNSLETIFKHIDVMVSIIIKECDEEETHSLED-ILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECS--LRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEP-FYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRI-YIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDR 1387
            + + CL VF +HW QV+  +            DDL++   +  H   M++++ ++       S    +LE+  + ++   +    +Q +  G   E     QL++++ L++      L    +   +L LL+ C   + SS  ++   V LL QL V +  +  L EF  +        P       ++  +HR+  +G+ +++ALLL+   + D    +  YI   S F  +L TGLS LYSS PRK++   DDW  + R  +IG VP L   +  L+FCN  +++ H  ++  ++D+++ GFL PV+GP+LH                + S+EE I++TAYLEL+LR +  P +++ FL+F+L  R + + +LD+L+ R+ S +         L +++LSLFRT+L+   EDVL  LV RYL+PC+H      V LS   +V D+  Y    D+
Sbjct:   32 DPETCLMVFKNHWSQVVRILERQGSRAAAGGADDLSA---VRNHTYQMLTLLAEDRAVPSAPSGPGPLLEFALREDLLSRVLTWQLQWDEFGDGVEERRAEQLKLFEMLVSEARQPLLRHGPVREALLALLDACGRPVPSSPALDEGLVLLLSQLCVCVAREPSLLEFFLQPPPEPGAAPRLLLFSRLVPFVHREGTLGQQARDALLLLMALS-DGSPTVGRYIADHSYFCPVLATGLSALYSSLPRKIEVPGDDWHCLRREDWIG-VPALALFMSSLEFCNAVIQVAHPLVQKQLVDYIHNGFLVPVMGPALH----------------KTSVEEMIASTAYLELFLRSISEPALLRTFLRFLLLHRHDTHTILDTLVARIGSNS--------RLCMVSLSLFRTLLNLSCEDVLLQLVLRYLVPCNH------VMLSQKPAVRDVDLYGRAADK 452          

HSP 2 Score: 62.003 bits (149), Expect = 3.109e-8
Identity = 34/101 (33.66%), Postives = 65/101 (64.36%), Query Frame = 2
Query: 2504 GPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHPDG 2806
            GPF++ +F +L  +  N+ ++N L+TG++  LA +PQPL++S LL+ +++ QP++  L  +L  VKN +   ++   D+ ++L  A +YL +R +L   +G
Sbjct:  559 GPFMAVLFAKLENMLQNSVYVNFLLTGLVAQLACHPQPLLRSFLLNTNMVFQPSVKSLLQVLGSVKNKIESFAASQEDFPALLSKAKKYLIARGKLDWAEG 659          
BLAST of FTS and Hook-interacting protein vs. UniProt/SwissProt
Match: sp|Q3U2I3|F16A2_MOUSE (FTS and Hook-interacting protein OS=Mus musculus OX=10090 GN=Fam160a2 PE=1 SV=2)

HSP 1 Score: 197.978 bits (502), Expect = 1.904e-50
Identity = 137/456 (30.04%), Postives = 233/456 (51.10%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFI---------NNIDDLNSLETIFKHIDVMVSIIIKECDEEETHSLED-ILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECS--LRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEP-FYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRI-YIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDR 1387
            + + CL VF +HW QV+  +            DDL++   +  H   M++++ ++       S    +LE+  + ++   +    +Q +  G   E     QL++++ L++      L    +   +L LL+ C   + SS  ++   V LL QL V +  +  L EF  +        P       ++  +HR+  +G+ +++ALLL+   + D    +  YI   S F  +L TGLS LYSS PRK++   DDW  + R  +IG VP L   +  L+FCN  +++ H  ++  ++D+++ GFL PV+GP+LH                + S+EE I++TAYLEL+LR +  P +++ FL+F+L  R + + +LD+L+ R+ S +         L +++LSLFRT+L+   EDVL  LV RYL+PC+H      V LS   +V D+  Y    D+
Sbjct:   32 DPETCLMVFKNHWSQVVRILERQGPRAATGGADDLSA---VRNHTYQMLTLLAEDRAVPSAPSGPGPLLEFALREDLLSRVLTWQLQWDEFGDGVEERRAEQLKLFEMLVSEARQPLLRHGPVREALLALLDACGRPVPSSPALDEGLVLLLSQLCVCVAREPSLLEFFLQPPPEPGAAPRLLLFSRLVPFVHREGTLGQQARDALLLLMALS-DGSPTVGRYIADHSYFCPVLATGLSALYSSLPRKIEVPGDDWHCLRREDWIG-VPALALFMSSLEFCNAVIQVAHPLVQKQLVDYIHNGFLVPVMGPALH----------------KTSVEEMIASTAYLELFLRSISEPALLRTFLRFLLLHRHDTHTILDTLVARIGSNS--------RLCMVSLSLFRTLLNLSCEDVLLQLVLRYLVPCNH------VMLSQKPAVRDVDLYGRAADK 452          

HSP 2 Score: 61.2326 bits (147), Expect = 5.531e-8
Identity = 34/101 (33.66%), Postives = 65/101 (64.36%), Query Frame = 2
Query: 2504 GPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHPDG 2806
            GPF++ +F +L  +  N+ ++N L+TG++  LA +PQPL++S LL+ +++ QP++  L  +L  VKN +   ++   D+ ++L  A +YL +R +L   +G
Sbjct:  743 GPFMAVLFAKLENMLQNSVYVNFLLTGLVAQLACHPQPLLRSFLLNTNMVFQPSVKSLLQVLGSVKNKIESFAASQEDFPALLSKAKKYLIARGKLDWAEG 843          
BLAST of FTS and Hook-interacting protein vs. UniProt/SwissProt
Match: sp|Q5R8V2|F16A2_PONAB (FTS and Hook-interacting protein OS=Pongo abelii OX=9601 GN=FAM160A2 PE=2 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 3.759e-49
Identity = 131/455 (28.79%), Postives = 226/455 (49.67%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFI---------NNIDDLNSLETIFKHIDVMVSIIIKE-CDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECS--LRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEP-FYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDR 1387
            + + CL VF +HW QV+  +            DDL++   +  H   M++++ ++            +LE+    ++   +    +Q    G   E     QL++++ L++      L    +   +L LL+ C   + SS  ++   V LL QL V +  +  L EF  +        P       ++  +HR+  +G+ +++AL L+   +    + +  YI   S F  +L TGLS LYSS PR+++   DDW  + R     VP L   +  L+FCN  +++ H  ++  ++D+++ GFL PV+GP+LH                + S+EE I++TAYLEL+LR +  P +++ FL+F+L  R + + +LD+L+ R+ S +         L +++LSLFRT+L+   EDVL  LV RYL+PC+H      V LS   +V D+  Y    D+
Sbjct:   32 DPETCLMVFKNHWSQVVRILERQGPRAAPGGADDLSA---VRNHTYQMLTLLAEDRAVPSAPTGPGPLLEFAPHEDLLTRVLTWQLQWGELGDGVEERRAEQLKLFEMLVSEARQPLLQHGPVREALLTLLDACGRPVPSSPALDEGLVLLLSQLCVCVAQEPSLLEFFLQPPPEPGAAPRLLLFSRLVPFVHREGTLGQQARDALPLLMALSAGSPT-VGRYIADHSYFCPVLATGLSALYSSLPRRIEVPGDDWHCLRREDWLGVPALALFMSSLEFCNAVIQVAHPLVQKQLVDYIHNGFLVPVMGPALH----------------KTSVEEMIASTAYLELFLRSISEPALLRTFLRFLLLHRHDTHTILDTLVARIGSNS--------RLCMVSLSLFRTLLNLSCEDVLLQLVLRYLVPCNH------VMLSQKPAVRDVDLYGRAADK 452          

HSP 2 Score: 68.9366 bits (167), Expect = 2.652e-10
Identity = 56/226 (24.78%), Postives = 104/226 (46.02%), Query Frame = 2
Query: 2504 GPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHPDGNGEMNQNFEDEFEIRLSTTSSGAVNNSFFDFDXXXXXXXXXXXXKNKEKRTR-KTAFGLLKRKKKDNIPQYRFPIQKFCYSK------KKPISDYEAQRIRNLAYNWILFDEFCKELASLCQEHT 3160
            GPF++ +F +L  +  N+ ++N L+TG++  LA +PQPL++S LL+ +++ QP++  L  +L  VKN +   ++   D+ ++L  A +YL +R +L   +G          +  ++    S G +                    ++    TR + A  L+ +  +D              +         P    EA R++N  Y  ++F EF KELA++ Q H 
Sbjct:  739 GPFMAVLFAKLENMLQNSVYVNFLLTGLVAQLACHPQPLLRSFLLNTNMVFQPSVKSLLQVLGSVKNKIENFAASQEDFPALLSKAKKYLIARGKLDWAEGPAAGPAPRRSDPLVKSRRPSLGEL------------------LLRHARSPTRARQAAQLVLQPGRDGAGLGLSGGSPGASTPVLPTRGGAPERQGEALRVKNAVYCAVIFPEFLKELAAISQAHA 946          
BLAST of FTS and Hook-interacting protein vs. TrEMBL
Match: A0A159X5N1 (FAM160A1-like protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=FAM160A1 PE=2 SV=1)

