HATPase_c domain-containing protein

Overview
NameHATPase_c domain-containing protein
Smed IDSMED30008204
Length (bp)529
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of HATPase_c domain-containing protein (SMED30008204) t-SNE clustered cells

Violin plots show distribution of expression levels for HATPase_c domain-containing protein (SMED30008204) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of HATPase_c domain-containing protein (SMED30008204) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for HATPase_c domain-containing protein (SMED30008204) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008204

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30008204SMESG000054821.1 SMESG000054819.1 SMESG000028508.1 Contig15693newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30008204SMESG000054821.1 SMESG000054819.1 SMESG000028508.1 Contig15693uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testis primordiumSMED30008204SMESG000054819.1 Contig5941_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of HATPase_c domain-containing protein vs. Ensembl Human
Match: HSP90B1 (heat shock protein 90 beta family member 1 [Source:HGNC Symbol;Acc:HGNC:12028])

HSP 1 Score: 129.798 bits (325), Expect = 1.179e-34
Identity = 59/129 (45.74%), Postives = 83/129 (64.34%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            W+K   LKD IEK  +S+RLT SPC L+AS YGWSGNMERIMKAQAYQ  +++   Y  +QKK  EIN +H LIR +       +D      LA  L++TA LRSGY++ +  ++  ++  +++ S+ I
Sbjct:  621 WMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVLDLAVVLFETATLRSGYLLPDTKAYGDRIERMLRLSLNI 749          
BLAST of HATPase_c domain-containing protein vs. Ensembl Human
Match: HSP90B1 (heat shock protein 90 beta family member 1 [Source:HGNC Symbol;Acc:HGNC:12028])

HSP 1 Score: 92.0485 bits (227), Expect = 1.365e-23
Identity = 41/98 (41.84%), Postives = 61/98 (62.24%), Query Frame = 1
Query:   94 YGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            YGWSGNMERIMKAQAYQ  +++   Y  +QKK  EIN +H LIR +       +D      LA  L++TA LRSGY++ +  ++  ++  +++ S+ I
Sbjct:    3 YGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVLDLAVVLFETATLRSGYLLPDTKAYGDRIERMLRLSLNI 100          
BLAST of HATPase_c domain-containing protein vs. Ensembl Human
Match: HSP90AA1 (heat shock protein 90 alpha family class A member 1 [Source:HGNC Symbol;Acc:HGNC:5253])

HSP 1 Score: 93.9745 bits (232), Expect = 4.354e-22
Identity = 48/123 (39.02%), Postives = 75/123 (60.98%), Query Frame = 1
Query:   19 LKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            L+  +EKV +S RL TSPC ++ STYGW+ NMERIMKAQA + +  +     +  KK LEIN  HS+I  L+      ++    + L   LY+TALL SG+ +++  + + +++ +IK  + I
Sbjct:  701 LEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMG---YMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGI 820          
BLAST of HATPase_c domain-containing protein vs. Ensembl Human
Match: HSP90AA1 (heat shock protein 90 alpha family class A member 1 [Source:HGNC Symbol;Acc:HGNC:5253])

HSP 1 Score: 93.2041 bits (230), Expect = 5.946e-22
Identity = 48/123 (39.02%), Postives = 75/123 (60.98%), Query Frame = 1
Query:   19 LKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            L+  +EKV +S RL TSPC ++ STYGW+ NMERIMKAQA + +  +     +  KK LEIN  HS+I  L+      ++    + L   LY+TALL SG+ +++  + + +++ +IK  + I
Sbjct:  579 LEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMG---YMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGI 698          
BLAST of HATPase_c domain-containing protein vs. Ensembl Human
Match: HSP90AB1 (heat shock protein 90 alpha family class B member 1 [Source:HGNC Symbol;Acc:HGNC:5258])

HSP 1 Score: 90.5077 bits (223), Expect = 6.730e-21
Identity = 46/119 (38.66%), Postives = 73/119 (61.34%), Query Frame = 1
Query:   31 IEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            +EKV IS RL +SPC ++ STYGW+ NMERIMKAQA + +  +   Y +  KK LEIN  H ++  L+      ++    + L   L++TALL SG+ +++  + S +++ +IK  + I
Sbjct:  575 VEKVTISNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTM--GYMM-AKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFETALLSSGFSLEDPQTHSNRIYRMIKLGLGI 690          
BLAST of HATPase_c domain-containing protein vs. Ensembl Celegans
Match: enpl-1 (Endoplasmin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q22235])

