E3 ubiquitin-ligase MIB2 isoform X2

Overview
NameE3 ubiquitin-ligase MIB2 isoform X2
Smed IDSMED30008206
Length (bp)1737
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 ubiquitin-ligase MIB2 isoform X2 (SMED30008206) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 ubiquitin-ligase MIB2 isoform X2 (SMED30008206) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 ubiquitin-ligase MIB2 isoform X2 (SMED30008206) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 ubiquitin-ligase MIB2 isoform X2 (SMED30008206) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008206

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30008206SMESG000007100.1 Contig1318GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30008206SMESG000007100.1 dd_Smed_v4_3416_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008206SMESG000007100.1 dd_Smed_v4_3416_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008206SMESG000007100.1 dd_Smed_v4_3416_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008206SMESG000007100.1 dd_Smed_v4_3416_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30008206SMESG000042541.1 SMESG000007100.1 Contig38349newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30008206SMESG000042541.1 SMESG000007100.1 Contig38349uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30008206SMESG000007100.1 dd_Smed_v4_3416_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Human
Match: MIB1 (mindbomb E3 ubiquitin protein ligase 1 [Source:HGNC Symbol;Acc:HGNC:21086])

HSP 1 Score: 58.151 bits (139), Expect = 3.913e-8
Identity = 24/73 (32.88%), Postives = 39/73 (53.42%), Query Frame = 3
Query: 1386 LQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIF 1604
            LQ D       +++ +L  +  D KE  +C +C+DR K+    CGH  C +C D++S CP C  AI   + ++
Sbjct:  934 LQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY 1006          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Fly
Match: mib2 (gene:FBgn0086442 transcript:FBtr0336840)

HSP 1 Score: 58.5362 bits (140), Expect = 1.625e-8
Identity = 27/98 (27.55%), Postives = 48/98 (48.98%), Query Frame = 3
Query: 1314 LNCDLKYHKSQAIESVVLA-KSKAELQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIF 1604
            L C +   +   +   V+A  +     +D  +   G  +  L ++ ++F+E H C ICM+R +D A  CGH  CS C++ L  C  C   I+  + ++
Sbjct:  952 LRCAVAIERRLTVSGRVVALPTSTSSPSDPTRLPSGDLLRYLENKVLEFEESHFCGICMERKRDVAFLCGHGACSHCAETLRTCHMCRKTILKKINLY 1049          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Fly
Match: mib2 (gene:FBgn0086442 transcript:FBtr0081142)

HSP 1 Score: 58.5362 bits (140), Expect = 1.625e-8
Identity = 27/98 (27.55%), Postives = 48/98 (48.98%), Query Frame = 3
Query: 1314 LNCDLKYHKSQAIESVVLA-KSKAELQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIF 1604
            L C +   +   +   V+A  +     +D  +   G  +  L ++ ++F+E H C ICM+R +D A  CGH  CS C++ L  C  C   I+  + ++
Sbjct:  952 LRCAVAIERRLTVSGRVVALPTSTSSPSDPTRLPSGDLLRYLENKVLEFEESHFCGICMERKRDVAFLCGHGACSHCAETLRTCHMCRKTILKKINLY 1049          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Fly
Match: mib2 (gene:FBgn0086442 transcript:FBtr0336841)

HSP 1 Score: 58.5362 bits (140), Expect = 1.625e-8
Identity = 27/98 (27.55%), Postives = 48/98 (48.98%), Query Frame = 3
Query: 1314 LNCDLKYHKSQAIESVVLA-KSKAELQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIF 1604
            L C +   +   +   V+A  +     +D  +   G  +  L ++ ++F+E H C ICM+R +D A  CGH  CS C++ L  C  C   I+  + ++
Sbjct:  952 LRCAVAIERRLTVSGRVVALPTSTSSPSDPTRLPSGDLLRYLENKVLEFEESHFCGICMERKRDVAFLCGHGACSHCAETLRTCHMCRKTILKKINLY 1049          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Fly
Match: mib1 (gene:FBgn0263601 transcript:FBtr0075520)

HSP 1 Score: 50.8322 bits (120), Expect = 3.912e-6
Identity = 22/79 (27.85%), Postives = 38/79 (48.10%), Query Frame = 3
Query: 1368 AKSKAELQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIF 1604
            A   A +   +V   +  ++ +L  +  D KE  +C +C DR K+    CGH  C +C D++  CP C   +   + +F
Sbjct: 1148 AAGNAMVAPSNVNNFQMDDVQKLKQQLQDIKEQTMCPVCFDRIKNMVFLCGHGTCQMCGDQIEGCPICRKTVEKRILLF 1226          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Fly
Match: mib1 (gene:FBgn0263601 transcript:FBtr0333578)

HSP 1 Score: 50.447 bits (119), Expect = 4.293e-6
Identity = 22/79 (27.85%), Postives = 38/79 (48.10%), Query Frame = 3
Query: 1368 AKSKAELQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIF 1604
            A   A +   +V   +  ++ +L  +  D KE  +C +C DR K+    CGH  C +C D++  CP C   +   + +F
Sbjct: 1037 AAGNAMVAPSNVNNFQMDDVQKLKQQLQDIKEQTMCPVCFDRIKNMVFLCGHGTCQMCGDQIEGCPICRKTVEKRILLF 1115          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 58.9214 bits (141), Expect = 1.366e-8
Identity = 24/73 (32.88%), Postives = 39/73 (53.42%), Query Frame = 3
Query: 1386 LQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIF 1604
            LQ D       +++ +L  +  D KE  +C +C+DR K+    CGH  C +C D++S CP C  AI   + ++
Sbjct:  969 LQRDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1041          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 58.9214 bits (141), Expect = 1.386e-8
Identity = 24/73 (32.88%), Postives = 39/73 (53.42%), Query Frame = 3
Query: 1386 LQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIF 1604
            LQ D       +++ +L  +  D KE  +C +C+DR K+    CGH  C +C D++S CP C  AI   + ++
Sbjct:  958 LQRDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1030          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 58.9214 bits (141), Expect = 1.425e-8
Identity = 24/73 (32.88%), Postives = 39/73 (53.42%), Query Frame = 3
Query: 1386 LQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIF 1604
            LQ D       +++ +L  +  D KE  +C +C+DR K+    CGH  C +C D++S CP C  AI   + ++
Sbjct:  966 LQRDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1038          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 52.373 bits (124), Expect = 4.250e-7
Identity = 24/73 (32.88%), Postives = 39/73 (53.42%), Query Frame = 3
Query: 1386 LQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIF 1604
            LQ D       +++ +L  +  D KE  +C +C+DR K+    CGH  C +C D++S CP C  AI   + ++
Sbjct:  161 LQRDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 233          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Xenopus
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:100170182])