HSP 1 Score: 517.694 bits (1332), Expect = 1.883e-171
Identity = 285/290 (98.28%), Postives = 285/290 (98.28%), Query Frame = 2
Query: 1931 TISNQQPNYLPPDEQEESNEHSVSNLLCQALNSAKMYKLNFFNFDSQIKEVQDSEGCMEIFENPEIDPSFINDFSFQEDVNEHNVLLTTHNDCTLSDFLVSLDLLEIHQKIDWNVNWDEISLLLFEHRANVNPGHERSSLTCISPVVXXXXXXXXXXXXTPTNEVIFKRRLQSFDQSIQFSPNISNFSATLGPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHP 2800
            TISNQQPNYLP DEQEESNEHSVSNLL QALNSAKMYKLNFFNFDSQIKEVQDSEGCMEIFENPEIDPSFINDFSFQEDVNEHNVLLT HNDCTLSDFLVSLDLLEIHQKIDWNVNWDEISLLLFEHRANVNP HERSSLTCISPVVSSEELYESSSRSTPTNEVIFKRRLQSFDQSIQFSPNISNFSATLGPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPLIKSLLLDIDIILQPNITKLYDIL EVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHP
Sbjct:   11 TISNQQPNYLPXDEQEESNEHSVSNLLXQALNSAKMYKLNFFNFDSQIKEVQDSEGCMEIFENPEIDPSFINDFSFQEDVNEHNVLLTIHNDCTLSDFLVSLDLLEIHQKIDWNVNWDEISLLLFEHRANVNPDHERSSLTCISPVVSSEELYESSSRSTPTNEVIFKRRLQSFDQSIQFSPNISNFSATLGPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPLIKSLLLDIDIILQPNITKLYDILTEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHP 300          
BLAST of FTS and Hook-interacting protein vs. TrEMBL
Match: A0A210R0F1 (FTS and Hook-interacting protein-like OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12510 PE=4 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 8.549e-64
Identity = 188/594 (31.65%), Postives = 298/594 (50.17%), Query Frame = 2
Query:   74 CLDVFIDHWQQVLYFI-----NNIDD------LNSLETIFKHIDVMVSIIIKE--CDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRS-SVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHED-----RPTFKCPPTXXXXXXXXXXXXXXAEQFLKL-------SLGIYSEDQNILPTFPMSNKKLDSITLEQRRASQS---PVVI--------NNLQRFSLYCPFHSYLHSAALFVNRRILASHGWQFSYDGINPSTKIFEEIN 1744
            CL+VF +HW Q    I     NNI         + +E + K+ + M++++  E   DE        IL Y  + N+F++ F  + Q   + +  E   + QLRM++ LI       L+   +I  +L LL  C   + S  IE   V +L+Q+   I+    + E     + ++    F    L+I  IHR+  IG+ S+++LLLI   +  +   + ++I   SDF  +L TGLSGLYSS PRK+    +DW QIT+  I  VP ++  L  L+FCN  +++ H+ I   +++F+Y GFL PV+GP+LHQ    L   L  +    NS EE I+ATAYLEL+LR +  P + + FL+FILTE+ +  ++L+SL+ R+NS T         L V++LSLF+T++  + EDV+F L+ RYLIPC H      V +S   +V+D+  Y    +     RP    P      +    N S +AE+ + L       +L   S  +  L +F  + K+       +RRA+ S   P  +        + L+ F     ++ YL  A   +     A   W + YDG  PS  +F +++
Sbjct:   37 CLEVFKNHWTQAQIIITAKESNNIGKNHEPCTYDDVEAVVKNFEQMINLLASEDGLDENGQGMPGPILHYLLEQNVFES-FCTWCQN--QPEYTEKLKMEQLRMFEVLIGQSRQLLLIHKAVINPILRLLSSCVQDTHSRGIESRLVLILHQICASISQQTVILESFFNANADQGPAKFLIFSLLIPFIHREGTIGQQSRDSLLLIMTLSS-KHPHIGEFIEKYSDFCPVLATGLSGLYSSLPRKIPVAAEDWFQITQDDINQVPGIQMFLNSLEFCNAVVQISHSSISEQLIEFIYKGFLVPVMGPALHQDVSGLPLPLLDSPMFANSREEVIAATAYLELFLRKITEPALTRAFLKFILTEQNDEIVILESLVTRINSSTK-------LLCVVSLSLFKTLIDKNCEDVIFQLILRYLIPCTH------VMVSQRRAVKDVDLYGKSAEKFLSLRPNCCVP--DPSESPKASNSSPTAERCVGLGIASPTPALPPASRPKRGLGSFLRARKQEQEYQRTRRRAATSMETPKTVLSQANPKGSKLEHFE--TDYNDYLLEARKALGNTSRACKTWVYPYDGDMPSPTVFTDLD 609          

HSP 2 Score: 74.3294 bits (181), Expect = 1.669e-9
Identity = 64/244 (26.23%), Postives = 120/244 (49.18%), Query Frame = 2
Query: 2483 SNFSATLGPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHPDGNGEMNQNFE---DEFEIRLSTTSSGAVNNSFFDFDXXXXXXXXXXXXKNKEKRT------RKTAFGLLK--RKKKDNIPQYRF-PIQKFCYSKKK------PISDYEAQRIRNLAYNWILFDEFCKELASLCQEHT 3160
            ++ S ++GPFLS++F +L  +  N   +NL++TG+I  LAAYPQPL++S LL+ +++ QP +  L  +L  V+  +   S  + ++E +L+ A + L +R E      N ++ +N+           +T  +  +NN                  K K+K +      R++  G  +     +   PQ    P + + Y  ++      P +  ++ + RN+ Y  ++ +EF KEL+S  QEH+
Sbjct:  922 TDTSPSIGPFLSSLFSKLEGMMQNNLSINLVLTGVIARLAAYPQPLLRSFLLNHNLVFQPTVKSLVQVLTSVRQKVDNYSYTLPNFEDLLLQARKNLATREE------NWKLGRNYSFLPQNVSTTPTTPKTSPINNVNIQI-------------KEKKKLSLTDLLFRRSPVGTKRPIAAPRRGAPQMEMVPGRGYRYVHRQKLPEPVPSNPMDSSKTRNIVYCALILEEFVKELSSFSQEHS 1146          
BLAST of FTS and Hook-interacting protein vs. TrEMBL
Match: A0A1S3HN84 (FTS and Hook-interacting protein isoform X1 OS=Lingula unguis OX=7574 GN=LOC106156695 PE=4 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 2.367e-62
Identity = 151/449 (33.63%), Postives = 248/449 (55.23%), Query Frame = 2
Query:   77 LDVFIDHWQQVLYFINNIDDLNSLETIFKHIDV-------MVSIIIKECDEEETHSLEDILEYCSQNNIFKTIFDHFIQE-NLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQ----VGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDR 1387
            L+V+  HWQQ+L  I   +   + + I   I+        M+ ++I+E  +EE      IL +    N+ + +F+   Q    R ++K      QL+MY+ LI+      L+   +I  ++ LL  CS   ++ IE   V LL+QL V ++ D QL E        +    F    L+I  +HR+ ++G+ +++ALLLI + +   + ++  ++   SDF  +L TGLSGLYSS PRKL+    DW Q+TR     +P+L   L  L+FCN   ++ H  ++  +L F+Y GFL PV+GP+LHQ    +   +++ LF      NS++E I+ATAYL+L+LR +  P +++ FL+FILTE  +   +L+SLI R++S +         L V++L LF+T+L  + EDV++ LVF+YL+PC H      V +S   +V D+  Y+   ++
Sbjct:   35 LEVYERHWQQILAIIQTTNAARTAQNIADDIEAVLHYFSQMMFLLIEE--KEEDGCQGPILRFTLTENLLEVLFNWCNQSVEFRHKLK----FEQLKMYEQLISQARQRLLVHKPIIRPLMKLLSSCSETKNIHIEQHEVLLLHQLCVCLSQDPQLLELFFSAHEVQGSAKFLVFSLLIPYVHREANLGQQARDALLLIMSLSA-VNEEIGKHVAEHSDFCPVLATGLSGLYSSLPRKLEIPTSDWYQLTREDWLQIPDLGMFLNSLEFCNAVAQVAHPMVRDQLLSFIYNGFLVPVLGPALHQDISGLPMSILEKLFV-----NSMDEVIAATAYLDLFLRRITEPALMRTFLKFILTEHHDEINILESLITRISSNS--------KLCVVSLGLFKTLLDLNCEDVMYQLVFKYLVPCTH------VMVSQRKAVGDVDLYSKAAEK 457          
BLAST of FTS and Hook-interacting protein vs. TrEMBL
Match: A0A1S3HPP9 (FTS and Hook-interacting protein isoform X2 OS=Lingula unguis OX=7574 GN=LOC106156695 PE=4 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 2.812e-62
Identity = 151/449 (33.63%), Postives = 248/449 (55.23%), Query Frame = 2
Query:   77 LDVFIDHWQQVLYFINNIDDLNSLETIFKHIDV-------MVSIIIKECDEEETHSLEDILEYCSQNNIFKTIFDHFIQE-NLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQ----VGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDR 1387
            L+V+  HWQQ+L  I   +   + + I   I+        M+ ++I+E  +EE      IL +    N+ + +F+   Q    R ++K      QL+MY+ LI+      L+   +I  ++ LL  CS   ++ IE   V LL+QL V ++ D QL E        +    F    L+I  +HR+ ++G+ +++ALLLI + +   + ++  ++   SDF  +L TGLSGLYSS PRKL+    DW Q+TR     +P+L   L  L+FCN   ++ H  ++  +L F+Y GFL PV+GP+LHQ    +   +++ LF      NS++E I+ATAYL+L+LR +  P +++ FL+FILTE  +   +L+SLI R++S +         L V++L LF+T+L  + EDV++ LVF+YL+PC H      V +S   +V D+  Y+   ++
Sbjct:   35 LEVYERHWQQILAIIQTTNAARTAQNIADDIEAVLHYFSQMMFLLIEE--KEEDGCQGPILRFTLTENLLEVLFNWCNQSVEFRHKLK----FEQLKMYEQLISQARQRLLVHKPIIRPLMKLLSSCSETKNIHIEQHEVLLLHQLCVCLSQDPQLLELFFSAHEVQGSAKFLVFSLLIPYVHREANLGQQARDALLLIMSLSA-VNEEIGKHVAEHSDFCPVLATGLSGLYSSLPRKLEIPTSDWYQLTREDWLQIPDLGMFLNSLEFCNAVAQVAHPMVRDQLLSFIYNGFLVPVLGPALHQDISGLPMSILEKLFV-----NSMDEVIAATAYLDLFLRRITEPALMRTFLKFILTEHHDEINILESLITRISSNS--------KLCVVSLGLFKTLLDLNCEDVMYQLVFKYLVPCTH------VMVSQRKAVGDVDLYSKAAEK 457          
BLAST of FTS and Hook-interacting protein vs. TrEMBL
Match: A0A1I8GRG5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 1.471e-61
Identity = 167/569 (29.35%), Postives = 275/569 (48.33%), Query Frame = 2
Query:   77 LDVFIDHWQQVLYFINNIDDL----NSLETIFKHIDVMVSIIIKE--------CDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEEC-SLRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRL---NSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDRPTFKCPPTXXXXXXXXXXXXXXAEQFLKLSLGIYSEDQNILPTFPMSNKKLDSITLEQRRASQSPVVINNLQRFSLYCPFHSYLHSAALFVNRRILASHGWQFSYDGINPSTKIFE 1735
            L+VF +HW QV   ++         + +E +  ++D M+S++I+E                   IL    +  +F  +          G+  E   + QL+ Y+ LI     + + R  ++  +L L++ C S  SS  +E   V +L+QL V++     L +   E+   E    F    L++  +HR+  IG+ +++ALLL+   +   + ++  +I + SDF  +L TGLSGLYSS PR+L    DDW Q+T      +P+L   L  LDFCN+ +++ H  ++  +L F+Y+GFL PV+G +LH                Q+S++E  +ATAYLEL+LR +  P ++K+ ++F+L +  ++Y +L+SLI R+   NS+          LGV+T+SLFRT+L+ H EDV + L++RYLIPC HL+      LS    + D   YA                          +A++F  L      +D         + ++  S   ++ RA +S              P   YL  AA  +  R +AS  W F YDG++P   +FE
Sbjct:   60 LEVFENHWDQVRQVMDATQGRAITGDDVEPVVHYVDQMLSLLIEERPPAAAAGEAASAGQQPGQILACAERERVFDLLL--AWSNRATGECLERLKLEQLKQYELLIGQCRQSVVGRVQILRPLLRLVKSCCSAGSSRAVESRVVLILHQLCVVLNRSPNLLDTCLEVGRAEAGSQFLVFSLLVPYVHREASIGQHARDALLLVMALSA-RNQEVGRFIAFSSDFCPVLATGLSGLYSSLPRRLPVDSDDWCQLTPADWQRIPDLAQFLNSLDFCNVVVELAHPLVRDQLLHFIYSGFLKPVLGAALH----------------QSSMDEVTAATAYLELFLRRVTEPALLKVLVRFVLLDYYDDYNILESLIGRIKFSNSL----------LGVVTMSLFRTLLNLHIEDVHYQLLYRYLIPCQHLM------LSQRRCLRDNEPYAR-------------------------AADKFASLVPSCCVQD---------TGEEAISPAADRLRAYES--------------PHAEYLRDAAERIVERTVASRRWAFRYDGVDPPIDVFE 545          
BLAST of FTS and Hook-interacting protein vs. Ensembl Cavefish
Match: fam160a1a (family with sequence similarity 160 member A1a [Source:ZFIN;Acc:ZDB-GENE-090312-132])