HSP 1 Score: 122.094 bits (305), Expect = 2.254e-32
Identity = 55/129 (42.64%), Postives = 83/129 (64.34%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            WLK T LKD IEK  +S+RL  SP  L+AS+YGWSGNMERIMK+QAY K+++  Q +   QKK  EIN +H +I+ L    +  ++       AK L++TA LRSG+ + +   F+ ++  +++ S+ +
Sbjct:  526 WLKETALKDLIEKAVVSQRLVKSPSALVASSYGWSGNMERIMKSQAYAKAKDPTQDFYATQKKTFEINPRHPVIKELLKRVTASEEDTTAASTAKLLFETATLRSGFSLQDQVGFADRIEAVLRQSLDV 654          
BLAST of HATPase_c domain-containing protein vs. Ensembl Celegans
Match: enpl-1 (Endoplasmin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q22235])

HSP 1 Score: 122.094 bits (305), Expect = 2.254e-32
Identity = 55/129 (42.64%), Postives = 83/129 (64.34%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            WLK T LKD IEK  +S+RL  SP  L+AS+YGWSGNMERIMK+QAY K+++  Q +   QKK  EIN +H +I+ L    +  ++       AK L++TA LRSG+ + +   F+ ++  +++ S+ +
Sbjct:  526 WLKETALKDLIEKAVVSQRLVKSPSALVASSYGWSGNMERIMKSQAYAKAKDPTQDFYATQKKTFEINPRHPVIKELLKRVTASEEDTTAASTAKLLFETATLRSGFSLQDQVGFADRIEAVLRQSLDV 654          
BLAST of HATPase_c domain-containing protein vs. Ensembl Celegans
Match: enpl-1 (Endoplasmin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q22235])

HSP 1 Score: 122.094 bits (305), Expect = 2.254e-32
Identity = 55/129 (42.64%), Postives = 83/129 (64.34%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            WLK T LKD IEK  +S+RL  SP  L+AS+YGWSGNMERIMK+QAY K+++  Q +   QKK  EIN +H +I+ L    +  ++       AK L++TA LRSG+ + +   F+ ++  +++ S+ +
Sbjct:  526 WLKETALKDLIEKAVVSQRLVKSPSALVASSYGWSGNMERIMKSQAYAKAKDPTQDFYATQKKTFEINPRHPVIKELLKRVTASEEDTTAASTAKLLFETATLRSGFSLQDQVGFADRIEAVLRQSLDV 654          
BLAST of HATPase_c domain-containing protein vs. Ensembl Celegans
Match: enpl-1 (Endoplasmin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q22235])

HSP 1 Score: 122.094 bits (305), Expect = 2.254e-32
Identity = 55/129 (42.64%), Postives = 83/129 (64.34%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            WLK T LKD IEK  +S+RL  SP  L+AS+YGWSGNMERIMK+QAY K+++  Q +   QKK  EIN +H +I+ L    +  ++       AK L++TA LRSG+ + +   F+ ++  +++ S+ +
Sbjct:  526 WLKETALKDLIEKAVVSQRLVKSPSALVASSYGWSGNMERIMKSQAYAKAKDPTQDFYATQKKTFEINPRHPVIKELLKRVTASEEDTTAASTAKLLFETATLRSGFSLQDQVGFADRIEAVLRQSLDV 654          
BLAST of HATPase_c domain-containing protein vs. Ensembl Celegans
Match: enpl-1 (Endoplasmin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q22235])

HSP 1 Score: 122.094 bits (305), Expect = 2.254e-32
Identity = 55/129 (42.64%), Postives = 83/129 (64.34%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            WLK T LKD IEK  +S+RL  SP  L+AS+YGWSGNMERIMK+QAY K+++  Q +   QKK  EIN +H +I+ L    +  ++       AK L++TA LRSG+ + +   F+ ++  +++ S+ +
Sbjct:  526 WLKETALKDLIEKAVVSQRLVKSPSALVASSYGWSGNMERIMKSQAYAKAKDPTQDFYATQKKTFEINPRHPVIKELLKRVTASEEDTTAASTAKLLFETATLRSGFSLQDQVGFADRIEAVLRQSLDV 654          
BLAST of HATPase_c domain-containing protein vs. Ensembl Fly
Match: Gp93 (gene:FBgn0039562 transcript:FBtr0085254)

HSP 1 Score: 119.013 bits (297), Expect = 3.193e-31
Identity = 50/129 (38.76%), Postives = 83/129 (64.34%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            WL    LKD I K ++SERL+ SPC L+A  +GW+GNMER+  + A+QKS++  +TY +NQKK LEIN +H L+R L       +  +  + +A  ++ TA LRSGY++   + F+  + ++++ ++ +
Sbjct:  618 WLNDVALKDQISKAQVSERLSNSPCALVAGVFGWTGNMERLAMSNAHQKSDDPQRTYYLNQKKTLEINPRHPLMRELLRRVEADEADDTAKDMAVMMFRTATLRSGYMLQETSQFADSIEQMMRQTLGV 746          
BLAST of HATPase_c domain-containing protein vs. Ensembl Fly
Match: Hsp83 (gene:FBgn0001233 transcript:FBtr0332873)