HSP 1 Score: 58.9214 bits (141), Expect = 2.053e-8
Identity = 24/73 (32.88%), Postives = 39/73 (53.42%), Query Frame = 3
Query: 1386 LQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIF 1604
            LQ D       +++ +L  +  D KE  +C +C+DR K+    CGH  C +C D++S CP C  AI   + ++
Sbjct:  974 LQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1046          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Xenopus
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:100170182])

HSP 1 Score: 58.9214 bits (141), Expect = 2.273e-8
Identity = 24/73 (32.88%), Postives = 39/73 (53.42%), Query Frame = 3
Query: 1386 LQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIF 1604
            LQ D       +++ +L  +  D KE  +C +C+DR K+    CGH  C +C D++S CP C  AI   + ++
Sbjct:  934 LQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1006          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Mouse
Match: Mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:MGI Symbol;Acc:MGI:2443157])

HSP 1 Score: 58.151 bits (139), Expect = 2.424e-8
Identity = 24/73 (32.88%), Postives = 39/73 (53.42%), Query Frame = 3
Query: 1386 LQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIF 1604
            LQ D       +++ +L  +  D KE  +C +C+DR K+    CGH  C +C D++S CP C  AI   + ++
Sbjct:  934 LQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY 1006          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Mouse
Match: Mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:MGI Symbol;Acc:MGI:2443157])

HSP 1 Score: 58.151 bits (139), Expect = 2.424e-8
Identity = 24/73 (32.88%), Postives = 39/73 (53.42%), Query Frame = 3
Query: 1386 LQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIF 1604
            LQ D       +++ +L  +  D KE  +C +C+DR K+    CGH  C +C D++S CP C  AI   + ++
Sbjct:  934 LQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY 1006          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Mouse
Match: Mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:MGI Symbol;Acc:MGI:2443157])

HSP 1 Score: 53.9138 bits (128), Expect = 4.834e-7
Identity = 24/73 (32.88%), Postives = 39/73 (53.42%), Query Frame = 3
Query: 1386 LQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIF 1604
            LQ D       +++ +L  +  D KE  +C +C+DR K+    CGH  C +C D++S CP C  AI   + ++
Sbjct:  569 LQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY 641          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Mouse
Match: Mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:MGI Symbol;Acc:MGI:2443157])

HSP 1 Score: 50.447 bits (119), Expect = 2.379e-6
Identity = 24/73 (32.88%), Postives = 39/73 (53.42%), Query Frame = 3
Query: 1386 LQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIF 1604
            LQ D       +++ +L  +  D KE  +C +C+DR K+    CGH  C +C D++S CP C  AI   + ++
Sbjct:  193 LQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY 265          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Mouse
Match: Birc7 (baculoviral IAP repeat-containing 7 (livin) [Source:MGI Symbol;Acc:MGI:2676458])