HSP 1 Score: 212.231 bits (539), Expect = 5.338e-56
Identity = 133/463 (28.73%), Postives = 236/463 (50.97%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFINNIDDLNS--------------LETIFKHIDVMVSIIIKECDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDRPTFKCPP 1408
            + + C+ VF +HW QV+  +   D L S                 +  +++ M+ ++++E +  ++ ++  ILE+    N+ + +F   ++      +K    ++QL+MY+ LI       L    ++  ++ LL  CS   +     L V LL QL  ++  D  + E     S ++    F    L+I  IHR+  +G+ +++ALLLI   +  E+  +  +I   + F  +L TGLSGLYSS P KLD   +DW  + R     VP L   L  L+FCN  +++ H  I+  ++ ++  GFL PV+ P+LH++                ++EE ++ TAYL+L+LR +  P ++  FL FIL  R +N  +LD+L++R+N+         + LG ++L+LFRT++  + EDV+  L+ +YLIPC+H++      LS    +++  CY+    +     PP
Sbjct:   22 DPETCMIVFKNHWAQVVKILEKHDPLRSGLGGLRLGQVPGDEASAVQNYVEHMLFLLMEE-ESGQSGAMGPILEFVVMENVMERLFIWSLRREFTDDMK----LDQLKMYEMLIGQARQPLLHHKPILRPLMMLLSSCS--GTAGTAEL-VLLLNQLCCVLAKDPSILELFFHTSEDQGAANFLIFSLLIPFIHREGAVGQQARDALLLIMALSA-ENHVVAKHIAENTYFCPVLATGLSGLYSSLPTKLDVPSEDWHSLNREDWQQVPALVQFLNSLEFCNAVMQVAHPSIRDQLVGYICNGFLVPVLAPALHKL----------------TIEEAMTTTAYLDLFLRSVTEPALLHTFLSFILLHRHDNVHILDTLVSRINTP--------FQLGTVSLALFRTLIGLYCEDVMLQLILKYLIPCNHMM------LSQRRVLKERDCYSVSAAKILIIPPP 445          

HSP 2 Score: 67.3958 bits (163), Expect = 9.545e-11
Identity = 47/130 (36.15%), Postives = 75/130 (57.69%), Query Frame = 2
Query: 2408 TPTNEVI-----FKRRLQSFDQSIQFSPNISNFSATLGPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSR 2782
            TP +E I      K R  S + SI F+          GPF+S +  RL  +  N+  +NLL+TGI+  LAAYPQPL++S LL+ +++ QP++  LY +LA +KN + + ++   D+  +L  A + L +R
Sbjct:  760 TPDSEKIPSPFGTKPRSASRNHSIPFT----------GPFVSVLLSRLENMLENSLHVNLLLTGILAQLAAYPQPLLRSFLLNTNMVFQPSVRSLYQVLASLKNQIEQLAASKKDFPELLTAAQQCLLAR 879          
BLAST of FTS and Hook-interacting protein vs. Ensembl Cavefish
Match: fam160a2 (FTS and Hook-interacting protein homolog [Source:NCBI gene;Acc:103037720])

HSP 1 Score: 202.986 bits (515), Expect = 1.411e-52
Identity = 135/453 (29.80%), Postives = 232/453 (51.21%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFINNID----DLNSLETIFKHIDVMVSIIIKE---CDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEEC---SLRSSVKIEHLSVHLLYQLTVLITSDVQLFEFI-KEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDR 1387
            + + CL VF +HW+QV + +   D      + L  +  H D M+ ++ +E     + +  ++  IL+  S  NI     +  +Q ++R  +     +  L++++ LI       L  ++++  +L LL  C          +E   V LL Q+ V +     + E + +  +  +         L++  IHRD  +G+ +++ALLL+   T   +  +  YI   S F  +L TGLS LYSS PRK++   DDW  + R     VP L   +  L+FCN  +++ H  ++  +LD+L+ GFL PV+GP+LH                ++S++E I++TAYL+L+LR +    ++K FL+FIL  R +N  +LD+L+ R++S +         L +++LSLF+T+LSF+ ED++  LV RYL+PC H      V LS   +V +   Y    D+
Sbjct:   29 DPETCLMVFENHWRQVSWVLEQRDSGAGGADDLTAVRNHTDQMLCLLAEERPAGGDSDPPAMGPILQLVSSENIL----ERLVQWHIRRGLDPDSQMALLKLFEMLIGQSHQPLLQHTSVLQPLLMLLGACVDPQFGCPSNLEASLVLLLNQVCVSMARQPAVLELLFRCGAVQQGPTNLLIFSLLVPFIHRDGVLGQQARDALLLVMA-TSASNHAVGRYITENSYFCPVLATGLSALYSSLPRKIEVRGDDWHALRREDWMGVPSLVLFMNSLEFCNAVVQITHPLVRCQLLDYLHNGFLVPVMGPALH----------------KSSVDEMIASTAYLDLFLRSITEKSLLKTFLRFILLHRHDNDTILDTLLTRISSNSR--------LCMVSLSLFKTLLSFNCEDLMLQLVLRYLLPCTH------VMLSQRRAVRETDLYGKSADK 446          

HSP 2 Score: 64.3142 bits (155), Expect = 7.787e-10
Identity = 39/102 (38.24%), Postives = 68/102 (66.67%), Query Frame = 2
Query: 2501 LGPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIH-DWESILVNAYEYLYSRIELTHPD 2803
            +GPF++ +F +L ++  N+ ++N+L+TGI+  LA YPQPL++S LL+ +++ QP++  L  +L  VKN  IE  + +H D+ S+L  A  +L +R +L   D
Sbjct:  930 IGPFMTVLFSKLESMMQNSLYVNILLTGIVFQLACYPQPLLRSFLLNTNMVFQPSVKSLIQVLGTVKNR-IEAFAAVHEDFPSMLRKARRFLAARGKLDWAD 1030          
BLAST of FTS and Hook-interacting protein vs. Ensembl Cavefish
Match: fam160a1b (family with sequence similarity 160 member A1b [Source:ZFIN;Acc:ZDB-GENE-110411-10])

