U8 snoRNA-decapping enzyme

Overview
NameU8 snoRNA-decapping enzyme
Smed IDSMED30008213
Length (bp)790
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of U8 snoRNA-decapping enzyme (SMED30008213) t-SNE clustered cells

Violin plots show distribution of expression levels for U8 snoRNA-decapping enzyme (SMED30008213) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of U8 snoRNA-decapping enzyme (SMED30008213) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for U8 snoRNA-decapping enzyme (SMED30008213) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008213

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30008213SMESG000028470.1 dd_Smed_v4_5872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Human
Match: NUDT16 (nudix hydrolase 16 [Source:HGNC Symbol;Acc:HGNC:26442])

HSP 1 Score: 144.821 bits (364), Expect = 2.158e-42
Identity = 65/188 (34.57%), Postives = 106/188 (56.38%), Query Frame = 2
Query:  119 GFQKINLNETSNEIYDCYMCAAHGMIYANDSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLT-EFQQKDHLVCYINHALKIILHFYIKEISMSEFIEAENNALLAEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAGLIKSGIFTQNEMNDI 679
            G +++ L E +  +   +  A H ++YA D  +LF + P R A++MQMRFDG +GF GG +D  D+++ DGLNRE +EE+         ++ D+   ++    +++ HFY K +++ E +  E  A  A+ +G E LG++RVP Y   D   GLP FL N F G A+ QL+  L   G+     ++ +
Sbjct:    3 GARRLELGE-ALALGSGWRHACHALLYAPDPGMLFGRIPLRYAILMQMRFDGRLGFPGGFVDTQDRSLEDGLNRELREELGEAAAAFRVERTDYRSSHVGSGPRVVAHFYAKRLTLEELLAVEAGATRAKDHGLEVLGLVRVPLYTLRDGVGGLPTFLENSFIGSAREQLLEALQDLGLLQSGSISGL 189          
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Human
Match: NUDT16 (nudix hydrolase 16 [Source:HGNC Symbol;Acc:HGNC:26442])

HSP 1 Score: 115.931 bits (289), Expect = 1.064e-31
Identity = 51/137 (37.23%), Postives = 79/137 (57.66%), Query Frame = 2
Query:  254 MQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLT-EFQQKDHLVCYINHALKIILHFYIKEISMSEFIEAENNALLAEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAGLIKSGIFTQ 661
            MQMRFDG +GF GG +D  D+++ DGLNRE +EE+         ++ D+   ++    +++ HFY K +++ E +  E  A  A+ +G E LG++RVP Y   D   GLP FL N F G A+ QL+   +   + T+
Sbjct:    1 MQMRFDGRLGFPGGFVDTQDRSLEDGLNRELREELGEAAAAFRVERTDYRSSHVGSGPRVVAHFYAKRLTLEELLAVEAGATRAKDHGLEVLGLVRVPLYTLRDGVGGLPTFLENSFIGSAREQLLEAALHGPMKTE 137          
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Human
Match: NUDT16L1 (nudix hydrolase 16 like 1 [Source:HGNC Symbol;Acc:HGNC:28154])

HSP 1 Score: 107.457 bits (267), Expect = 7.167e-28
Identity = 55/152 (36.18%), Postives = 85/152 (55.92%), Query Frame = 2
Query:  185 HGMIYANDSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLTEFQQKDHLVCYINHAL-KIILHFYIKEISMSEFIEAENNALLAEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAGL 637
            H M+YA +   LF + P R +V+MQMRFDG +GF GG +D+   ++ DGLNR     +    LTE    D+L  ++     +++ H Y +++++ +    E +A+ +  +G E LG++RVP Y   D   G P FL N F   AK QL+  L
Sbjct:   29 HAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRRFWSLEDGLNRVLGLGLGCLRLTE---ADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFAL 177          
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Human
Match: NUDT16 (nudix hydrolase 16 [Source:HGNC Symbol;Acc:HGNC:26442])

HSP 1 Score: 102.064 bits (253), Expect = 1.391e-25
Identity = 45/135 (33.33%), Postives = 78/135 (57.78%), Query Frame = 2
Query:  119 GFQKINLNETSNEIYDCYMCAAHGMIYANDSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLT-EFQQKDHLVCYINHALKIILHFYIKEISMSEFIEAENNALLAEHYGSE 520
            G +++ L E +  +   +  A H ++YA D  +LF + P R A++MQMRFDG +GF GG +D  D+++ DGLNRE +EE+         ++ D+   ++    +++ HFY K +++ E +  E  A  A+ +G E
Sbjct:    3 GARRLELGE-ALALGSGWRHACHALLYAPDPGMLFGRIPLRYAILMQMRFDGRLGFPGGFVDTQDRSLEDGLNRELREELGEAAAAFRVERTDYRSSHVGSGPRVVAHFYAKRLTLEELLAVEAGATRAKDHGLE 136          
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Human
Match: NUDT16L1 (nudix hydrolase 16 like 1 [Source:HGNC Symbol;Acc:HGNC:28154])

HSP 1 Score: 97.8265 bits (242), Expect = 2.475e-24
Identity = 53/152 (34.87%), Postives = 83/152 (54.61%), Query Frame = 2
Query:  185 HGMIYANDSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLTEFQQKDHLVCYINHAL-KIILHFYIKEISMSEFIEAENNALLAEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAGL 637
            H M+YA +   LF + P R +V+M  RFDG +GF GG +D+   ++ DGLNR     +    LTE    D+L  ++     +++ H Y +++++ +    E +A+ +  +G E LG++RVP Y   D   G P FL N F   AK QL+  L
Sbjct:   18 HAMLYAANPGQLFGRIPMRFSVLM--RFDGLLGFPGGFVDRRFWSLEDGLNRVLGLGLGCLRLTE---ADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFAL 164          
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Zebrafish
Match: zgc:103759 (zgc:103759 [Source:ZFIN;Acc:ZDB-GENE-041010-100])