HSP 1 Score: 50.0618 bits (118), Expect = 3.310e-6
Identity = 27/90 (30.00%), Postives = 45/90 (50.00%), Query Frame = 3
Query: 1341 SQAIESVVLAKSKAELQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTAL-NCGHTLCSICSDKLSVCPFCSLAIVNSLRIFL 1607
            + A  S  L +S+ E Q + V      ++ E L +    +E   C++C+DR        CGH +C+ C+  L +CP C + I + +R FL
Sbjct:  198 APAHGSPELLRSRRETQPEDVSEPGAKDVQEQLRQ---LQEERRCKVCLDRAVSIVFVPCGHFVCTECAPNLQLCPICRVPICSCVRTFL 284          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. UniProt/SwissProt
Match: sp|Q804S5|MIB1_DANRE (E3 ubiquitin-protein ligase mib1 OS=Danio rerio OX=7955 GN=mib1 PE=1 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.046e-7
Identity = 24/73 (32.88%), Postives = 39/73 (53.42%), Query Frame = 3
Query: 1386 LQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIF 1604
            LQ D       +++ +L  +  D KE  +C +C+DR K+    CGH  C +C D++S CP C  AI   + ++
Sbjct:  958 LQRDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1030          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. UniProt/SwissProt
Match: sp|Q6GNY1|MIB1_XENLA (E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis OX=8355 GN=mib1 PE=2 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.204e-7
Identity = 24/73 (32.88%), Postives = 39/73 (53.42%), Query Frame = 3
Query: 1386 LQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIF 1604
            LQ D       +++ +L  +  D KE  +C +C+DR K+    CGH  C +C D++S CP C  AI   + ++
Sbjct:  935 LQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1007          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. UniProt/SwissProt
Match: sp|Q80SY4|MIB1_MOUSE (E3 ubiquitin-protein ligase MIB1 OS=Mus musculus OX=10090 GN=Mib1 PE=1 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 1.695e-7
Identity = 24/73 (32.88%), Postives = 39/73 (53.42%), Query Frame = 3
Query: 1386 LQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIF 1604
            LQ D       +++ +L  +  D KE  +C +C+DR K+    CGH  C +C D++S CP C  AI   + ++
Sbjct:  934 LQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY 1006          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. UniProt/SwissProt
Match: sp|Q86YT6|MIB1_HUMAN (E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens OX=9606 GN=MIB1 PE=1 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 1.879e-7
Identity = 24/73 (32.88%), Postives = 39/73 (53.42%), Query Frame = 3
Query: 1386 LQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIF 1604
            LQ D       +++ +L  +  D KE  +C +C+DR K+    CGH  C +C D++S CP C  AI   + ++
Sbjct:  934 LQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY 1006          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. UniProt/SwissProt
Match: sp|Q9SAL0|RGLG4_ARATH (E3 ubiquitin-protein ligase RGLG4 OS=Arabidopsis thaliana OX=3702 GN=RGLG4 PE=1 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 8.706e-6
Identity = 19/49 (38.78%), Postives = 28/49 (57.14%), Query Frame = 3
Query: 1458 KELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIF 1604
            ++   C IC+   KD A +CGH  C  C  K+S CP C + I N L+++
Sbjct:  352 EQTQSCPICLTNRKDVAFSCGHMTCGDCGSKISNCPICRVRITNRLKLY 400          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. TrEMBL
Match: A0A1V9Y9B6 (Ankyrin repeat protein OS=Achlya hypogyna OX=1202772 GN=ACHHYP_16231 PE=4 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 9.909e-7
Identity = 42/156 (26.92%), Postives = 66/156 (42.31%), Query Frame = 3
Query: 1221 FDINKANLHKQVPLILACENLLSVVVNALLKLNCDLKYHKSQAIESVVLAKSKA-----ELQNDHVK---------------------AKKGSEIIELLSESVD-FKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIFL 1607
             DINKAN+    PL  A +     ++ AL++   D     +  + ++ +A  +      EL+                          A  G E +  L + +   +E  LC ICM+R+KDT   CGH  C +CS +L+ CP C   I   +R F+
Sbjct:  943 IDINKANMDGMTPLHEAAKYTRLPILAALMRAGADTTLRSNAGLTALDMAPPEGRALLLELERAPAALPTCLHGAEAADCKACLMLATAAGGDEAVLSLKQRIKRLEEASLCCICMERHKDTVFACGHETCMLCSTQLANCPNCREPITTRIRRFV 1098          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. TrEMBL
Match: A0A3R7YCS3 (Uncharacterized protein OS=Aphanomyces astaci OX=112090 GN=B5M09_004504 PE=4 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.246e-6
Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 3
Query: 1404 KAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIFL 1607
            +AKK S + ELL      +E +LC IC +  KDT   CGH  C+ C+ KL+ CP C + IV  +R ++
Sbjct:  219 EAKKTSNVDELLERIHALEEANLCAICQEYVKDTVFGCGHETCATCAAKLTECPHCRILIVTRIRRYI 286          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. TrEMBL
Match: W4GDM2 (Uncharacterized protein OS=Aphanomyces astaci OX=112090 GN=H257_08632 PE=4 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 1.360e-6
Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 3
Query: 1404 KAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIFL 1607
            +AKK S + ELL      +E +LC IC +  KDT   CGH  C+ C+ KL+ CP C + IV  +R ++
Sbjct:  194 EAKKTSNVDELLERIHALEEANLCAICQEYVKDTVFGCGHETCATCAAKLTECPHCRILIVTRIRRYI 261          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. TrEMBL
Match: K1PSK1 (E3 ubiquitin-protein ligase RGLG2 OS=Crassostrea gigas OX=29159 GN=CGI_10008596 PE=4 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 1.380e-6
Identity = 23/44 (52.27%), Postives = 29/44 (65.91%), Query Frame = 3
Query: 1473 CQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIF 1604
            C IC DRN+  A  CGHT CS CSD+L+ CP C + +   LR+F
Sbjct:   54 CPICYDRNRSIAFQCGHTFCSQCSDQLTDCPNCRVKVTQRLRLF 97          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. TrEMBL
Match: A0A3L6UY20 (Uncharacterized protein OS=Aphanomyces astaci OX=112090 GN=DYB28_000304 PE=4 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.604e-6
Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 3
Query: 1404 KAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIFL 1607
            +AKK S + ELL      +E +LC IC +  KDT   CGH  C+ C+ KL+ CP C + IV  +R ++
Sbjct:  262 EAKKTSNVDELLERIHALEEANLCAICQEYVKDTVFGCGHETCATCAAKLTECPHCRILIVTRIRRYI 329          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Cavefish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 58.9214 bits (141), Expect = 1.207e-8
Identity = 24/73 (32.88%), Postives = 39/73 (53.42%), Query Frame = 3
Query: 1386 LQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIF 1604
            LQ D       +++ +L  +  D KE  +C +C+DR K+    CGH  C +C D++S CP C  AI   + ++
Sbjct:  934 LQRDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1006          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Cavefish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 58.9214 bits (141), Expect = 1.215e-8
Identity = 24/73 (32.88%), Postives = 39/73 (53.42%), Query Frame = 3
Query: 1386 LQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIF 1604
            LQ D       +++ +L  +  D KE  +C +C+DR K+    CGH  C +C D++S CP C  AI   + ++
Sbjct:  955 LQRDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1027          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Nematostella
Match: EDO33600 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRR5])

HSP 1 Score: 59.3066 bits (142), Expect = 1.532e-9
Identity = 53/167 (31.74%), Postives = 80/167 (47.90%), Query Frame = 3
Query:  255 TMLGKVKWLG--RINHIDCVGIDLDEPYRFGNSGKLDYKNNFETRPKHGVFTPITNVNIVSNFTESIIPSQLKTSNDIIVNSSVKVYRFASNNKIEKLYGTIAWSGYTDNLKYLY-GIKLEFPVNDGTDGTFSFQRLFSCQPNLGILVPVGMVKLRENKIKPGKQHS 746
            T  G + +LG  +    D  GI LD+P    N G +  +  FE +P HGVFT +  +  V+  TES   S ++ S+ + +   V V    S NKI    GT+ + G T+  K  + G++L+ P+    DG  +  R F C    G+  PV  V      IK GK+ +
Sbjct:   18 TKPGVIAFLGETKFAKGDWAGIILDDPT-GKNDGSVAGEKYFECKPLHGVFTKLEKITKVNQVTES-PGSPVENSSSLEIGDRVVV----SGNKI----GTLRYVGTTEFAKGEWAGVELDEPLGK-NDGAVAGTRYFQCIQGYGLFAPVHKV------IKTGKKET 167          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Nematostella
Match: EDO44606 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV97])

HSP 1 Score: 48.9062 bits (115), Expect = 9.558e-7
Identity = 19/51 (37.25%), Postives = 28/51 (54.90%), Query Frame = 3
Query: 1452 DFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIF 1604
            D KE  +C +CMDR K+    CGH  C +C D++  CP C   +   + +F
Sbjct:  141 DMKEQTMCPVCMDRRKNLIFLCGHGTCQLCGDRMQECPMCRKTVERRILLF 191          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Medaka
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:101158637])

HSP 1 Score: 58.9214 bits (141), Expect = 1.194e-8
Identity = 24/73 (32.88%), Postives = 39/73 (53.42%), Query Frame = 3
Query: 1386 LQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIF 1604
            LQ D       +++ +L  +  D KE  +C +C+DR K+    CGH  C +C D++S CP C  AI   + ++
Sbjct:  948 LQRDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1020          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Planmine SMEST
Match: SMESG000007100.1 (SMESG000007100.1)