HSP 1 Score: 199.134 bits (505), Expect = 6.896e-52
Identity = 130/461 (28.20%), Postives = 225/461 (48.81%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFINNIDDLNS------------------LETIFKHIDVMVSIIIKECDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSL-------------RSSV------KIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQL 1333
            + + C+ VF +HW QVL  +   D   S                     +  +++ M+ ++++E +     ++  ILE+    N+ + +F   ++      +K    + QLRMY+ L+       L    ++  ++ +L  CS              RSS        +E   V LL+QL +++  D  + E     S ++    F    L++  +HRD  +G  +++AL LI   +   ++ + ++I   + F  +L TGLSGLYS  P KL+   + W  + R     VP L   L  L FC+   K+ H  I+  +L ++Y GFL PV+ P+LH++                +LEE ++ TAYLEL+LR +  P +++ FL FIL  R +N  +LD+L++R+N+         + LG ++L+LFRT++  + EDV+  L+ RYLIPC HL+  +  +L
Sbjct:   20 DPETCMIVFKNHWAQVLRILEKHDPARSNGGAGLPPCRLGPIPGDEASAVQNYVEHMLFLLMEE-ESGTGGAMGPILEFVVVENVMEKLFLWSLRREFTDDMK----LEQLRMYEMLVAQSRQPLLHHKPILKPLMMVLSACSGPCALGPSCALGPSRSSAMGPAGPAVEVELVRLLHQLCLVLARDASVLELFFHSSQDQGAANFLLFSLLVPFVHRDGPVGVQARDALTLIMALSA-RNAVVANHIAQNTYFCPVLATGLSGLYSWLPAKLEVYSEGWHCLERADWMQVPALVQFLNSLHFCSTVCKVAHPSIRDQLLGYIYNGFLVPVMAPALHKL----------------TLEEVMTTTAYLELFLRSISDPALLQTFLIFILRHRHDNVNILDTLVSRINT--------PFQLGTVSLALFRTLIGLYCEDVMLQLILRYLIPCTHLLSSERRKL 450          

HSP 2 Score: 54.6842 bits (130), Expect = 6.680e-7
Identity = 30/90 (33.33%), Postives = 52/90 (57.78%), Query Frame = 2
Query: 2504 GPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYL 2773
            GPF+S +  RL  +  N+  +NLL+TGI+  +A+YPQPL++  LL      QP++  LY +L  V   + +  +   ++  ++  A +YL
Sbjct:  764 GPFISVLLSRLENMLENSVEVNLLVTGILAQMASYPQPLLRCFLLSTRPAFQPSVRSLYQVLVSVGCQIEQYVASRPEFAQMVREAAQYL 853          
BLAST of FTS and Hook-interacting protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010108.1 (pep scaffold:Pmarinus_7.0:GL484264:401:12279:-1 gene:ENSPMAG00000009146.1 transcript:ENSPMAT00000010108.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 187.578 bits (475), Expect = 1.344e-49
Identity = 119/368 (32.34%), Postives = 194/368 (52.72%), Query Frame = 2
Query:  335 QLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFY-----------------FIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDR 1387
            QL+MY+ L++      L    ++  +L L+  C+   S K+E   V LL QL  ++  D    E +     N+   P                      L++  +HR+  +G+ +++ALLLI + T  E+  L +YI  RSDF  +L TGLSGLYSS PRK++   D+W  + R     VP L   +  L+FCN  +++ H  ++  ++ ++Y GFL PV+GP+L                 +  +EE I++TAYL+L+LR +  P +++ FL F+L   +++  VLD L+ R++S +         L +++L+LFRT+LS + EDV+  LV R+LIPC+H      V LS   +V+++  Y    DR
Sbjct:   20 QLKMYEVLVSQSHQPLLHHKPILHPLLGLMAACANSRSPKVETNLVLLLSQLCSVLVKDPATLELV----FNDRPSPLAPSGGAGAAGFAPRNDALVFALLVGYVHREGSLGQQARDALLLIMSLTA-ENRSLGEYIADRSDFCPVLATGLSGLYSSLPRKIEVNSDEWHSLRREDWLGVPALVRFMNSLEFCNAVVQVAHEVVRNQLIKYIYHGFLIPVMGPALD----------------KTLVEEQIASTAYLDLFLRMVTEPSLLRTFLHFVLLHSEDDKRVLDMLVARISSSS--------RLCMVSLALFRTLLSLNCEDVMLQLVLRFLIPCNH------VMLSQRRAVKEVDLYGRTADR 352          
BLAST of FTS and Hook-interacting protein vs. Ensembl Nematostella
Match: EDO40782 (UPF0518 protein v1g243165 [Source:UniProtKB/Swiss-Prot;Acc:A7S6A1])

HSP 1 Score: 162.155 bits (409), Expect = 1.126e-40
Identity = 117/419 (27.92%), Postives = 208/419 (49.64%), Query Frame = 2
Query:   95 HW---QQVLYF-INNIDDLNSLETIFKHIDVMVSIIIKECDEEETHSLEDILEYCSQNNIFKTIF----DHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEEC-SLRSSVKIEHLSVHLLYQLTVLITSDVQLFE-FIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQK 1321
            HW   QQ++      +      + +  H++ +VS++ +E +E     L+ +L+     NIF+ +F      ++ E ++ +        Q++++ NLI       L+   +   +L LL  C S +    +E   V +L  L V    D+ L + F  E   +     F    L+I  +HR+ D+G  +++A+LL    +   D+ L  YI   ++F  IL  GLSGL+S  P  LD   +DW  + R    T PEL   L  L+FCN  +++ H K++  +L+ +Y GFL  V+  +L                 Q+S+E   + TAYL+L++R +    ++++F++F+L E+ +   +LDSL+ R+   +         L V++L L  T+L  + ED+L+ LV +YLIPC H++  +
Sbjct:   43 HWNSSQQIMGLDSKTVGPQERCKILMYHLNEIVSVLAEEKEECPGPCLKYVLD----ENIFEIVFMWGTSSYVNELMKRE--------QIKVFRNLIERSKAPILIYEQVWKPLLCLLHSCASTKLPSDMEEDYVAVLKGLCVSANRDIVLLDLFFLENHNHSEISGFSVFSLLIPYVHREGDLGVWARDAMLLSMALSSI-DARLGSYIVEETNFCPILAIGLSGLFSDLPTSLDIPSEDWYSLERGLWATFPELVAFLTSLEFCNNVIQIAHHKVQHMLLELIYHGFLVSVMSSAL----------------TQSSVEALTAVTAYLDLFVRSITDSKLMQVFVKFLLVEKSDGVPILDSLVARIGQESQ--------LAVVSLGLIHTLLDLNCEDILYTLVLKYLIPCTHILSSQ 424          

HSP 2 Score: 60.8474 bits (146), Expect = 2.824e-9
Identity = 50/159 (31.45%), Postives = 85/159 (53.46%), Query Frame = 2
Query: 2267 WNVNWDEISLLLFEHRANVNPGHERSSLTCISPVVXXXXXXXXXXXXTPTNEVIFKRRLQSFDQSIQFSPNISNFSATLGPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVK---NNLIEKSSDIH 2734
            W++ +D   L   +     NP ++R SL   +  +       SS+ +   ++   KR L S D  +       +    LGPFLS +F++L  +  NT ++NL++T +IT L  YPQPL+KS LL+ +I+L+P +  L+ IL+ +K    N++E    +H
Sbjct:  529 WSMQYDGTDLSSTDDATENNPANKRRSLVLANGSIPRSASEVSSTLAVKASDKT-KRSLSSNDLCL------PSAEEGLGPFLSTLFRKLENMAQNTFYVNLILTAVITRLCYYPQPLLKSFLLNYNIVLKPGVRSLFQILSSIKIKVENVVESVEGLH 680          
BLAST of FTS and Hook-interacting protein vs. Ensembl Medaka
Match: fam160a1a (family with sequence similarity 160 member A1 [Source:NCBI gene;Acc:101154841])

HSP 1 Score: 219.164 bits (557), Expect = 4.367e-58
Identity = 129/432 (29.86%), Postives = 229/432 (53.01%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFINNIDDLNSLETIFK--------------HIDVMVSIIIKE-CDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLI 1312
            + + C+ VF +HW QV+  +   D L S  T+ +              +++ M+ ++++E C E    ++  ILE+    N+ + +F   ++      +K    + QL+MY+ L+       L    ++  ++ LL  CS  ++  +E   V LL QL  ++  D  + E     S ++    F    L+I  IHR   +G+ +++ALLLI + +  E+  +  +I   + F  +L TGLSGLYSS P KL+   ++W  + +     +P L   L  L+FCN  +++ H  I+  +LD++Y GFL PV+ P+LH++                +LEE ++ TAYL+L+LR +  P +++ FL FIL  + E   +LD+L++R+N+         + LG+++LS FRT++  + EDV+  L+ RYLIPC+H++
Sbjct:   21 DPETCMIVFKNHWAQVVKILEKHDPLRSSSTLSRFGAIPGDEASAVQNYVEHMLFLLMEEECGE--AGAMGPILEFVVMENVMERLFVWSLRREFTDDMK----LEQLKMYEMLVGQARQPLLHHKPILRPLMMLLSSCSTTTAPAVEAELVLLLNQLCCVLAKDPSILELFFHTSEDQGATNFLIFSLLIPFIHRKGTVGQQARDALLLIMSLSS-ENERVAKHIAENTYFCPVLATGLSGLYSSLPTKLEVPSEEWHCLHKEDWLQMPSLVQFLNSLEFCNAVIQVAHPSIRDQLLDYIYNGFLVPVLAPALHKL----------------TLEEVMTTTAYLDLFLRSVSEPALLQTFLSFILLHQHEAVHILDTLVSRVNTP--------FQLGLVSLSFFRTLIGLYCEDVMLQLILRYLIPCNHMM 421          

HSP 2 Score: 68.9366 bits (167), Expect = 2.634e-11
Identity = 38/93 (40.86%), Postives = 62/93 (66.67%), Query Frame = 2
Query: 2504 GPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSR 2782
            GPF+S +  RL  + +N   +NLL+TGI+  LAAYPQPL++S LL+ +++ QP +  LY +LA VKN + E+++   D+  ++  A  +L +R
Sbjct:  803 GPFISVLLSRLENMLSNPLHVNLLLTGILAQLAAYPQPLLRSFLLNTNLVFQPTVRSLYQVLATVKNQIEEEAARRKDFTELITAAQHWLLAR 895          
BLAST of FTS and Hook-interacting protein vs. Ensembl Medaka
Match: ENSORLT00000003880.2 (protein FAM160A1 [Source:NCBI gene;Acc:101175601])