HSP 1 Score: 86.2705 bits (212), Expect = 9.278e-20
Identity = 43/123 (34.96%), Postives = 71/123 (57.72%), Query Frame = 1
Query:   19 LKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            L + +EKV +S RL  SPC ++ S +GWS NMERIMKAQA + +      Y   +K+ LEIN  H ++  L+      ++    + L   L++T+LL SG+ +D+    + +++ +IK  + I
Sbjct:  564 LDNKVEKVVVSNRLVDSPCCIVTSQFGWSANMERIMKAQALRDT--ATMGYMAGKKQ-LEINPDHPIVETLRQKADADKNDKAVKDLVILLFETSLLSSGFSLDSPQVHASRIYRMIKLGLGI 683          
BLAST of HATPase_c domain-containing protein vs. Ensembl Fly
Match: Hsp83 (gene:FBgn0001233 transcript:FBtr0073040)

HSP 1 Score: 86.2705 bits (212), Expect = 9.278e-20
Identity = 43/123 (34.96%), Postives = 71/123 (57.72%), Query Frame = 1
Query:   19 LKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            L + +EKV +S RL  SPC ++ S +GWS NMERIMKAQA + +      Y   +K+ LEIN  H ++  L+      ++    + L   L++T+LL SG+ +D+    + +++ +IK  + I
Sbjct:  564 LDNKVEKVVVSNRLVDSPCCIVTSQFGWSANMERIMKAQALRDT--ATMGYMAGKKQ-LEINPDHPIVETLRQKADADKNDKAVKDLVILLFETSLLSSGFSLDSPQVHASRIYRMIKLGLGI 683          
BLAST of HATPase_c domain-containing protein vs. Ensembl Zebrafish
Match: hsp90b1 (heat shock protein 90, beta (grp94), member 1 [Source:ZFIN;Acc:ZDB-GENE-031002-1])

HSP 1 Score: 125.946 bits (315), Expect = 1.862e-33
Identity = 58/131 (44.27%), Postives = 85/131 (64.89%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKIPL 393
            W+K   LK+ IEK  +S+RLT SPC L+AS YGWSGNMERIMKAQAYQ  +++   Y  +QKK LEIN +H LI+ +    +   +      LA  L++TA LRSGY + +  ++ +++  +++ SM + L
Sbjct:  621 WMKDKALKEQIEKAVLSQRLTNSPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTLEINPKHPLIKEMLRRVNEDAEDKTAADLAVVLFETATLRSGYQLQDTKAYGERIERMLRLSMNVDL 751          
BLAST of HATPase_c domain-containing protein vs. Ensembl Zebrafish
Match: hsp90b1 (heat shock protein 90, beta (grp94), member 1 [Source:ZFIN;Acc:ZDB-GENE-031002-1])

HSP 1 Score: 125.561 bits (314), Expect = 2.120e-33
Identity = 58/131 (44.27%), Postives = 85/131 (64.89%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKIPL 393
            W+K   LK+ IEK  +S+RLT SPC L+AS YGWSGNMERIMKAQAYQ  +++   Y  +QKK LEIN +H LI+ +    +   +      LA  L++TA LRSGY + +  ++ +++  +++ SM + L
Sbjct:  622 WMKDKALKEQIEKAVLSQRLTNSPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTLEINPKHPLIKEMLRRVNEDAEDKTAADLAVVLFETATLRSGYQLQDTKAYGERIERMLRLSMNVDL 752          
BLAST of HATPase_c domain-containing protein vs. Ensembl Zebrafish
Match: hsp90aa1.2 (heat shock protein 90, alpha (cytosolic), class A member 1, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-031001-3])

HSP 1 Score: 92.4337 bits (228), Expect = 7.722e-22
Identity = 45/119 (37.82%), Postives = 72/119 (60.50%), Query Frame = 1
Query:   31 IEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            +EKV +S RL +SPC ++ STYGW+ NMERIMKAQA + +  +     +  KK LEIN  H ++  L+      ++    + L   L++TALL SG+ +D+  + S +++ +IK  + I
Sbjct:  585 VEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMG---YMAAKKHLEINPDHPIVETLRQKAEADKNDKSVKDLVILLFETALLSSGFTLDDPQTHSNRIYRMIKLGLGI 700          
BLAST of HATPase_c domain-containing protein vs. Ensembl Zebrafish
Match: hsp90ab1 (heat shock protein 90, alpha (cytosolic), class A member 1, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-031001-3])