HSP 1 Score: 1025.39 bits (2650), Expect = 0.000e+0
Identity = 503/506 (99.41%), Postives = 505/506 (99.80%), Query Frame = 3
Query:   90 MDNNENKYLMLPFIEDQFIDVSNLWRSHKEIYNQIGELKIGKKVTTFLKTATGQSTMLGKVKWLGRINHIDCVGIDLDEPYRFGNSGKLDYKNNFETRPKHGVFTPITNVNIVSNFTESIIPSQLKTSNDIIVNSSVKVYRFASNNKIEKLYGTIAWSGYTDNLKYLYGIKLEFPVNDGTDGTFSFQRLFSCQPNLGILVPVGMVKLRENKIKPGKQHSELLSDEFEGYQSIIKMLLENEGNVNHLDENNESIFDIARKLRNENFIYLMLDHCKQRLELSVTKSMEIILSNLVDSENWDLLFQVIDNAKVDEISNEYLLFLCISVLRKRNTLELFDEIISICTDKNAILHNGETFVTALLKSDINPATMVSILNRKLFDINKANLHKQVPLILACENLLSVVVNALLKLNCDLKYHKSQAIESVVLAKSKAELQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIFL 1607
            MDNNENKYLMLPFIEDQFIDVSNLWRSHKEIYNQIGELKIGKKVTTFLKTATGQSTMLGKVKWLGRINHIDCVGIDLDEPYRFGNSGKLDYKNNFETRPKHGVFTPITNVNIVSNFTESIIPSQLKTSNDIIVNSSVKVYRFASNNKIEKLYGTIAWSGYTDNLKYLYGIKLEFPV+DGTDGTFSFQRLFSCQPNLGILVPVGMVKLRENKIKPGKQHSELLSDEFEGY+SIIKMLLENEGNVNHLDENNESIFDIARKLRNENFIYLMLDHCKQRLELSVTKSMEIILSNLVDSENWDLLFQVIDNAKVDEISNEYLLFLCISVLRKRNTLELFDEIISICTDKNAILHNGETFVTALLKSDINPATMVSILNRKLFDINKANLHKQVPLILACENLL VVVNALLKLNCDLKYHKSQAIESVVLAKSKAELQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIFL
Sbjct:    1 MDNNENKYLMLPFIEDQFIDVSNLWRSHKEIYNQIGELKIGKKVTTFLKTATGQSTMLGKVKWLGRINHIDCVGIDLDEPYRFGNSGKLDYKNNFETRPKHGVFTPITNVNIVSNFTESIIPSQLKTSNDIIVNSSVKVYRFASNNKIEKLYGTIAWSGYTDNLKYLYGIKLEFPVDDGTDGTFSFQRLFSCQPNLGILVPVGMVKLRENKIKPGKQHSELLSDEFEGYESIIKMLLENEGNVNHLDENNESIFDIARKLRNENFIYLMLDHCKQRLELSVTKSMEIILSNLVDSENWDLLFQVIDNAKVDEISNEYLLFLCISVLRKRNTLELFDEIISICTDKNAILHNGETFVTALLKSDINPATMVSILNRKLFDINKANLHKQVPLILACENLLFVVVNALLKLNCDLKYHKSQAIESVVLAKSKAELQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIFL 506          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Planmine SMEST
Match: SMESG000007087.1 (SMESG000007087.1)

HSP 1 Score: 432.95 bits (1112), Expect = 2.040e-135
Identity = 231/460 (50.22%), Postives = 316/460 (68.70%), Query Frame = 3
Query:  228 FLKTATGQSTMLGKVKWLGRINHIDCVGIDLDEPYRFGNSGKLDYKNNFETRPKHGVFTPITNVNIVSNFTESIIPSQLKTSNDIIVNSSVKVYRFASNNKIEKLYGTIAWSGYTDNLKYLYGIKLEFPVNDGTDGTFSFQRLFSCQPNLGILVPVGMVKLRENKIKPGKQHSELLSDEFEGYQSIIKMLLENEGNVNHLDENNESIFDIARKLRNENFIYLMLDHCKQRLELSVTKSMEIILSNLVDSENWDLLFQVIDNAKVDEISNEYLLFLCISVLRKRNTLELFDEIISICTDKNAILHNGETFVTALLKSDINPATMVSILNRKLFDINKANLHKQVPLILACENLLSVVVNALLKLNCDLKYHKSQAIESVVLAKSKAELQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIFL 1607
            F+K    +  + GK++W+G +N +    I+LD+ +  G++G    +    +R K  + T + +V     +    IP +++   +I++NS+VK Y F +    + L+GT+ W+G  +N  Y +G++L+  ++ GTDGTF  QRLF+CQ   G+L P+  V           QH E LS E E Y+ IIKMLL NEG+VN L+ N +SIFDIA  LRNE+F+ +MLDHCKQ LELSVTKS E+ILSNLV+SENWDLL Q+IDNA+VDEISN+YL+ L ISVL+K+ T ELFD+I+S+C DKN I   GETFVTAL+KS I+ +TMVSIL RKLFDINK NL  + PL+LACE LL  VV  L+ LNCDLK ++ +AIES VLAK KA+ +N+H+K   GS+II+LLSE++D   +  C ICMDR+ DT LNCGHT C  C+++   CP C+L + +  +IFL
Sbjct: 1308 FVKQENPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFWRRRIVNSRGKRVIATSVNHVYKYEPYLSKAIPEEIQIFKEIVINSAVKYY-FLTATGYQDLFGTVKWTGVDENDCYFFGLELDDNIDIGTDGTFGGQRLFTCQNGHGVLAPLNTVASDTRFTAKETQHEEFLSAEIENYELIIKMLLANEGDVNKLNTNQDSIFDIANNLRNESFVNVMLDHCKQPLELSVTKSFEMILSNLVESENWDLLSQIIDNARVDEISNKYLMSLSISVLKKQKTAELFDKIMSLCLDKNIIFCGGETFVTALIKSGIHSSTMVSILARKLFDINKTNLGNETPLVLACEGLLLDVVKVLVALNCDLKRYRHEAIESAVLAKLKAKNENNHLKVDLGSQIIKLLSETIDNDSIQ-CNICMDRSIDTVLNCGHTFCLNCANEFHKCPNCNLDVSSYTKIFL 1765          