HSP 1 Score: 201.83 bits (512), Expect = 2.819e-52
Identity = 136/473 (28.75%), Postives = 226/473 (47.78%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFINN--------------------------------IDDLNSLETIFKHIDVMVSIIIKECDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECS---LRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYAN 1375
            + + C+ VF +HW QV   +                                   D+ ++++   +H   M+ ++++E +     ++  ILE      + + + +     +LR Q  E   + QLRMY  L++      L    ++  ++ LL  C+     S   +E   V LL QL   +  D  + E     S ++    F    L+I  IHR   +G  ++EALLLI + +  E   +  +I   + F  +L TGLSGLYSS P +L    +DW  +       VP L H L  LDFC+   K+ H  I+  +L ++Y GFL PV+ P+LH++                ++EE ++ TAYL+L+LR +  P +++ FL FIL    +N  +LD+LI+R+N+         + LG ++L+LFRT++    EDV+  LVFRYLIPC HL +++        S++   CY++
Sbjct:   21 DPETCMIVFRNHWAQVARILEKHEPSRCSSGAFSFLSGHHGGGGSGAPRLGPIPADEASAVQNYVEH---MLFLLMEE-EAGRGGAMGPILELV----VLEGVMERLFLWSLRRQFTEDMKLEQLRMYQMLLSQAKQPLLHHKPVLRPLMMLLASCAGAAADSGSVVEAELVLLLNQLCAALVKDPSVLELFFHSSEDQGAANFLLFSLLIPYIHRQGLVGHQAREALLLIMSLSASEQR-VAQHIADNTYFCPVLATGLSGLYSSLPTRLQVYSEDWHCLDPADWQQVPALVHFLHSLDFCSAVTKVAHPSIRSQLLGYIYDGFLVPVLAPALHKL----------------TVEEVMTTTAYLDLFLRSISEPALLQTFLSFILLHTHDNVYILDTLISRVNTP--------FQLGTVSLALFRTLIGLFCEDVMLQLVFRYLIPCSHLSRRQ------RRSLKQKDCYSS 454          

HSP 2 Score: 52.7582 bits (125), Expect = 2.682e-6
Identity = 31/93 (33.33%), Postives = 54/93 (58.06%), Query Frame = 2
Query: 2504 GPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSR 2782
            GPF+S +  RL  L  N+  +NLL+TGI+  L +YPQPL++S LL  +   Q ++  L+ +L  V   +     D  D+ +++  A+ +L ++
Sbjct:  947 GPFISVLLSRLENLLENSISVNLLLTGILVQLVSYPQPLLRSFLLSTEPHSQLSVRTLHQVLVSVHAQIERYVEDRPDYPALVTQAWRFLLAK 1039          
BLAST of FTS and Hook-interacting protein vs. Ensembl Medaka
Match: fam160a2 (FTS and Hook-interacting protein homolog [Source:NCBI gene;Acc:101162166])

HSP 1 Score: 197.978 bits (502), Expect = 4.260e-51
Identity = 139/455 (30.55%), Postives = 232/455 (50.99%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFINNIDDLNS---LETIFKHIDVMVSIIIKECDEEETH------SLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECS---LRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFI-GLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDR 1387
            + + CL VF +HW+QV + ++  +  +S   L  +  + D M+ ++ +E   E +       S+  ILE      I + I +  +Q +L   +        L++++ LI       L  + ++  +L LL  C+   L   + +E+  V LL Q+ V +     + E +   S  +       I  L++  IHRD  IG+ +++ALLL+   +    +    YI   S F  +L TGLS LYSS PRK++   DDW  + R     V  L   +  L+FCN  +++ H  +   +LD+L+ GFL PV+GP+LH                ++S++E I++TAYL+L+LR +    ++K FL+FIL  R +N  +LD+L+ R++S +         L +++LSLFRT+LS + EDV+  LVFRYL+PC H      V LS   ++ +   Y    D+
Sbjct:   29 DPETCLMVFKNHWRQVSWVLDQRESSSSSDDLTAVRNNTDQMLCLLAEERPAESSEGGFGVASMGPILELV----ITENILERLVQWHLCRGLDPDSQGALLKLFEMLIGQSQQPLLQHTAVLHPLLRLLGACADPELGCPLALENSLVLLLNQVCVSMARQPVILELLFRASPAQQGSTNLLIFSLLVPFIHRDGAIGQQARDALLLVMAASASHKA-AARYIAENSYFCPVLATGLSALYSSLPRKIEVRGDDWHALRREDWMGVSSLVLFMNSLEFCNAVVQVAHPTVSSQLLDYLHNGFLVPVMGPALH----------------KSSVDEMIASTAYLDLFLRSITETSLLKTFLRFILLHRHDNDTILDTLLIRISSNS--------RLCMVSLSLFRTLLSLNCEDVMLQLVFRYLLPCTH------VMLSQRRAIRETDMYGKCADK 448          

HSP 2 Score: 71.2478 bits (173), Expect = 6.490e-12
Identity = 61/223 (27.35%), Postives = 99/223 (44.39%), Query Frame = 2
Query: 2504 GPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHPDGNGEMNQNFEDEFEIRLSTTSSGAVNNSFFDFDXXXXXXXXXXXXKNKEKRTRKTAFGLLKRKKKDN----IPQYRFPIQKFCYSKKKPISDYEAQRIRNLAYNWILFDEFCKELASLCQEHT 3160
            GPF+  +F +L  +  N+ ++N+L+TGI+  LA YPQPL++S LL+ +++ QP++  L  +L  VKN +   ++   D+  +L  A +YL +R +L   D    +      E  ++    S G +                     N   R R  A   L   +          +R                 EA R++N  Y  ++F EF KELA+L QEH 
Sbjct:  923 GPFMVVLFAKLENMLQNSLYVNILLTGIVAQLACYPQPLLRSFLLNTNMVFQPSVKSLIQVLGSVKNRIEAFAASHEDFPVMLRKAQQYLVARGKLDWTDLPAAVPTLRRSESLVKSRKPSLGDL----------------ILRHTNSPTRARNAAQLALAHVRDGGQSLHSALFRGGGGSGGGGASGLEKQAEALRVKNAVYCTVIFCEFLKELAALAQEHA 1129          
BLAST of FTS and Hook-interacting protein vs. Ensembl Medaka
Match: fam160a2 (FTS and Hook-interacting protein homolog [Source:NCBI gene;Acc:101162166])

HSP 1 Score: 197.593 bits (501), Expect = 5.256e-51
Identity = 139/455 (30.55%), Postives = 232/455 (50.99%), Query Frame = 2
Query:   62 NSKICLDVFIDHWQQVLYFINNIDDLNS---LETIFKHIDVMVSIIIKECDEEETH------SLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECS---LRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFI-GLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDR 1387
            + + CL VF +HW+QV + ++  +  +S   L  +  + D M+ ++ +E   E +       S+  ILE      I + I +  +Q +L   +        L++++ LI       L  + ++  +L LL  C+   L   + +E+  V LL Q+ V +     + E +   S  +       I  L++  IHRD  IG+ +++ALLL+   +    +    YI   S F  +L TGLS LYSS PRK++   DDW  + R     V  L   +  L+FCN  +++ H  +   +LD+L+ GFL PV+GP+LH                ++S++E I++TAYL+L+LR +    ++K FL+FIL  R +N  +LD+L+ R++S +         L +++LSLFRT+LS + EDV+  LVFRYL+PC H      V LS   ++ +   Y    D+
Sbjct:   29 DPETCLMVFKNHWRQVSWVLDQRESSSSSDDLTAVRNNTDQMLCLLAEERPAESSEGGFGVASMGPILELV----ITENILERLVQWHLCRGLDPDSQGALLKLFEMLIGQSQQPLLQHTAVLHPLLRLLGACADPELGCPLALENSLVLLLNQVCVSMARQPVILELLFRASPAQQGSTNLLIFSLLVPFIHRDGAIGQQARDALLLVMAASASHKA-AARYIAENSYFCPVLATGLSALYSSLPRKIEVRGDDWHALRREDWMGVSSLVLFMNSLEFCNAVVQVAHPTVSSQLLDYLHNGFLVPVMGPALH----------------KSSVDEMIASTAYLDLFLRSITETSLLKTFLRFILLHRHDNDTILDTLLIRISSNS--------RLCMVSLSLFRTLLSLNCEDVMLQLVFRYLLPCTH------VMLSQRRAIRETDMYGKCADK 448          

HSP 2 Score: 62.003 bits (149), Expect = 3.804e-9
Identity = 35/96 (36.46%), Postives = 62/96 (64.58%), Query Frame = 2
Query: 2504 GPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIEL 2791
            GPF+  +F +L  +  N+ ++N+L+TGI+  LA YPQPL++S LL+ +++ QP++  L  +L  VKN +   ++   D+  +L  A +YL +R +L
Sbjct:  923 GPFMVVLFAKLENMLQNSLYVNILLTGIVAQLACYPQPLLRSFLLNTNMVFQPSVKSLIQVLGSVKNRIEAFAASHEDFPVMLRKAQQYLVARGKL 1018          
BLAST of FTS and Hook-interacting protein vs. Planmine SMEST
Match: SMESG000025657.1 (SMESG000025657.1)