HSP 1 Score: 91.2781 bits (225), Expect = 2.224e-21
Identity = 46/119 (38.66%), Postives = 73/119 (61.34%), Query Frame = 1
Query:   31 IEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            +EKV +S RL +SPC ++ STYGW+ NMERIMKAQA + +  +   Y +  KK LEIN  H ++  L+      ++    + L   L++TALL SG+ +D+  + S +++ +IK  + I
Sbjct:  574 VEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTM--GYMM-AKKHLEINPDHPIMETLRQKAEADKNDKAVKDLVILLFETALLSSGFSLDDPQTHSNRIYRMIKLGLGI 689          
BLAST of HATPase_c domain-containing protein vs. Ensembl Zebrafish
Match: hsp90ab1 (heat shock protein 90, alpha (cytosolic), class A member 1, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-031001-3])

HSP 1 Score: 91.2781 bits (225), Expect = 2.224e-21
Identity = 46/119 (38.66%), Postives = 73/119 (61.34%), Query Frame = 1
Query:   31 IEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            +EKV +S RL +SPC ++ STYGW+ NMERIMKAQA + +  +   Y +  KK LEIN  H ++  L+      ++    + L   L++TALL SG+ +D+  + S +++ +IK  + I
Sbjct:  574 VEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTM--GYMM-AKKHLEINPDHPIMETLRQKAEADKNDKAVKDLVILLFETALLSSGFSLDDPQTHSNRIYRMIKLGLGI 689          
BLAST of HATPase_c domain-containing protein vs. Ensembl Xenopus
Match: hsp90b1 (heat shock protein 90kDa beta (Grp94), member 1 [Source:NCBI gene;Acc:734089])

HSP 1 Score: 129.798 bits (325), Expect = 1.100e-34
Identity = 61/131 (46.56%), Postives = 83/131 (63.36%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKIPL 393
            W+K   LKD IEK  +S+RLT SPC L+AS YGWSGNMERIMKAQAYQ  +++   Y   QKK  EIN +H LI+ +       +D      LA  L++TA LRSGY + +  S+  ++  +++ S+KI L
Sbjct:  620 WMKEKALKDQIEKAVVSQRLTQSPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYSGQKKTFEINPRHPLIKEMLQRVKENEDDKTVADLAVVLFETATLRSGYHLPDTKSYGDRIERMLRLSLKIDL 750          
BLAST of HATPase_c domain-containing protein vs. Ensembl Xenopus
Match: hsp90b1 (heat shock protein 90kDa beta (Grp94), member 1 [Source:NCBI gene;Acc:734089])

HSP 1 Score: 129.413 bits (324), Expect = 1.418e-34
Identity = 61/131 (46.56%), Postives = 83/131 (63.36%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKIPL 393
            W+K   LKD IEK  +S+RLT SPC L+AS YGWSGNMERIMKAQAYQ  +++   Y   QKK  EIN +H LI+ +       +D      LA  L++TA LRSGY + +  S+  ++  +++ S+KI L
Sbjct:  593 WMKEKALKDQIEKAVVSQRLTQSPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYSGQKKTFEINPRHPLIKEMLQRVKENEDDKTVADLAVVLFETATLRSGYHLPDTKSYGDRIERMLRLSLKIDL 723          
BLAST of HATPase_c domain-containing protein vs. Ensembl Xenopus
Match: hsp90b1 (heat shock protein 90kDa beta (Grp94), member 1 [Source:NCBI gene;Acc:734089])

HSP 1 Score: 129.413 bits (324), Expect = 1.510e-34
Identity = 61/131 (46.56%), Postives = 83/131 (63.36%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKIPL 393
            W+K   LKD IEK  +S+RLT SPC L+AS YGWSGNMERIMKAQAYQ  +++   Y   QKK  EIN +H LI+ +       +D      LA  L++TA LRSGY + +  S+  ++  +++ S+KI L
Sbjct:  613 WMKEKALKDQIEKAVVSQRLTQSPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYSGQKKTFEINPRHPLIKEMLQRVKENEDDKTVADLAVVLFETATLRSGYHLPDTKSYGDRIERMLRLSLKIDL 743          
BLAST of HATPase_c domain-containing protein vs. Ensembl Xenopus
Match: hsp90b1 (heat shock protein 90kDa beta (Grp94), member 1 [Source:NCBI gene;Acc:734089])

HSP 1 Score: 129.413 bits (324), Expect = 1.575e-34
Identity = 61/131 (46.56%), Postives = 83/131 (63.36%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKIPL 393
            W+K   LKD IEK  +S+RLT SPC L+AS YGWSGNMERIMKAQAYQ  +++   Y   QKK  EIN +H LI+ +       +D      LA  L++TA LRSGY + +  S+  ++  +++ S+KI L
Sbjct:  591 WMKEKALKDQIEKAVVSQRLTQSPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYSGQKKTFEINPRHPLIKEMLQRVKENEDDKTVADLAVVLFETATLRSGYHLPDTKSYGDRIERMLRLSLKIDL 721          
BLAST of HATPase_c domain-containing protein vs. Ensembl Xenopus
Match: hsp90b1 (heat shock protein 90kDa beta (Grp94), member 1 [Source:NCBI gene;Acc:734089])