HSP 2 Score: 77.0258 bits (188), Expect = 2.694e-14
Identity = 66/231 (28.57%), Postives = 106/231 (45.89%), Query Frame = 3
Query:   42 NELIRIYGIFSYIP-VGMDNNENKYLMLPFIEDQFIDVSNLWRSHKEIYNQIGELKIGKKVTTFLKTATGQS-TMLGKVKWLGRINHIDCVGIDLDEPYRFGNSGKLDYKNNFETRPKHGVFTPITNVNI------VSNFTESII-PSQLKTSNDIIVNSSVKVYRFASN--------NKIEKLYGTIAWSGYTDNLKYLYGIKLEFPVNDGTDGTFSFQRLFSCQPNLGI 683
            NEL RI  I   I  + ++  EN  L   FI D+ +D   ++    E         +G      L T  G+S   +G++KW+G+IN+  CVG+D+++   FG  G ++  N F+   KHG+ T ++NVN+      V      II P +     +   +  +K  R   +        N    L GT+ W G  +N+  +  ++L     +GT+G F   RLF C+  L I
Sbjct:  218 NELSRILNIDGRIRFISLECVENAKLH--FIFDKIVDTGKIFYVDCEEDRDY----LGNFAAINLTTRDGKSKQFIGELKWIGKINNEKCVGLDMEDETEFGMDGIINQDNRFDCMEKHGLITVLSNVNLYKYDNNVHLLPSGIINPDKYLRCKETFGDECIKAQRIKKDGMVNVKLLNGQANLKGTLKWHGLMNNVP-VCAVQLLQEHENGTNGRFWRTRLFECRDKLAI 441          

HSP 3 Score: 63.5438 bits (153), Expect = 3.599e-10
Identity = 56/211 (26.54%), Postives = 98/211 (46.45%), Query Frame = 3
Query:  126 FIEDQFIDVSNLWR-SHKEIYNQIGELKIGKKVTTFLKTATGQST-MLGKVKWLGRINHIDCVGIDL-DEPYRFGNSGKLDYKNNFETRPKHGVFTPITNVNIVSNF-TESIIPSQLKTSNDIIVNSSVKVYRFASNNKIE--------------KLYGTIAWSGYTDNLKYLYGIKLEFPVNDGTDGTFSFQRLFSCQPNLGILVPVGMV 704
            FI D+ +D++ ++  S  E  N IG   IGK +   L +  G++   +G+VKW GRIN   CVG+D+ +E    G  G +     F+   KHG+   +++V +  N     I+ S +   N  I     +  ++  +  I+              KL G + W G+ + L  +  I+L+    +G++GTF  +R+ + +    I   V  V
Sbjct: 1165 FIADKIVDINKIYSISPCEGENGIG---IGKPIKINLNSPNGRNRDFIGEVKWTGRINDEKCVGLDMVEEEMEHGMDGMIGKSRIFQCMEKHGLVALLSDVELSENAENPQILDSGMIAPNKFIRFQEERSKKYLDDKNIKMNEFVFVKQENPELKLKGKLRWIGWMNKL-LVCVIELDQDHENGSNGTFWRRRIVNSRGKRVIATSVNHV 1371          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Planmine SMEST
Match: SMESG000074227.1 (SMESG000074227.1)

HSP 1 Score: 383.645 bits (984), Expect = 8.114e-124
Identity = 222/469 (47.33%), Postives = 302/469 (64.39%), Query Frame = 3
Query:  207 IGKKVTTFLKTATGQST-MLGKVKWLGRINHIDCVGIDLDEPYRFGNSGKLDYKNNFETRPKHGVFTPITNVNIVSN-FTESIIPSQLKTSNDIIVNSSVKVYRFASNNKIEKLYGTIAWSGYTDNLKYLYGIKLEFPVNDGTDGTFSFQRLFSCQPNLGILVPVGMVKLRENKIKPGKQHSELLSDEFEGYQSIIKMLLENEGNVNHLDENNESIFDIARKLRNENFIYLMLDHCKQRLELSVTKSMEIILSNLVDSENWDLLFQVIDNAKVDEISNEYLLFLCISVLRKRNTLELFDEIISICTDKNAILHNGETFVTALLKSDINPATMVSILNRKLFDINKANLHKQVPLILACENLLSVVVNALLKLNCDLKYHKSQAIESVVLAKSKAELQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIFL 1607
            IGK +   L +  G++   +G+VKW+GRIN   CVG+D+++    G  GK+     FE   +HG+   +++V +  N     I+ + +   N  I        R+  +  I K+   I W     N   +  I+L+    +G++G F  +R+   +    I   +       N +    QH ELL  E E Y+SIIKMLL NEG+VN L++N ESIFDIA  L+NE+F+ +MLDHC Q L+LSVTKS E+ILSNLV+SENW+LL Q+I +A VDEISN+YL+ L ISVL+K+NT ELFD+I+S+C  KN IL  GET VTA++KS I  +TMVSIL RK+FD NK NL  + PLILAC+ LL  VVN L+ LNCDLK ++ +AIES VLAK +A+ +N+H+K + GSEII+LLSE++D   +  CQICMDR+KDT LNCGHT C  C ++L  CP C   I  S +IFL
Sbjct:  343 IGKPIKMNLNSPNGRNRDFIGEVKWIGRINDEKCVGLDMEDEMEHGMDGKIGQSQRFECMERHGLVALLSDVELHENAVNPQILDNGIIAPNKFIRFQEEHSKRYLDDKNI-KMNEFIGWM----NKLLVCVIELDQDHENGSNGIFWRRRIVDSRGKRVIATHL-------NNVYKDVQHEELLPIEIENYESIIKMLLTNEGDVNKLNQNQESIFDIANTLKNESFVNVMLDHCNQPLKLSVTKSFEVILSNLVESENWNLLSQIIGHAHVDEISNKYLISLSISVLKKQNTTELFDKIMSLCLYKNIILCGGETVVTAVIKSGIPSSTMVSILERKIFDTNKTNLENEAPLILACKFLLFDVVNVLVALNCDLKRYRHEAIESAVLAKLEAKNENNHLKVEFGSEIIKLLSETIDNDSIQ-CQICMDRSKDTVLNCGHTFCLNCVNELYKCPNCFSDISTSSKIFL 798          