HSP 1 Score: 124.02 bits (310), Expect = 2.137e-34
Identity = 64/179 (35.75%), Postives = 105/179 (58.66%), Query Frame = 2
Query:  170 YMCAAHGMIYANDSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLTEFQQKDHL-VCYINHALKIILHFYIKEISMSEFIEAENNALL-AEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAGLIKSGIFTQNEMNDILKLSDNI 700
            Y  A H M+Y + S+ LF K P +  V+MQMRFDG +GF GGL++ S++T+  GL+RE  EE+ +         DH+  C  +   ++I HFYIK+++ +E  E E  A+  A  +G E LG++RVP Y       GLP FL + F   +++QL++ L    + +Q E+ + ++ ++ +
Sbjct:   17 YRHACHVMLYGDSSAKLFGKIPIKHIVLMQMRFDGLLGFPGGLVNPSEETLEAGLSRELHEEVGVAVPVGVD--DHMSSCVSSSCPRLITHFYIKKMTEAELKEIERAAVASATDHGLEVLGMVRVPLYFLKKGG-GLPYFLSHSFISNSRAQLLSALRHCRLLSQGELKEAVRQAEQM 192          
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Zebrafish
Match: zgc:103759 (zgc:103759 [Source:ZFIN;Acc:ZDB-GENE-041010-100])

HSP 1 Score: 124.02 bits (310), Expect = 2.392e-34
Identity = 64/179 (35.75%), Postives = 105/179 (58.66%), Query Frame = 2
Query:  170 YMCAAHGMIYANDSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLTEFQQKDHL-VCYINHALKIILHFYIKEISMSEFIEAENNALL-AEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAGLIKSGIFTQNEMNDILKLSDNI 700
            Y  A H M+Y + S+ LF K P +  V+MQMRFDG +GF GGL++ S++T+  GL+RE  EE+ +         DH+  C  +   ++I HFYIK+++ +E  E E  A+  A  +G E LG++RVP Y       GLP FL + F   +++QL++ L    + +Q E+ + ++ ++ +
Sbjct:   17 YRHACHVMLYGDSSAKLFGKIPIKHIVLMQMRFDGLLGFPGGLVNPSEETLEAGLSRELHEEVGVAVPVGVD--DHMSSCVSSSCPRLITHFYIKKMTEAELKEIERAAVASATDHGLEVLGMVRVPLYFLKKGG-GLPYFLSHSFISNSRAQLLSALRHCRLLSQGELKEAVRQAEQM 192          
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Zebrafish
Match: zgc:103759 (zgc:103759 [Source:ZFIN;Acc:ZDB-GENE-041010-100])

HSP 1 Score: 76.6406 bits (187), Expect = 1.047e-16
Identity = 42/137 (30.66%), Postives = 77/137 (56.20%), Query Frame = 2
Query:  296 LIDKSDKTVVDGLNREFKEEINMKFLTEFQQKDHLV-CYINHALKIILHFYIKEISMSEFIEAENNALL-AEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAGLIKSGIFTQNEMNDILKLSDNI 700
            L++ S++T+  GL+RE  EE+ +         DH+  C  +   ++I HFYIK+++ +E  E E  A+  A  +G E LG++RVP Y       GLP FL + F   +++QL++ L    + +Q E+ + ++ ++ +
Sbjct:   36 LVNPSEETLEAGLSRELHEEVGVAVPVGVD--DHMSSCVSSSCPRLITHFYIKKMTEAELKEIERAAVASATDHGLEVLGMVRVPLYFLKKGG-GLPYFLSHSFISNSRAQLLSALRHCRLLSQGELKEAVRQAEQM 169          
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Xenopus
Match: slc45a2 (solute carrier family 45 member 2 [Source:Xenbase;Acc:XB-GENE-947685])

HSP 1 Score: 128.642 bits (322), Expect = 5.486e-36
Identity = 66/181 (36.46%), Postives = 104/181 (57.46%), Query Frame = 2
Query:  170 YMCAAHGMIYANDSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLT-EFQQKDHLVCYIN-HALKIILHFYIKEISMSEFIEAENNALLAEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAGLIKSGIFTQNEMNDILKLSDNICF 706
            Y  A H +++A  ++ LFD+ P R  ++M MRFDG +GF GG +D  D ++ +GL RE +EE+     T E   +D+    +  +  K + HFYIKE+ + E    E  A+ A+ +G E +G++RVP Y   D   GLP FL N F G +KSQL+  L    +  +N++ ++LK S  + +
Sbjct:   33 YKHACHALLHAPSTAKLFDRVPIRRVLLMMMRFDGRLGFPGGFVDTRDTSLEEGLKRELQEELGPALTTVEVSVEDYRSSQVREYPQKCVTHFYIKELKLEEIERIEAEAVNAKDHGLEVMGLVRVPLYTLRDGVGGLPAFLCNNFIGNSKSQLLYALRSLKLLRENQIQEVLKASHKLHY 213          
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Mouse
Match: Nudt16 (nudix (nucleoside diphosphate linked moiety X)-type motif 16 [Source:MGI Symbol;Acc:MGI:1922936])