HSP 1 Score: 125.176 bits (313), Expect = 4.227e-33
Identity = 61/131 (46.56%), Postives = 83/131 (63.36%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKIPL 393
            W+K   LKD IEK  +S+RLT SPC L+AS YGWSGNMERIMKAQAYQ  +++   Y   QKK  EIN +H LI+ +       +D      LA  L++TA LRSGY + +  S+  ++  +++ S+KI L
Sbjct:  611 WMKEKALKDQIEKAVVSQRLTQSPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYSGQKKTFEINPRHPLIKEMLQ--RENEDDKTVADLAVVLFETATLRSGYHLPDTKSYGDRIERMLRLSLKIDL 739          
BLAST of HATPase_c domain-containing protein vs. Ensembl Mouse
Match: Hsp90b1 (heat shock protein 90, beta (Grp94), member 1 [Source:MGI Symbol;Acc:MGI:98817])

HSP 1 Score: 130.183 bits (326), Expect = 6.535e-35
Identity = 59/129 (45.74%), Postives = 83/129 (64.34%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            W+K   LKD IEK  +S+RLT SPC L+AS YGWSGNMERIMKAQAYQ  +++   Y  +QKK  EIN +H LIR +       +D      LA  L++TA LRSGY++ +  ++  ++  +++ S+ I
Sbjct:  621 WMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVMDLAVVLFETATLRSGYLLPDTKAYGDRIERMLRLSLNI 749          
BLAST of HATPase_c domain-containing protein vs. Ensembl Mouse
Match: Hsp90b1 (heat shock protein 90, beta (Grp94), member 1 [Source:MGI Symbol;Acc:MGI:98817])

HSP 1 Score: 104.76 bits (260), Expect = 1.060e-26
Identity = 46/77 (59.74%), Postives = 56/77 (72.73%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHL 231
            W+K   LKD IEK  +S+RLT SPC L+AS YGWSGNMERIMKAQAYQ  +++   Y  +QKK  EIN +H LIR +
Sbjct:  297 WMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDM 373          
BLAST of HATPase_c domain-containing protein vs. Ensembl Mouse
Match: Hsp90aa1 (heat shock protein 90, alpha (cytosolic), class A member 1 [Source:MGI Symbol;Acc:MGI:96250])

HSP 1 Score: 93.5893 bits (231), Expect = 3.967e-22
Identity = 48/123 (39.02%), Postives = 75/123 (60.98%), Query Frame = 1
Query:   19 LKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            L+  +EKV +S RL TSPC ++ STYGW+ NMERIMKAQA + +  +     +  KK LEIN  HS+I  L+      ++    + L   LY+TALL SG+ +++  + + +++ +IK  + I
Sbjct:  580 LEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMG---YMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGI 699          
BLAST of HATPase_c domain-containing protein vs. Ensembl Mouse
Match: Hsp90aa1 (heat shock protein 90, alpha (cytosolic), class A member 1 [Source:MGI Symbol;Acc:MGI:96250])

HSP 1 Score: 93.5893 bits (231), Expect = 3.967e-22
Identity = 48/123 (39.02%), Postives = 75/123 (60.98%), Query Frame = 1
Query:   19 LKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            L+  +EKV +S RL TSPC ++ STYGW+ NMERIMKAQA + +  +     +  KK LEIN  HS+I  L+      ++    + L   LY+TALL SG+ +++  + + +++ +IK  + I
Sbjct:  580 LEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMG---YMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGI 699          
BLAST of HATPase_c domain-containing protein vs. Ensembl Mouse
Match: Hsp90ab1 (heat shock protein 90 alpha (cytosolic), class B member 1 [Source:MGI Symbol;Acc:MGI:96247])