HSP 1 Score: 1942.93 bits (5032), Expect = 0.000e+0
Identity = 1024/1040 (98.46%), Postives = 1024/1040 (98.46%), Query Frame = 2
Query:   50 MDYNNSKICLDVFIDHWQQVLYFINNIDDLNSLETIFKHIDVMVSIIIKECDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDRPTFKCPPTXXXXXXXXXXXXXXAEQFLKLSLGIYSEDQNILPTFPMSNKKLDSITLEQRRASQSPVVINNLQRFSLYCPFHSYLHSAALFVNRRILASHGWQFSYDGINPSTKIFEEINNSFEQWNQKFQFSHHIKESQETVTELYIESDQRNYPDSPGETHTNIPIRDVXXXXXXXXXXXTISNQQPNYLPPDEQEESNEHSVSNLLCQALNSAKMYKLNFFNFDSQIKEVQDSEGCMEIFENPEIDPSFINDFSFQEDVNEHNVLLTTHNDCTLSDFLVSLDLLEIHQKIDWNVNWDEISLLLFEHRANVNPGHERSSLTCISPVVXXXXXXXXXXXXTPTNEVIFKRRLQSFDQSIQFSPNISNFSATLGPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHPDGNGEMNQNFEDEFEIRLSTTSSGAVNNSFFDFDXXXXXXXXXXXXKNKEKRTRKTAFGLLKRKKKDNIPQYRFPIQKFCYSKKKPISDYEAQRIRNLAYNWILFDEFCKELASLCQEHTQHC 3169
            MDYNNSKICLDVFIDHWQQVLYFINNIDDLNSLETIFKHIDVMVSIIIKECDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQ                NSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDRPTFKCPPTSKISNSINENLSNSAEQFLKLSLGIYSEDQNILPTFPMSNKKLDSITLEQRRASQSPVVINNLQRFSLYCPFHSYLHSAALFVNRRILASHGWQFSYDGINPSTKIFEEINNSFEQWNQKFQFSHHIKESQETVTELYIESDQRNYPDSPGETHTNIPIRDVGYYSSNNGSGSTISNQQPNYLPPDEQEESNEHSVSNLLCQALNSAKMYKLNFFNFDSQIKEVQDSEGCMEIFENPEIDPSFINDFSFQEDVNEHNVLLTTHNDCTLSDFLVSLDLLEIHQKIDWNVNWDEISLLLFEHRANVNPGHERSSLTCISPVVSSEELYESSSRSTPTNEVIFKRRLQSFDQSIQFSPNISNFSATLGPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPLIKSLLLDIDIILQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHPDGNGEMNQNFEDEFEIRLSTTSSGAVNNSFFDFDSLSRRLSQSSPSKNKEKRTRKTAFGLLKRKKKDNIPQYRFPIQKFCYSKKKPISDYEAQRIRNLAYNWILFDEFCKELASLCQEHTQHC
Sbjct:    1 MDYNNSKICLDVFIDHWQQVLYFINNIDDLNSLETIFKHIDVMVSIIIKECDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQ----------------NSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDRPTFKCPPTSKISNSINENLSNSAEQFLKLSLGIYSEDQNILPTFPMSNKKLDSITLEQRRASQSPVVINNLQRFSLYCPFHSYLHSAALFVNRRILASHGWQFSYDGINPSTKIFEEINNSFEQWNQKFQFSHHIKESQETVTELYIESDQRNYPDSPGETHTNIPIRDVGYYSSNNGSGSTISNQQPNYLPPDEQEESNEHSVSNLLCQALNSAKMYKLNFFNFDSQIKEVQDSEGCMEIFENPEIDPSFINDFSFQEDVNEHNVLLTTHNDCTLSDFLVSLDLLEIHQKIDWNVNWDEISLLLFEHRANVNPGHERSSLTCISPVVSSEELYESSSRSTPTNEVIFKRRLQSFDQSIQFSPNISNFSATLGPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPLIKSLLLDIDIILQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHPDGNGEMNQNFEDEFEIRLSTTSSGAVNNSFFDFDSLSRRLSQSSPSKNKEKRTRKTAFGLLKRKKKDNIPQYRFPIQKFCYSKKKPISDYEAQRIRNLAYNWILFDEFCKELASLCQEHTQHC 1024          
BLAST of FTS and Hook-interacting protein vs. Planmine SMEST
Match: SMESG000025657.1 (SMESG000025657.1)

HSP 1 Score: 1919.05 bits (4970), Expect = 0.000e+0
Identity = 1016/1040 (97.69%), Postives = 1016/1040 (97.69%), Query Frame = 2
Query:   50 MDYNNSKICLDVFIDHWQQVLYFINNIDDLNSLETIFKHIDVMVSIIIKECDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDRPTFKCPPTXXXXXXXXXXXXXXAEQFLKLSLGIYSEDQNILPTFPMSNKKLDSITLEQRRASQSPVVINNLQRFSLYCPFHSYLHSAALFVNRRILASHGWQFSYDGINPSTKIFEEINNSFEQWNQKFQFSHHIKESQETVTELYIESDQRNYPDSPGETHTNIPIRDVXXXXXXXXXXXTISNQQPNYLPPDEQEESNEHSVSNLLCQALNSAKMYKLNFFNFDSQIKEVQDSEGCMEIFENPEIDPSFINDFSFQEDVNEHNVLLTTHNDCTLSDFLVSLDLLEIHQKIDWNVNWDEISLLLFEHRANVNPGHERSSLTCISPVVXXXXXXXXXXXXTPTNEVIFKRRLQSFDQSIQFSPNISNFSATLGPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPXXXXXXXXXXXXXQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHPDGNGEMNQNFEDEFEIRLSTTSSGAVNNSFFDFDXXXXXXXXXXXXKNKEKRTRKTAFGLLKRKKKDNIPQYRFPIQKFCYSKKKPISDYEAQRIRNLAYNWILFDEFCKELASLCQEHTQHC 3169
            MDYNNSKICLDVFIDHWQQVLYFINNIDDLNSLETIFKHIDVMVSIIIKECDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQ                NSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITM        LGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDRPTFKCPPTSKISNSINENLSNSAEQFLKLSLGIYSEDQNILPTFPMSNKKLDSITLEQRRASQSPVVINNLQRFSLYCPFHSYLHSAALFVNRRILASHGWQFSYDGINPSTKIFEEINNSFEQWNQKFQFSHHIKESQETVTELYIESDQRNYPDSPGETHTNIPIRDVGYYSSNNGSGSTISNQQPNYLPPDEQEESNEHSVSNLLCQALNSAKMYKLNFFNFDSQIKEVQDSEGCMEIFENPEIDPSFINDFSFQEDVNEHNVLLTTHNDCTLSDFLVSLDLLEIHQKIDWNVNWDEISLLLFEHRANVNPGHERSSLTCISPVVSSEELYESSSRSTPTNEVIFKRRLQSFDQSIQFSPNISNFSATLGPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPLIKSLLLDIDIILQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHPDGNGEMNQNFEDEFEIRLSTTSSGAVNNSFFDFDSLSRRLSQSSPSKNKEKRTRKTAFGLLKRKKKDNIPQYRFPIQKFCYSKKKPISDYEAQRIRNLAYNWILFDEFCKELASLCQEHTQHC
Sbjct:    1 MDYNNSKICLDVFIDHWQQVLYFINNIDDLNSLETIFKHIDVMVSIIIKECDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQ----------------NSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSITM--------LGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDRPTFKCPPTSKISNSINENLSNSAEQFLKLSLGIYSEDQNILPTFPMSNKKLDSITLEQRRASQSPVVINNLQRFSLYCPFHSYLHSAALFVNRRILASHGWQFSYDGINPSTKIFEEINNSFEQWNQKFQFSHHIKESQETVTELYIESDQRNYPDSPGETHTNIPIRDVGYYSSNNGSGSTISNQQPNYLPPDEQEESNEHSVSNLLCQALNSAKMYKLNFFNFDSQIKEVQDSEGCMEIFENPEIDPSFINDFSFQEDVNEHNVLLTTHNDCTLSDFLVSLDLLEIHQKIDWNVNWDEISLLLFEHRANVNPGHERSSLTCISPVVSSEELYESSSRSTPTNEVIFKRRLQSFDQSIQFSPNISNFSATLGPFLSAIFQRLSALPTNTPFMNLLITGIITDLAAYPQPLIKSLLLDIDIILQPNITKLYDILAEVKNNLIEKSSDIHDWESILVNAYEYLYSRIELTHPDGNGEMNQNFEDEFEIRLSTTSSGAVNNSFFDFDSLSRRLSQSSPSKNKEKRTRKTAFGLLKRKKKDNIPQYRFPIQKFCYSKKKPISDYEAQRIRNLAYNWILFDEFCKELASLCQEHTQHC 1016          
BLAST of FTS and Hook-interacting protein vs. Planmine SMEST
Match: SMESG000040098.1 (SMESG000040098.1)

HSP 1 Score: 151.754 bits (382), Expect = 1.086e-38
Identity = 117/370 (31.62%), Postives = 197/370 (53.24%), Query Frame = 2
Query:   77 LDVFIDHWQQVLYFINN-IDDLNSLETIFKHIDVMVSIIIKECDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDD--WQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSIT 1177
            L+VFI HW   L  ++     L+  E +  +++ MVS++I+E D     +   I EY    +IF  I++        G I E     QLR++  +++    + L++  L+  +L LL   S+RSS K+E   V+LL  ++V ++++  L     EI  +  ++P   +  ++  +HRD  +G+ +++A+LL+   + + + D+   +  +SDF  +L TGLS LYS+ PRKL          Q++   I    EL+H L+ L+FC    ++ H  I+  +L ++Y GFL PVIG SL+Q                +SL+E I+AT Y +L+LR +    ++K FL F + E  +   +LDSLINR+NS T
Sbjct:   26 LEVFIKHWVHALKTMSKEYPTLDESEPVLYYMEEMVSLLIEEKDSNTIQTTGPIFEYSLSQDIFNKIYNW--SSKCSGDILEKVKQQQLRLFAAIVSQGHPSVLLKRELLQPLLRLLNGYSIRSSHKLEISLVNLLKLISVRVSNEPVLQSLCTEIGLSLLNDPLPLLNPLVPFLHRDGILGQEAKDAVLLLLALSMNNE-DVACSVALQSDFCPVLATGLSALYSALPRKLPGYCHSVLLGQLSSPSICKFAELQHFLDYLNFCCQVNEVTHPLIREAVLHYIYNGFLLPVIGSSLNQ----------------SSLDEVIAATIYFDLFLRSITDSGILKAFLCFTIAESHDGCRILDSLINRMNSNT 376          
BLAST of FTS and Hook-interacting protein vs. Planmine SMEST
Match: SMESG000040098.1 (SMESG000040098.1)