HSP 1 Score: 139.428 bits (350), Expect = 1.708e-40
Identity = 71/194 (36.60%), Postives = 111/194 (57.22%), Query Frame = 2
Query:  116 DGFQKINLNETSNEIYDCYMCAAHGMIYANDSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLTEF--QQKDHLVCYINHALKIILHFYIKEISMSEFIEAENNALLAEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAG-----LIKSGIFTQNEMND 676
            +G +K+ L+E      D +  A H ++YA D   LF + P R AV+MQMRFDG +GF GG +D  D  + DGLNRE +EE+  + ++ F  ++ D+   +I    +++ HFY K +++ +    E  A  A+ +G E LG++RVP Y+  D + GLP FL N F G A+ QL+       L+  GI  + ++ D
Sbjct:    2 EGHRKVELSEALALGPD-WRHACHALLYAPDPRKLFGRIPMRFAVLMQMRFDGRLGFPGGFVDAQDSCLEDGLNRELREELG-EAMSAFRVERSDYRSSHIAARPRVVAHFYAKRLTLEQLQAVEARAPQAKDHGLEVLGLVRVPLYVLRDGEGGLPAFLENSFIGAAREQLLEALQDLKLLDPGIIAKLKIPD 193          
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Mouse
Match: Nudt16 (nudix (nucleoside diphosphate linked moiety X)-type motif 16 [Source:MGI Symbol;Acc:MGI:1922936])

HSP 1 Score: 127.872 bits (320), Expect = 4.469e-36
Identity = 68/191 (35.60%), Postives = 107/191 (56.02%), Query Frame = 2
Query:  125 QKINLNETSNEIYDCYMCAAHGMIYANDSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLTEF--QQKDHLVCYINHALKIILHFYIKEISMSEFIEAENNALLAEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAG-----LIKSGIFTQNEMND 676
            +K+ L+E      D +  A H ++YA D   LF + P R AV+M  RFDG +GF GG +D  D  + DGLNRE +EE+  + ++ F  ++ D+   +I    +++ HFY K +++ +    E  A  A+ +G E LG++RVP Y+  D + GLP FL N F G A+ QL+       L+  GI  + ++ D
Sbjct:    3 RKVELSEALALGPD-WRHACHALLYAPDPRKLFGRIPMRFAVLM--RFDGRLGFPGGFVDAQDSCLEDGLNRELREELG-EAMSAFRVERSDYRSSHIAARPRVVAHFYAKRLTLEQLQAVEARAPQAKDHGLEVLGLVRVPLYVLRDGEGGLPAFLENSFIGAAREQLLEALQDLKLLDPGIIAKLKIPD 189          
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Mouse
Match: Nudt16l2 (nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 2 [Source:MGI Symbol;Acc:MGI:1920782])

HSP 1 Score: 111.309 bits (277), Expect = 1.455e-29
Identity = 59/172 (34.30%), Postives = 90/172 (52.33%), Query Frame = 2
Query:  170 YMCAAHGMIYANDSSILFD-KYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLT-EFQQKDHLVCYINHALKIILHFYIKEISMSEFIEAENNALLAEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAGLIKSGIFTQNEMNDI 679
            ++C  H M+YA D  +LF  +     AV+M MRFDG +GF GG +D    ++ +GLN+E  +++     T      D+         K++ HFY+K +++ +    E  A  A+ +G E LG++RVP Y   D   GLP FL N F G A+ QL+  L   GI      +D+
Sbjct:   21 HLC--HVMLYAPDPGVLFGGRILLNYAVLMSMRFDGRLGFPGGFVDDRSPSLEEGLNKELLKKLGEGVSTFSILSTDYRSSLAESKSKVVAHFYVKCLTLEQLQAVEAGAPQAKDHGLEVLGLVRVPLYTLRDGVGGLPAFLENSFIGVAREQLLEALQDLGILAPETASDL 190          
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Mouse
Match: Nudt16l1 (nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1 [Source:MGI Symbol;Acc:MGI:1914161])

HSP 1 Score: 97.4413 bits (241), Expect = 2.539e-24
Identity = 56/167 (33.53%), Postives = 90/167 (53.89%), Query Frame = 2
Query:  140 NETSNEIYDCYMCAAHGMIYANDSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLTEFQQKDHLVCYINHAL-KIILHFYIKEISMSEFIEAENNALLAEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAGL 637
             E +  +   +  + H M+YA +   LF + P R +V+MQMRFDG +GF GG +D+   ++ DGLNR     +    LTE    D+L  ++     +++ H Y +++++ +    E +A+ +  +G E LG++RVP Y   D   G P FL N F   AK QL+  L
Sbjct:   14 REEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRRFWSLEDGLNRVLGLGLGGLRLTE---ADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNAFVSTAKYQLLFAL 177          
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Mouse
Match: Nudt16l1 (nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1 [Source:MGI Symbol;Acc:MGI:1914161])

HSP 1 Score: 97.4413 bits (241), Expect = 3.569e-24
Identity = 56/167 (33.53%), Postives = 90/167 (53.89%), Query Frame = 2
Query:  140 NETSNEIYDCYMCAAHGMIYANDSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLTEFQQKDHLVCYINHAL-KIILHFYIKEISMSEFIEAENNALLAEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAGL 637
             E +  +   +  + H M+YA +   LF + P R +V+MQMRFDG +GF GG +D+   ++ DGLNR     +    LTE    D+L  ++     +++ H Y +++++ +    E +A+ +  +G E LG++RVP Y   D   G P FL N F   AK QL+  L
Sbjct:   14 REEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRRFWSLEDGLNRVLGLGLGGLRLTE---ADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNAFVSTAKYQLLFAL 177          
BLAST of U8 snoRNA-decapping enzyme vs. UniProt/SwissProt
Match: sp|Q96DE0|NUD16_HUMAN (U8 snoRNA-decapping enzyme OS=Homo sapiens OX=9606 GN=NUDT16 PE=1 SV=2)