HSP 2 Score: 62.3882 bits (150), Expect = 6.793e-10
Identity = 49/185 (26.49%), Postives = 78/185 (42.16%), Query Frame = 3
Query:  204 KIGKKVTTFLKTATGQSTMLGKVKWLGRINHIDCVGIDLDEPYRFGNSGKLDYKNNFETRPKHGVFT------PIT---------NVNIVSNFTESIIPS--QLKTSNDIIVNSSVKVYRFASNNKIEKLYGTIAWSGYTDNLKYLYGIKLEFPVNDGTDGTFSFQRLFSCQPNLGILVPVGMVK 707
            +I K     +K   GQ+ + G +KW G +N++    ++L + +  G +G+      FE R K  + T      PI          N+N+V  F    I +  Q+  S    +N +VK+               I W G  D  +   G +L  PV  GTDG F  + LF      G+L+P G ++
Sbjct:   40 RIKKDGMVSVKLLNGQANLKGTLKWHGSMNNVPVCAVELLQEHENGTNGRFWRTRLFECRDKLAIATLQQNLSPIKSELKFIKEINLNVVDPFNVREIENGRQINKSTCYKINGAVKIL-------------NIKWRGIVDG-ELCVGCELSGPVECGTDGKFGNKNLFKFPDRRGVLIPTGELR 210          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Planmine SMEST
Match: SMESG000074227.1 (SMESG000074227.1)

HSP 1 Score: 383.259 bits (983), Expect = 2.179e-123
Identity = 226/498 (45.38%), Postives = 317/498 (63.65%), Query Frame = 3
Query:  126 FIEDQFIDVSNLWRSHKEIYNQIGE--LKIGKKVTTFLKTATGQST-MLGKVKWLGRINHIDCVGIDLDEPYRFGNSGKLDYKNNFETRPKHGVFTPITNVNIVSN-FTESIIPSQLKTSNDIIVNSSVKVYRFASNNKIEKLYGTIAWSGYTDNLKYLYGIKLEFPVNDGTDGTFSFQRLFSCQPNLGILVPVGMVKLRENKIKPGKQHSELLSDEFEGYQSIIKMLLENEGNVNHLDENNESIFDIARKLRNENFIYLMLDHCKQRLELSVTKSMEIILSNLVDSENWDLLFQVIDNAKVDEISNEYLLFLCISVLRKRNTLELFDEIISICTDKNAILHNGETFVTALLKSDINPATMVSILNRKLFDINKANLHKQVPLILACENLLSVVVNALLKLNCDLKYHKSQAIESVVLAKSKAELQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIFL 1607
            FI ++ +D++  +R    I    G+  + IGK +   L +  G++   +G+VKW+GRIN   CVG+D+++    G  GK+     FE   +HG+   +++V +  N     I+ + +   N  I        R+  +  I+       + G+ + L  +  I+L+    +G++G F  +R+   +    I   +       N +    QH ELL  E E Y+SIIKMLL NEG+VN L++N ESIFDIA  L+NE+F+ +MLDHC Q L+LSVTKS E+ILSNLV+SENW+LL Q+I +A VDEISN+YL+ L ISVL+K+NT ELFD+I+S+C  KN IL  GET VTA++KS I  +TMVSIL RK+FD NK NL  + PLILAC+ LL  VVN L+ LNCDLK ++ +AIES VLAK +A+ +N+H+K + GSEII+LLSE++D   +  CQICMDR+KDT LNCGHT C  C ++L  CP C   I  S +IFL
Sbjct:  339 FIANKIVDINKPYR----ISPCGGDNGISIGKPIKMNLNSPNGRNRDFIGEVKWIGRINDEKCVGLDMEDEMEHGMDGKIGQSQRFECMERHGLVALLSDVELHENAVNPQILDNGIIAPNKFIRFQEEHSKRYLDDKNIK--MNEFVFIGWMNKL-LVCVIELDQDHENGSNGIFWRRRIVDSRGKRVIATHL-------NNVYKDVQHEELLPIEIENYESIIKMLLTNEGDVNKLNQNQESIFDIANTLKNESFVNVMLDHCNQPLKLSVTKSFEVILSNLVESENWNLLSQIIGHAHVDEISNKYLISLSISVLKKQNTTELFDKIMSLCLYKNIILCGGETVVTAVIKSGIPSSTMVSILERKIFDTNKTNLENEAPLILACKFLLFDVVNVLVALNCDLKRYRHEAIESAVLAKLEAKNENNHLKVEFGSEIIKLLSETIDNDSIQ-CQICMDRSKDTVLNCGHTFCLNCVNELYKCPNCFSDISTSSKIFL 821          

HSP 2 Score: 62.003 bits (149), Expect = 9.458e-10
Identity = 49/185 (26.49%), Postives = 78/185 (42.16%), Query Frame = 3
Query:  204 KIGKKVTTFLKTATGQSTMLGKVKWLGRINHIDCVGIDLDEPYRFGNSGKLDYKNNFETRPKHGVFT------PIT---------NVNIVSNFTESIIPS--QLKTSNDIIVNSSVKVYRFASNNKIEKLYGTIAWSGYTDNLKYLYGIKLEFPVNDGTDGTFSFQRLFSCQPNLGILVPVGMVK 707
            +I K     +K   GQ+ + G +KW G +N++    ++L + +  G +G+      FE R K  + T      PI          N+N+V  F    I +  Q+  S    +N +VK+               I W G  D  +   G +L  PV  GTDG F  + LF      G+L+P G ++
Sbjct:   40 RIKKDGMVSVKLLNGQANLKGTLKWHGSMNNVPVCAVELLQEHENGTNGRFWRTRLFECRDKLAIATLQQNLSPIKSELKFIKEINLNVVDPFNVREIENGRQINKSTCYKINGAVKIL-------------NIKWRGIVDG-ELCVGCELSGPVECGTDGKFGNKNLFKFPDRRGVLIPTGELR 210          
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Planmine SMEST
Match: SMESG000056847.1 (SMESG000056847.1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.692e-21
Identity = 50/158 (31.65%), Postives = 90/158 (56.96%), Query Frame = 3
Query:  231 LKTATGQSTMLGKVKWLGRINHIDCVGIDLDEPYRFGNSGKLDYKNNFETRPKHGVFTPITNVNIVSNFTESIIPSQLKTSNDIIVNSSVKVYRFASNNKIEKLYGTIAWSGYTDNLKYLYGIKLEFPVNDGTDGTFSFQRLFSCQPNLGILVPVGMV 704
            +K    +  + GK++W+G +N +    I+LD+ +  G++G    +    +R K  + T + +V     +    IP +++   +I++NS+VK Y F +    + L+GT+ W+G  +N  Y +G++L+  +N GTDGTF  QRLF+CQ   G+L P+  V
Sbjct:  612 VKQGNPELKLKGKLRWIGWMNKLLVCVIELDQDHENGSNGTFWRRQIVNSRGKRVIATSVNHVYKYEPYVIKTIPEEIQIFKEIVINSAVKYY-FLTATGYQDLFGTVKWTGVDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNV 768          