HSP 1 Score: 90.5077 bits (223), Expect = 4.446e-21
Identity = 46/119 (38.66%), Postives = 73/119 (61.34%), Query Frame = 1
Query:   31 IEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            +EKV IS RL +SPC ++ STYGW+ NMERIMKAQA + +  +   Y +  KK LEIN  H ++  L+      ++    + L   L++TALL SG+ +++  + S +++ +IK  + I
Sbjct:  575 VEKVTISNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTM--GYMM-AKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFETALLSSGFSLEDPQTHSNRIYRMIKLGLGI 690          
BLAST of HATPase_c domain-containing protein vs. UniProt/SwissProt
Match: sp|P08712|ENPL_MESAU (Endoplasmin (Fragment) OS=Mesocricetus auratus OX=10036 GN=HSP90B1 PE=1 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 2.876e-35
Identity = 59/129 (45.74%), Postives = 84/129 (65.12%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            W+K   LKD IEK  +S+RLT SPC L+AS YGWSGNMERIMKAQAYQ  +++   Y  +QKK  EIN +H LIR +       +D      LA  L++TA LRSGY++ +  +++ ++  +++ S+ I
Sbjct:  218 WMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRVKEDEDDKTVLDLAVVLFETATLRSGYLLPDTKAYADRIERMLRLSLNI 346          
BLAST of HATPase_c domain-containing protein vs. UniProt/SwissProt
Match: sp|Q95M18|ENPL_BOVIN (Endoplasmin OS=Bos taurus OX=9913 GN=HSP90B1 PE=2 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 4.446e-34
Identity = 59/129 (45.74%), Postives = 83/129 (64.34%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            W+K   LKD IEK  +S+RLT SPC L+AS YGWSGNMERIMKAQAYQ  +++   Y  +QKK  EIN +H LIR +       +D      LA  L++TA LRSGY++ +  ++  ++  +++ S+ I
Sbjct:  621 WMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRVKEDEDDKTVSDLAVVLFETATLRSGYLLPDTKAYGDRIERMLRLSLNI 749          
BLAST of HATPase_c domain-containing protein vs. UniProt/SwissProt
Match: sp|P08113|ENPL_MOUSE (Endoplasmin OS=Mus musculus OX=10090 GN=Hsp90b1 PE=1 SV=2)

HSP 1 Score: 130.183 bits (326), Expect = 4.571e-34
Identity = 59/129 (45.74%), Postives = 83/129 (64.34%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            W+K   LKD IEK  +S+RLT SPC L+AS YGWSGNMERIMKAQAYQ  +++   Y  +QKK  EIN +H LIR +       +D      LA  L++TA LRSGY++ +  ++  ++  +++ S+ I
Sbjct:  621 WMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVMDLAVVLFETATLRSGYLLPDTKAYGDRIERMLRLSLNI 749          
BLAST of HATPase_c domain-containing protein vs. UniProt/SwissProt
Match: sp|Q29092|ENPL_PIG (Endoplasmin OS=Sus scrofa OX=9823 GN=HSP90B1 PE=2 SV=3)