HSP 1 Score: 144.821 bits (364), Expect = 1.036e-41
Identity = 65/188 (34.57%), Postives = 106/188 (56.38%), Query Frame = 2
Query:  119 GFQKINLNETSNEIYDCYMCAAHGMIYANDSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLT-EFQQKDHLVCYINHALKIILHFYIKEISMSEFIEAENNALLAEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAGLIKSGIFTQNEMNDI 679
            G +++ L E +  +   +  A H ++YA D  +LF + P R A++MQMRFDG +GF GG +D  D+++ DGLNRE +EE+         ++ D+   ++    +++ HFY K +++ E +  E  A  A+ +G E LG++RVP Y   D   GLP FL N F G A+ QL+  L   G+     ++ +
Sbjct:    3 GARRLELGE-ALALGSGWRHACHALLYAPDPGMLFGRIPLRYAILMQMRFDGRLGFPGGFVDTQDRSLEDGLNRELREELGEAAAAFRVERTDYRSSHVGSGPRVVAHFYAKRLTLEELLAVEAGATRAKDHGLEVLGLVRVPLYTLRDGVGGLPTFLENSFIGSAREQLLEALQDLGLLQSGSISGL 189          
BLAST of U8 snoRNA-decapping enzyme vs. UniProt/SwissProt
Match: sp|Q6P3D0|NUD16_MOUSE (U8 snoRNA-decapping enzyme OS=Mus musculus OX=10090 GN=Nudt16 PE=1 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 1.194e-39
Identity = 71/194 (36.60%), Postives = 111/194 (57.22%), Query Frame = 2
Query:  116 DGFQKINLNETSNEIYDCYMCAAHGMIYANDSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLTEF--QQKDHLVCYINHALKIILHFYIKEISMSEFIEAENNALLAEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAG-----LIKSGIFTQNEMND 676
            +G +K+ L+E      D +  A H ++YA D   LF + P R AV+MQMRFDG +GF GG +D  D  + DGLNRE +EE+  + ++ F  ++ D+   +I    +++ HFY K +++ +    E  A  A+ +G E LG++RVP Y+  D + GLP FL N F G A+ QL+       L+  GI  + ++ D
Sbjct:    2 EGHRKVELSEALALGPD-WRHACHALLYAPDPRKLFGRIPMRFAVLMQMRFDGRLGFPGGFVDAQDSCLEDGLNRELREELG-EAMSAFRVERSDYRSSHIAARPRVVAHFYAKRLTLEQLQAVEARAPQAKDHGLEVLGLVRVPLYVLRDGEGGLPAFLENSFIGAAREQLLEALQDLKLLDPGIIAKLKIPD 193          
BLAST of U8 snoRNA-decapping enzyme vs. UniProt/SwissProt
Match: sp|Q2V8X7|NUD16_SHEEP (U8 snoRNA-decapping enzyme OS=Ovis aries OX=9940 GN=NUDT16 PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 4.768e-38
Identity = 68/187 (36.36%), Postives = 101/187 (54.01%), Query Frame = 2
Query:  119 GFQKINLNETSNEIYDCYMCAAHGMIYANDSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLT-EFQQKDHLVCYINHALKIILHFYIKEISMSEFIEAENNALLAEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIA-----GLIKSGIFTQ 661
            G +++ L E  + +   +  A H M+YA D  +LF + P R AV+MQMRFDG +GF GG +D  D ++ DGLNRE  EE+         ++ D+   +     +++ HFY K +++ +    E  A  A  +G E LG++RVP Y   D   GLP FL N F G A+ QL+      GL++ G F  
Sbjct:    3 GMRRLELAEALH-LGPGWRHACHAMLYAPDPGLLFGRIPLRYAVLMQMRFDGRLGFPGGFVDLRDGSLEDGLNRELGEELGEAAAAFRVERADYRSSHAGSRPRVVAHFYTKLLTLEQLTAVEMGAPRARDHGLEVLGLVRVPLYTLRDRVGGLPAFLENTFIGNAREQLLEAVQNLGLLEPGSFAH 188          
BLAST of U8 snoRNA-decapping enzyme vs. UniProt/SwissProt
Match: sp|A1A4Q9|NUD16_BOVIN (U8 snoRNA-decapping enzyme OS=Bos taurus OX=9913 GN=NUDT16 PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 6.510e-38
Identity = 67/187 (35.83%), Postives = 103/187 (55.08%), Query Frame = 2
Query:  119 GFQKINLNETSNEIYDCYMCAAHGMIYANDSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLT-EFQQKDHLVCYINHALKIILHFYIKEISMSEFIEAENNALLAEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIA-----GLIKSGIFTQ 661
            G +++ L+E  + +   +  A H ++YA D  +LF + P R AV+MQMRFDG +GF GG +D  D ++ DGLNRE  EE+         ++ D+   +     +++ HFY K +++ +    E  A  A  +G E LG++RVP Y   D   GLP FL N F G A+ QL+      GL++ G F +
Sbjct:    3 GMRRLELSEALH-LGPGWRHACHALLYAPDPGLLFGRIPLRYAVLMQMRFDGRLGFPGGFVDLRDGSLEDGLNRELGEELGEAAGAFRVERADYRSSHAGSRPRVVAHFYTKLLTLEQLTAVEMGAPRARDHGLEVLGLVRVPLYTLRDGVGGLPAFLENTFIGNAREQLLEAVQNLGLLEPGSFAR 188          
BLAST of U8 snoRNA-decapping enzyme vs. UniProt/SwissProt
Match: sp|Q6TEC1|NUD16_XENLA (U8 snoRNA-decapping enzyme OS=Xenopus laevis OX=8355 GN=nudt16 PE=1 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 9.008e-36
Identity = 69/200 (34.50%), Postives = 111/200 (55.50%), Query Frame = 2
Query:  113 KDGFQKINLNETSNEIYDCYMCAAHGMIYANDSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLT-EFQQKDHLVCYIN-HALKIILHFYIKEISMSEFIEAENNALLAEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAGLIKSGIFTQNEMNDILKLSDNICF 706
            +D  +  N++   +   + Y  A H +++A   + LFD+ P R  ++M MRFDG +GF GG +D  D ++ +GL RE +EE+     T E  + D+    +  H  K + HFYIKE+ + E    E  A+ A+ +G E +G+IRVP Y   D   GLP FL N F G +KSQL+  L    +  ++++ ++LK S  + +
Sbjct:   13 EDKPRPRNISREESLQLEGYKHACHALLHAPSQAKLFDRVPIRRVLLMMMRFDGRLGFPGGFVDTRDISLEEGLKRELEEELGPALATVEVTEDDYRSSQVREHPQKCVTHFYIKELKLEEIERIEAEAVNAKDHGLEVMGLIRVPLYTLRDRVGGLPAFLCNNFIGNSKSQLLYALRSLKLLREDQIQEVLKASHRLQY 212          
BLAST of U8 snoRNA-decapping enzyme vs. TrEMBL