HSP 1 Score: 150.984 bits (380), Expect = 3.495e-38
Identity = 117/370 (31.62%), Postives = 197/370 (53.24%), Query Frame = 2
Query:   77 LDVFIDHWQQVLYFINN-IDDLNSLETIFKHIDVMVSIIIKECDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMYDNLINFLPCTQLMRSNLIITVLHLLEECSLRSSVKIEHLSVHLLYQLTVLITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLIFNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDD--WQQITRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIGPSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLFLQFILTERQENYIVLDSLINRLNSIT 1177
            L+VFI HW   L  ++     L+  E +  +++ MVS++I+E D     +   I EY    +IF  I++        G I E     QLR++  +++    + L++  L+  +L LL   S+RSS K+E   V+LL  ++V ++++  L     EI  +  ++P   +  ++  +HRD  +G+ +++A+LL+   + + + D+   +  +SDF  +L TGLS LYS+ PRKL          Q++   I    EL+H L+ L+FC    ++ H  I+  +L ++Y GFL PVIG SL+Q                +SL+E I+AT Y +L+LR +    ++K FL F + E  +   +LDSLINR+NS T
Sbjct:   26 LEVFIKHWVHALKTMSKEYPTLDESEPVLYYMEEMVSLLIEEKDSNTIQTTGPIFEYSLSQDIFNKIYN--WSSKCSGDILEKVKQQQLRLFAAIVSQGHPSVLLKRELLQPLLRLLNGYSIRSSHKLEISLVNLLKLISVRVSNEPVLQSLCTEIGLSLLNDPLPLLNPLVPFLHRDGILGQEAKDAVLLLLALSMNNE-DVACSVALQSDFCPVLATGLSALYSALPRKLPGYCHSVLLGQLSSPSICKFAELQHFLDYLNFCCQVNEVTHPLIREAVLHYIYNGFLLPVIGSSLNQ----------------SSLDEVIAATIYFDLFLRSITDSGILKAFLCFTIAESHDGCRILDSLINRMNSNT 376          
BLAST of FTS and Hook-interacting protein vs. Planmine SMEST
Match: SMESG000040065.1 (SMESG000040065.1)

HSP 1 Score: 54.299 bits (129), Expect = 6.342e-7
Identity = 23/35 (65.71%), Postives = 29/35 (82.86%), Query Frame = 2
Query: 1205 LGVITLSLFRTMLSFHSEDVLFALVFRYLIPCDHL 1309
            LGV TL+L  T+LSF+ ED++F L+FRYLIPC HL
Sbjct:  139 LGVATLTLMNTLLSFNCEDIMFELIFRYLIPCYHL 173          
The following BLAST results are available for this feature:
BLAST of FTS and Hook-interacting protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FAM160A17.685e-5929.56family with sequence similarity 160 member A1 [Sou... [more]
FAM160A17.685e-5929.56family with sequence similarity 160 member A1 [Sou... [more]
FAM160A27.922e-4729.23family with sequence similarity 160 member A2 [Sou... [more]
FAM160A28.527e-4729.23family with sequence similarity 160 member A2 [Sou... [more]
FAM160A22.073e-4629.23family with sequence similarity 160 member A2 [Sou... [more]
back to top
BLAST of FTS and Hook-interacting protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C05D11.88.479e-2329.14UPF0518 protein C05D11.8 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of FTS and Hook-interacting protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG35581.952e-4227.84gene:FBgn0025681 transcript:FBtr0273230[more]
CG35581.993e-4227.84gene:FBgn0025681 transcript:FBtr0331653[more]
CG35581.855e-4127.17gene:FBgn0025681 transcript:FBtr0077645[more]
CG35581.879e-4127.17gene:FBgn0025681 transcript:FBtr0077644[more]
back to top
BLAST of FTS and Hook-interacting protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fam160a1a1.870e-5429.21family with sequence similarity 160 member A1a [So... [more]
fam160a1a1.870e-5429.21family with sequence similarity 160 member A1a [So... [more]
fam160a1b2.210e-4928.40family with sequence similarity 160 member A1b [So... [more]
fam160a22.251e-4929.45family with sequence similarity 160 member A2 [Sou... [more]
fam160a1a6.244e-4227.19family with sequence similarity 160 member A1a [So... [more]
back to top
BLAST of FTS and Hook-interacting protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FAM160A12.755e-5930.51family with sequence similarity 160 member A1 [Sou... [more]
kmt2d3.976e-4230.66lysine methyltransferase 2D [Source:Xenbase;Acc:XB... [more]
kmt2d4.663e-4230.66lysine methyltransferase 2D [Source:Xenbase;Acc:XB... [more]
kmt2d5.360e-4230.66lysine methyltransferase 2D [Source:Xenbase;Acc:XB... [more]
kmt2d8.524e-4230.66lysine methyltransferase 2D [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of FTS and Hook-interacting protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fam160a18.141e-6030.00family with sequence similarity 160, member A1 [So... [more]
Fam160a18.141e-6030.00family with sequence similarity 160, member A1 [So... [more]
Fam160a21.003e-5130.04family with sequence similarity 160, member A2 [So... [more]
Fam160a22.722e-5130.04family with sequence similarity 160, member A2 [So... [more]
Fam160a22.722e-5130.04family with sequence similarity 160, member A2 [So... [more]
back to top
BLAST of FTS and Hook-interacting protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q505K2|F16A1_MOUSE5.694e-5930.00Protein FAM160A1 OS=Mus musculus OX=10090 GN=Fam16... [more]
sp|Q05DH4|F16A1_HUMAN3.690e-5829.56Protein FAM160A1 OS=Homo sapiens OX=9606 GN=FAM160... [more]
sp|Q66H54|F16A2_RAT7.338e-5130.04FTS and Hook-interacting protein OS=Rattus norvegi... [more]
sp|Q3U2I3|F16A2_MOUSE1.904e-5030.04FTS and Hook-interacting protein OS=Mus musculus O... [more]
sp|Q5R8V2|F16A2_PONAB3.759e-4928.79FTS and Hook-interacting protein OS=Pongo abelii O... [more]
back to top
BLAST of FTS and Hook-interacting protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A159X5N11.883e-17198.28FAM160A1-like protein (Fragment) OS=Schmidtea medi... [more]
A0A210R0F18.549e-6431.65FTS and Hook-interacting protein-like OS=Mizuhopec... [more]
A0A1S3HN842.367e-6233.63FTS and Hook-interacting protein isoform X1 OS=Lin... [more]
A0A1S3HPP92.812e-6233.63FTS and Hook-interacting protein isoform X2 OS=Lin... [more]
A0A1I8GRG51.471e-6129.35Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of FTS and Hook-interacting protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
fam160a1a5.338e-5628.73family with sequence similarity 160 member A1a [So... [more]
fam160a21.411e-5229.80FTS and Hook-interacting protein homolog [Source:N... [more]
fam160a1b6.896e-5228.20family with sequence similarity 160 member A1b [So... [more]
back to top
BLAST of FTS and Hook-interacting protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000010108.11.344e-4932.34pep scaffold:Pmarinus_7.0:GL484264:401:12279:-1 ge... [more]
back to top
BLAST of FTS and Hook-interacting protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FTS and Hook-interacting protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO407821.126e-4027.92UPF0518 protein v1g243165 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of FTS and Hook-interacting protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
fam160a1a4.367e-5829.86family with sequence similarity 160 member A1 [Sou... [more]
ENSORLT00000003880.22.819e-5228.75protein FAM160A1 [Source:NCBI gene;Acc:101175601][more]
fam160a24.260e-5130.55FTS and Hook-interacting protein homolog [Source:N... [more]
fam160a25.256e-5130.55FTS and Hook-interacting protein homolog [Source:N... [more]
back to top
BLAST of FTS and Hook-interacting protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025657.10.000e+098.46SMESG000025657.1[more]
SMESG000025657.10.000e+097.69SMESG000025657.1[more]
SMESG000040098.11.086e-3831.62SMESG000040098.1[more]
SMESG000040098.13.495e-3831.62SMESG000040098.1[more]
SMESG000040065.16.342e-765.71SMESG000040065.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008221 ID=SMED30008221|Name=FTS and Hook-interacting protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3627bp
AGCTTTGTTTAACTGCATGAATTTGATTTCAATTCAATGAAATTACAAAA
TGGATTATAACAACTCAAAAATTTGCTTAGATGTTTTCATCGATCACTGG
CAGCAAGTTTTGTATTTTATCAATAACATCGACGACTTAAATAGTTTGGA
AACAATTTTTAAGCACATAGATGTTATGGTGTCCATTATAATTAAAGAGT
GCGACGAAGAAGAAACACACTCTTTGGAAGACATACTAGAATATTGTAGT
CAAAATAATATTTTTAAAACAATATTCGATCATTTCATTCAAGAAAATCT
ACGAGGTCAAATTAAAGAATATGGTATAATCAATCAATTGAGAATGTATG
ATAACCTGATTAATTTTTTGCCTTGCACACAATTGATGCGTTCAAATTTA
ATTATAACAGTTCTGCATTTGTTAGAGGAATGCTCTTTAAGATCAAGCGT
GAAAATCGAACATTTGTCCGTGCACTTGCTATATCAATTAACCGTACTAA
TAACAAGCGACGTACAATTGTTCGAATTTATCAAAGAGATTTCTACAAAT
GAATTTCATGAACCGTTTTACTTTATTGGACTCATCATACAATTGATTCA
CCGCGACAGGGATATCGGTCGGTTGTCCCAGGAAGCTTTGCTATTGATAT
TCAATTTCACGAAAGATGAAGATTCCGATTTAGTTGATTACATTTGCTAT
AGATCGGATTTCTCTGCTATATTGGTTACCGGGTTGAGTGGTTTATACTC
ATCGTTTCCTAGGAAATTGGATAATCTTCCGGATGACTGGCAACAGATCA
CGAGGATTTACATTGGCACAGTTCCTGAATTGAAGCATAGCCTCGAGATA
TTAGATTTCTGTAATTTGGCATTAAAGATGGGACACGCAAAGATAAAAAT
GGACATCCTCGATTTTTTATATACGGGATTCTTATCACCGGTAATTGGGC
CTTCACTGCATCAGGTTGGATACATTTTAATCCAGCATTTATTTACTGCC
GTAAACTGTCAGAATTCATTGGAAGAAACGATAAGCGCCACCGCATATCT
AGAGTTATATTTGAGACATCTGAGGCATCCTTTAATGATAAAATTGTTCC
TGCAATTTATATTAACCGAGCGGCAAGAGAATTATATCGTTTTGGATTCT
CTGATAAATCGGTTGAATTCCATCACAATGGACACCGTGGAAGGAATGTA
TACACTCGGCGTCATAACTCTTTCTCTATTCCGTACAATGTTGAGTTTCC
ACAGTGAGGACGTTCTATTTGCCTTAGTGTTCAGATATTTAATTCCTTGC
GATCACCTGATCAAACAGAAATGGGTTCAATTGTCCCCGGTTTCGAGTGT
AGAAGATATTAGCTGTTATGCGAATCATGAGGATAGGCCAACTTTCAAAT
GTCCTCCAACATCAAAAATTTCCAACAGTATCAATGAAAATCTGTCAAAT
TCTGCCGAACAGTTTCTTAAACTTTCTCTTGGGATTTATTCTGAAGATCA
AAACATCTTACCGACGTTTCCAATGTCGAACAAAAAGCTCGATTCGATCA
CTTTGGAACAACGTCGAGCAAGTCAGAGTCCAGTTGTGATAAACAATCTC
CAAAGATTTTCTCTGTATTGTCCATTTCATTCCTATTTACATTCGGCAGC
ATTGTTTGTGAATCGTAGAATTCTCGCTTCTCATGGATGGCAGTTCAGTT
ACGACGGAATCAATCCGTCGACGAAAATCTTTGAGGAAATCAATAATTCT
TTTGAACAATGGAATCAAAAATTCCAGTTCTCTCATCATATCAAAGAATC
ACAAGAGACTGTCACAGAACTATATATTGAATCTGATCAGAGAAATTATC
CGGACTCTCCGGGTGAAACTCACACAAATATACCTATCAGAGATGTCGGT
TACTATTCCTCCAATAATGGATCTGGCAGTACAATATCAAATCAGCAGCC
TAACTACTTGCCGCCTGATGAACAGGAGGAGTCTAATGAACATTCAGTAT
CAAATTTATTATGCCAGGCTTTAAACTCAGCGAAAATGTACAAGTTAAAC
TTCTTTAATTTTGACTCTCAAATAAAGGAGGTCCAAGATTCAGAAGGTTG
CATGGAAATATTCGAAAACCCAGAAATTGATCCATCATTTATCAATGACT
TCTCTTTTCAAGAAGATGTAAATGAACATAATGTCCTATTGACAACCCAT
AACGACTGCACTTTATCCGATTTCCTCGTCAGCTTAGATTTGCTAGAAAT
TCATCAGAAAATTGACTGGAATGTAAATTGGGACGAGATTTCACTTTTAC
TCTTTGAACATCGAGCTAATGTAAATCCAGGTCATGAAAGATCTAGTTTG
ACTTGTATTTCTCCCGTGGTAAGTTCAGAAGAATTATATGAGTCATCTAG
CAGGTCTACCCCAACAAATGAAGTGATATTCAAAAGACGTCTTCAATCTT
TTGATCAATCAATTCAATTTTCTCCAAACATTTCCAATTTTTCTGCGACT
TTAGGTCCATTTCTCAGTGCCATATTTCAACGCCTAAGTGCTCTTCCTAC
AAATACGCCGTTTATGAATCTGCTCATAACTGGCATCATCACAGATCTCG
CTGCGTATCCTCAGCCTCTTATTAAGAGTCTCCTATTAGATATCGACATA
ATTTTACAGCCGAATATTACTAAATTGTATGATATTTTAGCCGAAGTCAA
AAATAACCTCATTGAAAAATCCAGTGATATCCACGACTGGGAAAGCATCC
TTGTCAATGCTTATGAGTATCTGTATTCTCGTATCGAATTGACTCACCCG
GACGGAAATGGCGAAATGAACCAGAATTTCGAGGATGAATTCGAAATTAG
ACTGTCGACCACTTCATCCGGAGCGGTAAATAATTCATTCTTTGATTTTG
ATAGTTTGTCGAGACGTTTATCTCAATCTTCGCCTTCAAAGAATAAAGAA
AAAAGAACTCGAAAAACAGCATTTGGGTTATTGAAACGGAAAAAGAAAGA
CAATATTCCCCAATATCGGTTCCCTATCCAGAAATTTTGTTACTCAAAAA
AGAAGCCGATTTCAGATTACGAAGCACAGAGAATAAGAAATCTCGCGTAT
AATTGGATATTGTTTGACGAGTTTTGTAAGGAGTTAGCATCACTGTGCCA
GGAACATACCCAACATTGCTTTTTCTAGTCGTTTTCCTTTCTATAGATTT
TTATCATGATCTACTTACTTTGTCAAGTTTTTACTATTTCAGTTATTGGA
ATTTGTTTTCTTTATCATTTTTACAGATGTTTATATATATATATATATAT
ATGGGAGTGTTTGTAAGTAACTATATTATGGTTTTTATATTGCCTTTTCA
TATGTTCTGTTGATATTTATTATTTCTGTCATTTATCAGAATTTGTTTGT
ATTTTTTCACTATTCTCTGGTTTTGTACTTTTGCTTTATATCATCCTTTA
ATGGAAATGTAGCAAAAAAACGGGACCGGTCTTATTTGAACGTGATTACC
CGGGAAGTGGTAATCTTGATTTCAGTTTATCAATGATCATCCACTTTAGG
TCGGGAATTTTCAGATTTTTTAATGCAAATATTTTGATTTTGAATTAATA
ATAATAATTTTGGGTTTGTCAAAAAAA
back to top