HSP 1 Score: 129.798 bits (325), Expect = 5.294e-34
Identity = 59/129 (45.74%), Postives = 83/129 (64.34%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            W+K   LKD IEK  +S+RLT SPC L+AS YGWSGNMERIMKAQAYQ  +++   Y  +QKK  EIN +H LIR +       +D      LA  L++TA LRSGY++ +  ++  ++  +++ S+ I
Sbjct:  621 WMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRVKEDEDDKTVSDLAVVLFETATLRSGYLLPDTKAYGDRIERMLRLSLNI 749          
BLAST of HATPase_c domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5R6F7|ENPL_PONAB (Endoplasmin OS=Pongo abelii OX=9601 GN=HSP90B1 PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 5.611e-34
Identity = 59/129 (45.74%), Postives = 83/129 (64.34%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            W+K   LKD IEK  +S+RLT SPC L+AS YGWSGNMERIMKAQAYQ  +++   Y  +QKK  EIN +H LIR +       +D      LA  L++TA LRSGY++ +  ++  ++  +++ S+ I
Sbjct:  621 WMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVLDLAVVLFETATLRSGYLLPDTKAYGDRIERMLRLSLNI 749          
BLAST of HATPase_c domain-containing protein vs. TrEMBL
Match: A0A2R4NBU5 (Heat shock protein 902 OS=Dugesia japonica OX=6161 GN=hsp902 PE=2 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 6.122e-68
Identity = 128/176 (72.73%), Postives = 147/176 (83.52%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKIPLXXXXXXXXXXXXXTPRQTGTEKLNNENIAPKFDEENKSDKSSAKD 528
            WLK+  LKDY+EKVEISERLT+SPCVLIA+TYGWSGNMERIMKAQAYQKS+EVMQ YQVNQKKILEIN +H LIR LKYS +  Q++NETR LAK LYDTALLRSGYI++NVASFSKQV  II+TSMKIP D++IIDDEEI+EDT ++  TEK  +EN         K+DK SAKD
Sbjct:  633 WLKTDVLKDYVEKVEISERLTSSPCVLIATTYGWSGNMERIMKAQAYQKSDEVMQNYQVNQKKILEINPRHPLIRQLKYSLNKNQNINETRALAKLLYDTALLRSGYILNNVASFSKQVDTIIRTSMKIPHDENIIDDEEIMEDTFKEPVTEKSEDEN--------KKNDKFSAKD 800          
BLAST of HATPase_c domain-containing protein vs. TrEMBL
Match: R7U2A8 (HATPase_c domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_159587 PE=3 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 1.934e-39
Identity = 67/131 (51.15%), Postives = 94/131 (71.76%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKIPL 393
            W+K   LKD IEK  ISERLT SPC L+AS+YGWSGNMERIMKAQAYQK+++   T+  NQKK LE+N +H L++ LK      +D   T+ LA+ L++TA LRSGY + + A+F+ ++  +++ S+ +PL
Sbjct:  618 WMKEDALKDKIEKAVISERLTESPCALVASSYGWSGNMERIMKAQAYQKADDTSSTFYANQKKTLEVNVRHPLVKELKERMETDKDDQTTKDLAEVLFETATLRSGYTLQDTAAFAGRIERMLRLSVDVPL 748          
BLAST of HATPase_c domain-containing protein vs. TrEMBL
Match: A0A2T7NSL7 (HATPase_c domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_14649 PE=3 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 8.781e-37
Identity = 65/131 (49.62%), Postives = 92/131 (70.23%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKIPL 393
            WLK + LK+ IEK  ISERL+TSPC L+AS YGWSGNMERIM+AQAY K ++  Q +  NQKK LE+N +H LI+ LK      +D    + LA  +++TA LRSGY++ + A F+++V  +++ S+ +PL
Sbjct:  613 WLKDSALKEKIEKATISERLSTSPCALVASQYGWSGNMERIMRAQAYAKQQDPSQQFYSNQKKTLEVNPRHPLIKELKARVEVNKDDETAKDLAVVMFETATLRSGYLLPDTAGFAERVERMLRLSLDVPL 743          
BLAST of HATPase_c domain-containing protein vs. TrEMBL
Match: A0A0N4UU82 (Uncharacterized protein OS=Enterobius vermicularis OX=51028 GN=EVEC_LOCUS647 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.572e-36
Identity = 61/131 (46.56%), Postives = 91/131 (69.47%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKIPL 393
            WLK   LKD IEK  +S+RLT SP  L+AS+YGWSGNMERIMK+QAY KS++  Q +  NQKK  EIN +H +I+ L    ++ Q+  +    AK L++TA LRSG+ + +   F++++ ++I+ +M++PL
Sbjct:   91 WLKDKALKDQIEKAVVSQRLTKSPSALVASSYGWSGNMERIMKSQAYSKSQDPTQEFYANQKKTFEINPRHPVIKELLRRVTDDQEDPKALTTAKLLFETATLRSGFALKDQLGFAERIEQVIRQTMEVPL 221          
BLAST of HATPase_c domain-containing protein vs. TrEMBL
Match: T1EM75 (HATPase_c domain-containing protein OS=Helobdella robusta OX=6412 GN=20197675 PE=3 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 3.279e-36
Identity = 68/131 (51.91%), Postives = 90/131 (68.70%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKIPL 393
            W+K   LKD IEK  ISERLTTSPC L+AS++GWSGNMERIMK+QAYQK+ +    Y  NQKK LEIN  H LI+ LK      ++   T  LA  L++TA LRSGY + + A F++++  +++ SM +PL
Sbjct:  598 WMKDDALKDKIEKAVISERLTTSPCALVASSFGWSGNMERIMKSQAYQKTNDPNNQYYANQKKTLEINPYHPLIKVLKNRLDTDKENPTTADLAVVLFETATLRSGYSVGDTAQFAERIERMLRLSMNVPL 728          
BLAST of HATPase_c domain-containing protein vs. Ensembl Cavefish
Match: hsp90b1 (heat shock protein 90, beta (grp94), member 1 [Source:ZFIN;Acc:ZDB-GENE-031002-1])

HSP 1 Score: 128.642 bits (322), Expect = 1.666e-34
Identity = 63/132 (47.73%), Postives = 88/132 (66.67%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRH-LKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKIPL 393
            W+K   LKD IEK  +S+RLT SPC L+AS YGWSGNMERIMKAQAYQ  +++   Y  +QKK LEIN +H LI+  LK    N +D   +  LA  L++TA LRSGY + +  ++ +++  +++ SM + L
Sbjct:  616 WMKDNALKDKIEKAVLSQRLTNSPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTLEINPKHPLIKEMLKRVQDNAEDQTAS-DLAVVLFETATLRSGYQLADTKAYGERIERMLRLSMNVDL 746          
BLAST of HATPase_c domain-containing protein vs. Ensembl Cavefish
Match: hsp90aa1.2 (Astyanax mexicanus heat shock protein HSP 90-alpha 1-like (LOC103024454), mRNA. [Source:RefSeq mRNA;Acc:NM_001291257])