Match: A0A0B6Y0Y0 (Nudix hydrolase domain-containing protein OS=Arion vulgaris OX=1028688 GN=ORF7721 PE=4 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 1.583e-50
Identity = 88/205 (42.93%), Postives = 129/205 (62.93%), Query Frame = 2
Query:   74 DLIEDDRLYSEKDKDGFQKINLNETSNEIYDCYMCAAHGMIYANDSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLT-EFQQKDHLVCYINHALKIILHFYIKEISMSEFIEAENNALLAEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAGLIKSGIFTQNEMNDILK 685
            D I+D +  + +D+     I L   SN  +     A+HGMI+A  S +L+D Y  +  VMMQ+RFDG +GF GGL+D+ + T +DG+NRE  EEI +      F+ +DH+  Y++ A +++LHFY+ E++  +F+  E N L AE YG ET GI+RVP +   D  RG P FL NQFAG A+ +LI GL+ S +FT+ EM+  +K
Sbjct:   20 DSIDDFQYLTSEDR-----IKLETQSN--FSSMQHASHGMIFARKSKLLWDLYDMKGMVMMQVRFDGVLGFPGGLVDQGE-TPIDGVNREMHEEIGLDLSKYSFRDEDHIASYVHEAKRLVLHFYMMEVTAEDFVVLEQNTLNAEEYGIETYGIVRVPLFTMGDGVRGFPAFLANQFAGNARDELIRGLLASKLFTEQEMSVAVK 216          
BLAST of U8 snoRNA-decapping enzyme vs. TrEMBL
Match: A0A2C9KLC4 (Nudix hydrolase domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106052081 PE=4 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 1.035e-47
Identity = 81/170 (47.65%), Postives = 111/170 (65.29%), Query Frame = 2
Query:  179 AAHGMIYANDSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLT-EFQQKDHLVCYINHALKIILHFYIKEISMSEFIEAENNALLAEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAGLIKSGIFTQNEMNDILK 685
            AAHGMI+A  S++L++ Y  +  VMMQ+RFDG +GF GGL+D  +K  VDG+NRE  EEI +      F +  H+ CY     K+ILHFY+ E+S  +F   E   L AE YG ET GI+RVP +   D  RG P FL NQFAG A+++LI GL+++ +F+++EM   LK
Sbjct:   46 AAHGMIFAKKSNLLWNLYDQKGLVMMQVRFDGLLGFPGGLVDDGEK-AVDGINREMHEEIGLDLHKYSFTEDHHIACYYQEMKKMILHFYLMEVSPEDFATLEQKTLSAEEYGIETCGIVRVPLFTMGDGVRGFPAFLANQFAGNARAELIHGLLEAKLFSESEMGTALK 214          
BLAST of U8 snoRNA-decapping enzyme vs. TrEMBL
Match: A0A2C9KL91 (Nudix hydrolase domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106052081 PE=4 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 1.050e-47
Identity = 81/170 (47.65%), Postives = 111/170 (65.29%), Query Frame = 2
Query:  179 AAHGMIYANDSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLT-EFQQKDHLVCYINHALKIILHFYIKEISMSEFIEAENNALLAEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAGLIKSGIFTQNEMNDILK 685
            AAHGMI+A  S++L++ Y  +  VMMQ+RFDG +GF GGL+D  +K  VDG+NRE  EEI +      F +  H+ CY     K+ILHFY+ E+S  +F   E   L AE YG ET GI+RVP +   D  RG P FL NQFAG A+++LI GL+++ +F+++EM   LK
Sbjct:   55 AAHGMIFAKKSNLLWNLYDQKGLVMMQVRFDGLLGFPGGLVDDGEK-AVDGINREMHEEIGLDLHKYSFTEDHHIACYYQEMKKMILHFYLMEVSPEDFATLEQKTLSAEEYGIETCGIVRVPLFTMGDGVRGFPAFLANQFAGNARAELIHGLLEAKLFSESEMGTALK 223          
BLAST of U8 snoRNA-decapping enzyme vs. TrEMBL
Match: A0A2C9KL81 (Nudix hydrolase domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106052081 PE=4 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 1.234e-47
Identity = 81/170 (47.65%), Postives = 111/170 (65.29%), Query Frame = 2
Query:  179 AAHGMIYANDSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLT-EFQQKDHLVCYINHALKIILHFYIKEISMSEFIEAENNALLAEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAGLIKSGIFTQNEMNDILK 685
            AAHGMI+A  S++L++ Y  +  VMMQ+RFDG +GF GGL+D  +K  VDG+NRE  EEI +      F +  H+ CY     K+ILHFY+ E+S  +F   E   L AE YG ET GI+RVP +   D  RG P FL NQFAG A+++LI GL+++ +F+++EM   LK
Sbjct:   52 AAHGMIFAKKSNLLWNLYDQKGLVMMQVRFDGLLGFPGGLVDDGEK-AVDGINREMHEEIGLDLHKYSFTEDHHIACYYQEMKKMILHFYLMEVSPEDFATLEQKTLSAEEYGIETCGIVRVPLFTMGDGVRGFPAFLANQFAGNARAELIHGLLEAKLFSESEMGTALK 220          
BLAST of U8 snoRNA-decapping enzyme vs. TrEMBL
Match: A0A2C9KL89 (Nudix hydrolase domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106052081 PE=4 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 2.286e-47
Identity = 81/170 (47.65%), Postives = 111/170 (65.29%), Query Frame = 2
Query:  179 AAHGMIYANDSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLT-EFQQKDHLVCYINHALKIILHFYIKEISMSEFIEAENNALLAEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAGLIKSGIFTQNEMNDILK 685
            AAHGMI+A  S++L++ Y  +  VMMQ+RFDG +GF GGL+D  +K  VDG+NRE  EEI +      F +  H+ CY     K+ILHFY+ E+S  +F   E   L AE YG ET GI+RVP +   D  RG P FL NQFAG A+++LI GL+++ +F+++EM   LK
Sbjct:   67 AAHGMIFAKKSNLLWNLYDQKGLVMMQVRFDGLLGFPGGLVDDGEK-AVDGINREMHEEIGLDLHKYSFTEDHHIACYYQEMKKMILHFYLMEVSPEDFATLEQKTLSAEEYGIETCGIVRVPLFTMGDGVRGFPAFLANQFAGNARAELIHGLLEAKLFSESEMGTALK 235          
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Cavefish
Match: zgc:103759 (U8 snoRNA-decapping enzyme-like [Source:NCBI gene;Acc:103041050])