protein sequence of SMED30008221-orf-1

>SMED30008221-orf-1 ID=SMED30008221-orf-1|Name=SMED30008221-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1043bp
MDYNNSKICLDVFIDHWQQVLYFINNIDDLNSLETIFKHIDVMVSIIIKE
CDEEETHSLEDILEYCSQNNIFKTIFDHFIQENLRGQIKEYGIINQLRMY
DNLINFLPCTQLMRSNLIITVLHLLEECSLRSSVKIEHLSVHLLYQLTVL
ITSDVQLFEFIKEISTNEFHEPFYFIGLIIQLIHRDRDIGRLSQEALLLI
FNFTKDEDSDLVDYICYRSDFSAILVTGLSGLYSSFPRKLDNLPDDWQQI
TRIYIGTVPELKHSLEILDFCNLALKMGHAKIKMDILDFLYTGFLSPVIG
PSLHQVGYILIQHLFTAVNCQNSLEETISATAYLELYLRHLRHPLMIKLF
LQFILTERQENYIVLDSLINRLNSITMDTVEGMYTLGVITLSLFRTMLSF
HSEDVLFALVFRYLIPCDHLIKQKWVQLSPVSSVEDISCYANHEDRPTFK
CPPTSKISNSINENLSNSAEQFLKLSLGIYSEDQNILPTFPMSNKKLDSI
TLEQRRASQSPVVINNLQRFSLYCPFHSYLHSAALFVNRRILASHGWQFS
YDGINPSTKIFEEINNSFEQWNQKFQFSHHIKESQETVTELYIESDQRNY
PDSPGETHTNIPIRDVGYYSSNNGSGSTISNQQPNYLPPDEQEESNEHSV
SNLLCQALNSAKMYKLNFFNFDSQIKEVQDSEGCMEIFENPEIDPSFIND
FSFQEDVNEHNVLLTTHNDCTLSDFLVSLDLLEIHQKIDWNVNWDEISLL
LFEHRANVNPGHERSSLTCISPVVSSEELYESSSRSTPTNEVIFKRRLQS
FDQSIQFSPNISNFSATLGPFLSAIFQRLSALPTNTPFMNLLITGIITDL
AAYPQPLIKSLLLDIDIILQPNITKLYDILAEVKNNLIEKSSDIHDWESI
LVNAYEYLYSRIELTHPDGNGEMNQNFEDEFEIRLSTTSSGAVNNSFFDF
DSLSRRLSQSSPSKNKEKRTRKTAFGLLKRKKKDNIPQYRFPIQKFCYSK
KKPISDYEAQRIRNLAYNWILFDEFCKELASLCQEHTQHCFF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005829cytosol
GO:0070695FHF complex
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0007032endosome organization
GO:0007040lysosome organization
GO:0008333endosome to lysosome transport
GO:0015031protein transport
GO:0045022early endosome to late endosome transport
GO:0008150biological_process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR019384RetinoicA-induced_16-like
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019384Retinoic acid induced 16-like proteinPFAMPF10257RAI16-likecoord: 62..414
e-value: 6.6E-32
score: 110.8
NoneNo IPR availablePANTHERPTHR21705RAI16 PROTEIN-RELATEDcoord: 6..1037
NoneNo IPR availablePANTHERPTHR21705:SF11UPF0518 PROTEIN CG3558coord: 6..1037