HSP 2 Score: 67.0106 bits (162), Expect = 3.272e-11
Identity = 62/223 (27.80%), Postives = 101/223 (45.29%), Query Frame = 3
Query:   63 GIFSYIPVGMDNNENKYLMLP-------------FIEDQFIDVSNLWR-SHKEIYNQIGELKIGKKVTTFLKTATGQST-MLGKVKWLGRINHIDCVGIDLDEPYRFGNSGKLDYKNNFETRPKHGVFTPITNVNIVSNF-------TESIIPS-----QLKTSNDIIVNSSVKVYRFA---SNNKIEKLYGTIAWSGYTDNLKYLYGIKLEFPVNDGTDGTF 641
            GIFSY  +         LML              FI D+ +D++ ++  S  E  N IG   IGK +        G++   +G+VKW GRIN   CVG+D++E    G +G +     FE   KHG+   +++V +  N        +  I P+     Q + S   + + ++K+  F      N   KL G + W G+ + L  +  I+L+    +G++GTF
Sbjct:  435 GIFSYFRMFTCEGGKGVLMLAENIFHDKESEKPQFIADKIVDINKIYSISPCEGENGIG---IGKPIKINFNYPNGRNRDFIGEVKWTGRINDEKCVGLDMEEEMEHGMNGMIGKSQRFECMEKHGLVALLSDVELSENAENPQVLDSGMIAPNKFIRFQEERSKKYLDDKNIKMNEFVIVKQGNPELKLKGKLRWIGWMNKL-LVCVIELDQDHENGSNGTF 653          

HSP 3 Score: 54.299 bits (129), Expect = 2.677e-7
Identity = 40/119 (33.61%), Postives = 59/119 (49.58%), Query Frame = 3
Query:  198 ELKIGKKVTTFLKTATGQSTMLGKVKWLGRINHIDC--VGIDLDEPYRFGNSGKLDYKNNFETRPKHGVFTPITNVNIVSNFTESII-PSQLK---TSNDII--VNSSVKVYRFASNNK 530
            E+ I   V  +  TATG   + G VKW G ++  DC   G++LD+    G  G    +  F  +  HGV  P+ NV   + FT  ++ P  +K   TS+ I+  +NSSV     A +NK
Sbjct:  694 EIVINSAVKYYFLTATGYQDLFGTVKWTG-VDENDCYFFGLELDDRINIGTDGTFGGQRLFTCQNGHGVLAPLNNVASDTRFTAKVVSPENVKKSETSDQIVCGLNSSV----IAGDNK 807          
The following BLAST results are available for this feature:
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MIB13.913e-832.88mindbomb E3 ubiquitin protein ligase 1 [Source:HGN... [more]
back to top
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib21.625e-827.55gene:FBgn0086442 transcript:FBtr0336840[more]
mib21.625e-827.55gene:FBgn0086442 transcript:FBtr0081142[more]
mib21.625e-827.55gene:FBgn0086442 transcript:FBtr0336841[more]
mib13.912e-627.85gene:FBgn0263601 transcript:FBtr0075520[more]
mib14.293e-627.85gene:FBgn0263601 transcript:FBtr0333578[more]
back to top
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mib11.366e-832.88mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib11.386e-832.88mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib11.425e-832.88mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib14.250e-732.88mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
back to top
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mib12.053e-832.88mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib12.273e-832.88mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
back to top
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mib12.424e-832.88mindbomb E3 ubiquitin protein ligase 1 [Source:MGI... [more]
Mib12.424e-832.88mindbomb E3 ubiquitin protein ligase 1 [Source:MGI... [more]
Mib14.834e-732.88mindbomb E3 ubiquitin protein ligase 1 [Source:MGI... [more]
Mib12.379e-632.88mindbomb E3 ubiquitin protein ligase 1 [Source:MGI... [more]
Birc73.310e-630.00baculoviral IAP repeat-containing 7 (livin) [Sourc... [more]
back to top
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q804S5|MIB1_DANRE1.046e-732.88E3 ubiquitin-protein ligase mib1 OS=Danio rerio OX... [more]
sp|Q6GNY1|MIB1_XENLA1.204e-732.88E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis... [more]
sp|Q80SY4|MIB1_MOUSE1.695e-732.88E3 ubiquitin-protein ligase MIB1 OS=Mus musculus O... [more]
sp|Q86YT6|MIB1_HUMAN1.879e-732.88E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens O... [more]
sp|Q9SAL0|RGLG4_ARATH8.706e-638.78E3 ubiquitin-protein ligase RGLG4 OS=Arabidopsis t... [more]
back to top
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1V9Y9B69.909e-726.92Ankyrin repeat protein OS=Achlya hypogyna OX=12027... [more]
A0A3R7YCS31.246e-641.18Uncharacterized protein OS=Aphanomyces astaci OX=1... [more]
W4GDM21.360e-641.18Uncharacterized protein OS=Aphanomyces astaci OX=1... [more]
K1PSK11.380e-652.27E3 ubiquitin-protein ligase RGLG2 OS=Crassostrea g... [more]
A0A3L6UY201.604e-641.18Uncharacterized protein OS=Aphanomyces astaci OX=1... [more]
back to top
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mib11.207e-832.88mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib11.215e-832.88mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
back to top
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO336001.532e-931.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO446069.558e-737.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mib11.194e-832.88mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
back to top
BLAST of E3 ubiquitin-ligase MIB2 isoform X2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007100.10.000e+099.41SMESG000007100.1[more]
SMESG000007087.12.040e-13550.22SMESG000007087.1[more]
SMESG000074227.18.114e-12447.33SMESG000074227.1[more]
SMESG000074227.12.179e-12345.38SMESG000074227.1[more]
SMESG000056847.11.692e-2131.65SMESG000056847.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008206 ID=SMED30008206|Name=E3 ubiquitin-ligase MIB2 isoform X2|organism=Schmidtea mediterranea sexual|type=transcript|length=1737bp
ATCTATATAAATCTTATATGTTAATATTATCAAAGAAATAGAATGAATTG
ATCAGAATTTATGGTATATTTAGCTATATACCTGTAGGAATGGACAATAA
TGAAAATAAGTACTTAATGCTTCCTTTCATAGAGGATCAATTTATTGACG
TTAGTAATCTTTGGAGATCCCATAAAGAGATATACAATCAAATTGGTGAA
TTGAAAATCGGAAAAAAGGTGACAACTTTTCTCAAAACTGCAACTGGTCA
ATCTACCATGTTAGGAAAAGTTAAATGGTTAGGTCGCATTAATCATATAG
ATTGTGTTGGAATTGATCTCGATGAACCATACAGATTTGGCAATTCTGGA
AAGTTAGACTATAAAAATAACTTTGAAACTAGACCGAAACACGGAGTATT
TACTCCCATTACAAATGTTAATATTGTGTCAAATTTCACCGAATCAATTA
TTCCTAGCCAATTAAAAACGTCTAATGACATTATAGTCAATTCTTCAGTA
AAGGTTTATCGCTTTGCATCGAATAATAAAATTGAAAAGCTCTATGGAAC
CATTGCTTGGTCTGGATATACCGACAATTTGAAATATCTTTATGGAATTA
AGCTAGAATTTCCTGTCAATGATGGAACTGATGGAACATTTTCATTTCAA
AGATTATTTTCATGTCAACCTAACTTAGGAATATTAGTTCCTGTTGGGAT
GGTAAAATTACGTGAAAATAAAATTAAACCAGGTAAGCAGCATAGTGAAT
TGTTATCGGATGAATTTGAGGGCTACCAGTCAATCATTAAAATGCTTTTA
GAAAATGAAGGGAATGTGAATCATCTTGATGAAAATAATGAGAGTATTTT
TGATATAGCTCGAAAATTACGAAATGAAAATTTCATTTATCTGATGTTGG
ATCATTGCAAGCAACGATTGGAATTGTCGGTTACAAAATCCATGGAAATC
ATTCTGTCTAATTTGGTCGACTCTGAAAATTGGGATTTGTTATTTCAAGT
AATTGACAATGCCAAAGTTGACGAAATAAGCAATGAATATCTCCTATTTC
TTTGTATTTCCGTTCTTAGAAAACGAAATACGTTAGAGCTTTTTGATGAG
ATTATTTCAATTTGCACAGATAAAAATGCCATTCTTCACAATGGCGAAAC
CTTCGTTACTGCTTTGTTAAAATCTGATATCAACCCAGCTACCATGGTTA
GCATATTGAATAGGAAACTATTCGATATCAATAAAGCAAATCTACACAAA
CAAGTGCCATTAATTCTCGCTTGCGAAAATTTGTTGTCTGTCGTGGTGAA
TGCCCTTCTTAAATTAAATTGCGATTTGAAATATCATAAAAGTCAGGCTA
TTGAATCTGTCGTCTTAGCAAAAAGTAAAGCGGAATTACAAAATGATCAC
GTAAAAGCAAAGAAGGGCTCAGAAATTATCGAACTATTATCAGAATCAGT
TGATTTTAAAGAATTGCACCTTTGTCAGATCTGTATGGATAGGAACAAAG
ATACAGCTTTGAATTGCGGTCATACACTTTGTTCGATTTGCTCAGATAAA
TTATCTGTTTGCCCATTTTGTAGTTTGGCTATTGTTAATAGTCTGAGAAT
ATTTTTATAAATCACTGATTGACTTACCTTTGAAACCAGATAGATATTTT
ATTAACTTTTAATTTTAATTTGTGGATCATGGATTATTATTTGTGTAATT
GGATTTTTATTTGAGTAAATTTCTTATCATCCTTCAA
back to top