HSP 1 Score: 101.679 bits (252), Expect = 5.655e-26
Identity = 60/176 (34.09%), Postives = 104/176 (59.09%), Query Frame = 2
Query:  179 AAHGMIYANDSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLTEFQQKDHLVCYINHALK-IILHFYIKEISMSEFIEAENNALL-AEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAGLIKSGIFTQNEMNDILKLSDNI 700
            A H +++A  S+ LF K P +  V+MQMRFDG +GF GGL++ S++T+  GL+RE +EE+ +         D++   +  +   +I HFY K+++ +E +E E  A+  A  +G E +G++RVP Y    N  GL  FL + F   +++QL+  L + G+ ++  ++D L+  D +
Sbjct:   26 ACHILLHAETSAKLFRKIPLKHIVLMQMRFDGLLGFPGGLVNPSEETLESGLSRELQEEVGVAVPVTVD--DYVYSRLPPSSPNLITHFYTKKMTEAELLELEKAAVGNAADHGLEVMGMVRVPLYTLK-NGGGLSWFLSHSFISNSRAQLLGSLRRLGLVSEGVLDDALRQGDQM 198          
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Nematostella
Match: EDO44507 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVT3])

HSP 1 Score: 110.538 bits (275), Expect = 1.002e-29
Identity = 62/186 (33.33%), Postives = 99/186 (53.23%), Query Frame = 2
Query:  170 YMCAAHGMIYAN--DSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMK----------FLTEFQQKDHLVCYINHALKIILHFYIKEISMSEFIEAENNALLAEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAGLIKSGIFTQNEMNDILKLS 691
            Y    H M++ +  +   LF  YP +  ++MQ+RFDG IGF+GG +D  +  +   +NRE +EE+             ++    Q++H +  +N   K+ LHFY KE+ +++F+E E       +   E LG IR P Y   D K GLP FL + F G A+ QL  G+ K  + ++ E+ + +KLS
Sbjct:   18 YRHCCHVMLHTSIPEDVKLFRYYPIKNTILMQLRFDGRIGFSGGFVDDGED-LETAVNREVQEEMGQTSTPVGITEDNYVITHVQEEH-IAELNLTKKLCLHFYAKEVPLNQFLELERRNSTTSNLDFEVLGAIRCPLYTLRDKKGGLPSFLLHNFVGNARLQLFIGIEKENLLSREELLEAVKLS 201          
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Medaka
Match: zgc:103759 (U8 snoRNA-decapping enzyme-like [Source:NCBI gene;Acc:101171079])

HSP 1 Score: 105.531 bits (262), Expect = 2.844e-27
Identity = 69/192 (35.94%), Postives = 110/192 (57.29%), Query Frame = 2
Query:  146 TSNEIYDCYMC--AAHGMIYANDSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLTEFQQKDHL-VCYINHAL------KIILHFYIKEISMSEFIEAENNAL-LAEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAGLIKSGIFTQNEMNDILKLS 691
            +  E   C  C  A H M+YA+ +S LF + P R  V+MQMRFDG +GF GGL++ +++++  GL+RE  EE+ ++      ++D++  CY   AL      K+ILHFY+K++   +  E E  A   A  +G E +G++RVP +  N +  GL  FL + F G A+SQLI  L++  + +   +   L+ S
Sbjct:    7 SREEALACSGCRHACHVMLYADTTSKLFGRTPIRHIVLMQMRFDGLLGFPGGLVNPAEESLEAGLSRELLEELGLEI--PITEEDYVETCYAP-ALSWTAKSKLILHFYVKKMEEEQIKEVERAAASTAVDHGLEVMGMVRVPLFRTNHDG-GLSFFLSHSFIGNARSQLINSLLRLHLISPQNLAKALRKS 194          
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Medaka
Match: zgc:103759 (U8 snoRNA-decapping enzyme-like [Source:NCBI gene;Acc:101171079])

HSP 1 Score: 55.8398 bits (133), Expect = 5.015e-9
Identity = 43/144 (29.86%), Postives = 77/144 (53.47%), Query Frame = 2
Query:  281 GFTGGLIDKSDKTVVDGLNREFKEEINMKFLTEFQQKDHL-VCYI-----NHALKIILHFYIKEISMSEFIEAENNAL-LAEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAGLIKSGIFTQNEMNDILKLS 691
            G    L++ +++++  GL+RE  EE+ ++      ++D++  CY          K+ILHFY+K++   +  E E  A   A  +G E +G++RVP +  N +  GL  FL + F G A+SQLI  L++  + +   +   L+ S
Sbjct:   43 GSQQSLVNPAEESLEAGLSRELLEELGLEI--PITEEDYVETCYAPALSWTAKSKLILHFYVKKMEEEQIKEVERAAASTAVDHGLEVMGMVRVPLFRTNHDG-GLSFFLSHSFIGNARSQLINSLLRLHLISPQNLAKALRKS 183          
BLAST of U8 snoRNA-decapping enzyme vs. Planmine SMEST
Match: SMESG000028470.1 (SMESG000028470.1)

HSP 1 Score: 447.588 bits (1150), Expect = 1.006e-161
Identity = 216/218 (99.08%), Postives = 217/218 (99.54%), Query Frame = 2
Query:   59 MLNEKDLIEDDRLYSEKDKDGFQKINLNETSNEIYDCYMCAAHGMIYANDSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLTEFQQKDHLVCYINHALKIILHFYIKEISMSEFIEAENNALLAEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAGLIKSGIFTQNEMNDILKLSDNICFDL 712
            MLNEKDLIEDDRLYSEKDKDGFQ INLNETSNEIYDCYMCAAHGMIYANDSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLTEFQQKDHLVCYINHALKIILHFYIKEISMSEFIEAENNALLAEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAGLIKSGIFTQNEMNDILKLS+NICFDL
Sbjct:    1 MLNEKDLIEDDRLYSEKDKDGFQTINLNETSNEIYDCYMCAAHGMIYANDSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEINMKFLTEFQQKDHLVCYINHALKIILHFYIKEISMSEFIEAENNALLAEHYGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAGLIKSGIFTQNEMNDILKLSENICFDL 218          
BLAST of U8 snoRNA-decapping enzyme vs. Planmine SMEST
Match: SMESG000058480.1 (SMESG000058480.1)