protein sequence of SMED30008206-orf-1

>SMED30008206-orf-1 ID=SMED30008206-orf-1|Name=SMED30008206-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=507bp
MDNNENKYLMLPFIEDQFIDVSNLWRSHKEIYNQIGELKIGKKVTTFLKT
ATGQSTMLGKVKWLGRINHIDCVGIDLDEPYRFGNSGKLDYKNNFETRPK
HGVFTPITNVNIVSNFTESIIPSQLKTSNDIIVNSSVKVYRFASNNKIEK
LYGTIAWSGYTDNLKYLYGIKLEFPVNDGTDGTFSFQRLFSCQPNLGILV
PVGMVKLRENKIKPGKQHSELLSDEFEGYQSIIKMLLENEGNVNHLDENN
ESIFDIARKLRNENFIYLMLDHCKQRLELSVTKSMEIILSNLVDSENWDL
LFQVIDNAKVDEISNEYLLFLCISVLRKRNTLELFDEIISICTDKNAILH
NGETFVTALLKSDINPATMVSILNRKLFDINKANLHKQVPLILACENLLS
VVVNALLKLNCDLKYHKSQAIESVVLAKSKAELQNDHVKAKKGSEIIELL
SESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVN
SLRIFL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR036859CAP-Gly_dom_sf
IPR001841Znf_RING
IPR000938CAP-Gly_domain
IPR020683Ankyrin_rpt-contain_dom
IPR013083Znf_RING/FYVE/PHD
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0016874ligase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001841Zinc finger, RING-typeSMARTSM00184ring_2coord: 462..494
e-value: 1.3E-4
score: 31.4
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 462..495
score: 11.28
IPR000938CAP Gly-rich domainSMARTSM01052CAP_GLY_2coord: 40..111
e-value: 0.001
score: 26.1
coord: 133..206
e-value: 2.1E-6
score: 37.3
IPR000938CAP Gly-rich domainPFAMPF01302CAP_GLYcoord: 149..202
e-value: 1.8E-7
score: 31.0
coord: 53..110
e-value: 5.8E-8
score: 32.6
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 226..440
e-value: 2.0E-8
score: 35.8
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 228..415
NoneNo IPR availablePFAMPF13920zf-C3HC4_3coord: 460..497
e-value: 1.1E-6
score: 28.4
NoneNo IPR availablePANTHERPTHR14879CASPASE REGULATOR, RING FINGER DOMAIN-CONTAININGcoord: 435..505
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 451..498
IPR036859CAP Gly-rich domain superfamilyGENE3DG3DSA:2.30.30.190coord: 34..119
e-value: 9.6E-9
score: 36.7
IPR036859CAP Gly-rich domain superfamilyGENE3DG3DSA:2.30.30.190coord: 120..219
e-value: 1.4E-11
score: 45.7
IPR036859CAP Gly-rich domain superfamilySUPERFAMILYSSF74924Cap-Gly domaincoord: 130..208
IPR036859CAP Gly-rich domain superfamilySUPERFAMILYSSF74924Cap-Gly domaincoord: 35..148
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 441..506
e-value: 3.4E-11
score: 44.5