HSP 1 Score: 48.9062 bits (115), Expect = 7.686e-7
Identity = 35/123 (28.46%), Postives = 61/123 (49.59%), Query Frame = 2
Query:  167 CYMCAAHGMIYANDSSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEI--NMKFLTEFQQKDHLVCYINHALKIILHFYIKEISMSEFIEAENNALLAEHYGSETLG 529
            C   A H + Y++ ++       T+  ++ Q+R+DG +GF GG   ++ + ++  L RE  EE+  + KF+     KD    Y     K   H + KEI+ SE  E   +A  +  +G+E +G
Sbjct:   53 CAFTAGHVLYYSSSNN-----RKTQYDILFQIRYDGYLGFVGG-SQQTGENMLQCLKREIFEELTRSRKFVPNL--KDVFKIYFEKKSKFCDHLFTKEINNSELQELAFDAHKSPAFGTEIMG 167          
The following BLAST results are available for this feature:
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NUDT162.158e-4234.57nudix hydrolase 16 [Source:HGNC Symbol;Acc:HGNC:26... [more]
NUDT161.064e-3137.23nudix hydrolase 16 [Source:HGNC Symbol;Acc:HGNC:26... [more]
NUDT16L17.167e-2836.18nudix hydrolase 16 like 1 [Source:HGNC Symbol;Acc:... [more]
NUDT161.391e-2533.33nudix hydrolase 16 [Source:HGNC Symbol;Acc:HGNC:26... [more]
NUDT16L12.475e-2434.87nudix hydrolase 16 like 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
zgc:1037592.137e-3435.75zgc:103759 [Source:ZFIN;Acc:ZDB-GENE-041010-100][more]
zgc:1037592.392e-3435.75zgc:103759 [Source:ZFIN;Acc:ZDB-GENE-041010-100][more]
zgc:1037591.047e-1630.66zgc:103759 [Source:ZFIN;Acc:ZDB-GENE-041010-100][more]
back to top
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc45a25.486e-3636.46solute carrier family 45 member 2 [Source:Xenbase;... [more]
back to top
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nudt161.708e-4036.60nudix (nucleoside diphosphate linked moiety X)-typ... [more]
Nudt164.469e-3635.60nudix (nucleoside diphosphate linked moiety X)-typ... [more]
Nudt16l21.455e-2934.30nudix (nucleoside diphosphate linked moiety X)-typ... [more]
Nudt16l12.539e-2433.53nudix (nucleoside diphosphate linked moiety X)-typ... [more]
Nudt16l13.569e-2433.53nudix (nucleoside diphosphate linked moiety X)-typ... [more]
back to top
BLAST of U8 snoRNA-decapping enzyme vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96DE0|NUD16_HUMAN1.036e-4134.57U8 snoRNA-decapping enzyme OS=Homo sapiens OX=9606... [more]
sp|Q6P3D0|NUD16_MOUSE1.194e-3936.60U8 snoRNA-decapping enzyme OS=Mus musculus OX=1009... [more]
sp|Q2V8X7|NUD16_SHEEP4.768e-3836.36U8 snoRNA-decapping enzyme OS=Ovis aries OX=9940 G... [more]
sp|A1A4Q9|NUD16_BOVIN6.510e-3835.83U8 snoRNA-decapping enzyme OS=Bos taurus OX=9913 G... [more]
sp|Q6TEC1|NUD16_XENLA9.008e-3634.50U8 snoRNA-decapping enzyme OS=Xenopus laevis OX=83... [more]
back to top
BLAST of U8 snoRNA-decapping enzyme vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B6Y0Y01.583e-5042.93Nudix hydrolase domain-containing protein OS=Arion... [more]
A0A2C9KLC41.035e-4747.65Nudix hydrolase domain-containing protein OS=Biomp... [more]
A0A2C9KL911.050e-4747.65Nudix hydrolase domain-containing protein OS=Biomp... [more]
A0A2C9KL811.234e-4747.65Nudix hydrolase domain-containing protein OS=Biomp... [more]
A0A2C9KL892.286e-4747.65Nudix hydrolase domain-containing protein OS=Biomp... [more]
back to top
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zgc:1037595.655e-2634.09U8 snoRNA-decapping enzyme-like [Source:NCBI gene;... [more]
back to top
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO445071.002e-2933.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of U8 snoRNA-decapping enzyme vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
zgc:1037592.844e-2735.94U8 snoRNA-decapping enzyme-like [Source:NCBI gene;... [more]
zgc:1037595.015e-929.86U8 snoRNA-decapping enzyme-like [Source:NCBI gene;... [more]
back to top
BLAST of U8 snoRNA-decapping enzyme vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000028470.11.006e-16199.08SMESG000028470.1[more]
SMESG000058480.17.686e-728.46SMESG000058480.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008213 ID=SMED30008213|Name=U8 snoRNA-decapping enzyme|organism=Schmidtea mediterranea sexual|type=transcript|length=790bp
TGTAGATGAACTTAAAAATTACTTAAGTATTAAATAATTCCAATTTTATT
TTTAGATTATGTTGAATGAAAAAGATTTAATCGAGGACGATCGCCTTTAT
AGTGAAAAAGATAAGGATGGATTTCAAAAAATTAATTTAAATGAAACTTC
AAATGAAATTTATGATTGTTATATGTGTGCTGCTCATGGTATGATATATG
CAAATGATTCGAGTATTTTGTTTGATAAATATCCTACACGAGCTGCAGTT
ATGATGCAAATGAGATTTGATGGCACTATTGGATTTACTGGAGGTTTAAT
TGATAAAAGCGATAAAACAGTAGTTGATGGGTTAAATAGAGAATTCAAAG
AAGAAATAAATATGAAATTTCTAACTGAATTCCAACAAAAAGATCATTTA
GTTTGTTATATAAATCACGCTTTAAAAATTATTCTTCATTTTTACATTAA
AGAAATTTCAATGTCTGAATTTATTGAAGCTGAAAATAATGCTTTGTTGG
CAGAGCATTATGGAAGTGAAACTCTTGGAATAATTCGAGTTCCTTGTTAT
ATATGGAATGATAACAAACGTGGATTACCAATATTTTTACGCAATCAATT
CGCTGGTAAAGCTAAATCCCAATTAATAGCCGGATTGATTAAAAGTGGAA
TTTTTACTCAAAATGAAATGAATGATATTTTAAAACTATCTGACAACATT
TGTTTCGATTTGTAATATTTAAGATTTTAATCGAAAAATATGTTTATAAA
TTATTATAAAAAAAAAAATGATAAATTTCGAATTATTATA
back to top

protein sequence of SMED30008213-orf-1

>SMED30008213-orf-1 ID=SMED30008213-orf-1|Name=SMED30008213-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=219bp
MLNEKDLIEDDRLYSEKDKDGFQKINLNETSNEIYDCYMCAAHGMIYAND
SSILFDKYPTRAAVMMQMRFDGTIGFTGGLIDKSDKTVVDGLNREFKEEI
NMKFLTEFQQKDHLVCYINHALKIILHFYIKEISMSEFIEAENNALLAEH
YGSETLGIIRVPCYIWNDNKRGLPIFLRNQFAGKAKSQLIAGLIKSGIFT
QNEMNDILKLSDNICFDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
Vocabulary: INTERPRO
TermDefinition
IPR015797NUDIX_hydrolase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.90.79.10coord: 14..215
e-value: 1.1E-62
score: 213.2
NoneNo IPR availablePANTHERPTHR31699FAMILY NOT NAMEDcoord: 31..213
NoneNo IPR availablePANTHERPTHR31699:SF1ZGC:103759coord: 31..213
IPR015797NUDIX hydrolase-like domain superfamilySUPERFAMILYSSF55811Nudixcoord: 32..145