HSP 1 Score: 93.2041 bits (230), Expect = 3.812e-22
Identity = 47/123 (38.21%), Postives = 74/123 (60.16%), Query Frame = 1
Query:   19 LKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            L+  +EKV +S RL +SPC ++ STYGW+ NMERIMKAQA + +  +     +  KK LEIN  H +I  L+      ++    + L   L++TALL SG+ +D+  + S +++ +IK  + I
Sbjct:  578 LEKKVEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMG---YMAAKKHLEINPDHPIIETLRQKAEADKNDKSVKDLVILLFETALLSSGFTLDDPQTHSNRIYRMIKLGLGI 697          
BLAST of HATPase_c domain-containing protein vs. Ensembl Cavefish
Match: hsp90aa1.2 (Astyanax mexicanus heat shock protein HSP 90-alpha 1-like (LOC103024454), mRNA. [Source:RefSeq mRNA;Acc:NM_001291257])

HSP 1 Score: 93.2041 bits (230), Expect = 3.923e-22
Identity = 47/123 (38.21%), Postives = 74/123 (60.16%), Query Frame = 1
Query:   19 LKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            L+  +EKV +S RL +SPC ++ STYGW+ NMERIMKAQA + +  +     +  KK LEIN  H +I  L+      ++    + L   L++TALL SG+ +D+  + S +++ +IK  + I
Sbjct:  577 LEKKVEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMG---YMAAKKHLEINPDHPIIETLRQKAEADKNDKSVKDLVILLFETALLSSGFTLDDPQTHSNRIYRMIKLGLGI 696          
BLAST of HATPase_c domain-containing protein vs. Ensembl Cavefish
Match: hsp90ab1 (heat shock protein 90 alpha family class B member 1 [Source:NCBI gene;Acc:103047517])

HSP 1 Score: 91.2781 bits (225), Expect = 1.762e-21
Identity = 46/119 (38.66%), Postives = 73/119 (61.34%), Query Frame = 1
Query:   31 IEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            +EKV +S RL +SPC ++ STYGW+ NMERIMKAQA + +  +   Y +  KK LEIN  H ++  L+      ++    + L   L++TALL SG+ +D+  + S +++ +IK  + I
Sbjct:  575 VEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTM--GYMM-AKKHLEINPDHPIMETLRQKAEADKNDKAVKDLVILLFETALLSSGFSLDDPQTHSNRIYRMIKLGLGI 690          
BLAST of HATPase_c domain-containing protein vs. Ensembl Cavefish
Match: hsp90aa1.2 (Astyanax mexicanus heat shock protein HSP 90-alpha 1-like (LOC103024454), mRNA. [Source:RefSeq mRNA;Acc:NM_001291257])

HSP 1 Score: 87.8113 bits (216), Expect = 2.690e-20
Identity = 43/119 (36.13%), Postives = 71/119 (59.66%), Query Frame = 1
Query:   31 IEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            IEKV +S RL  SPC ++ STYGW+ NMERIMK+QA + +  +     +  KK LEIN  H ++  L+      ++    + L   L++TALL SG+ +++  + + +++ +IK  + I
Sbjct:  574 IEKVTVSNRLVASPCCIVTSTYGWTANMERIMKSQALRDNSTMG---YMTAKKHLEINPLHPIVETLREKAEADKNDKAVKDLVILLFETALLSSGFTLEDPQTHANRIYRMIKLGLGI 689          
BLAST of HATPase_c domain-containing protein vs. Ensembl Sea Lamprey
Match: hsp90b1 (heat shock protein 90, beta (grp94), member 1 [Source:ZFIN;Acc:ZDB-GENE-031002-1])

HSP 1 Score: 119.013 bits (297), Expect = 7.709e-32
Identity = 55/121 (45.45%), Postives = 78/121 (64.46%), Query Frame = 1
Query:   31 IEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKIPL 393
            IEK  +S+RL  SPC L+AS YGWSGNMERIMKAQAYQ  ++    +  +QKK  EIN +H LI+ L       ++    + LA  L++TA LRSGY++ +  SFS ++  +++ S+ I L
Sbjct:  601 IEKATVSQRLLGSPCALVASQYGWSGNMERIMKAQAYQTGKDAASNFYGSQKKTFEINPRHPLIKELLTRVQASEEDATAKDLALVLFETATLRSGYLLQDTRSFSDRIERMLRVSLNIDL 721          
BLAST of HATPase_c domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003399.1 (pep scaffold:Pmarinus_7.0:GL479675:6143:15195:1 gene:ENSPMAG00000002912.1 transcript:ENSPMAT00000003399.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.2041 bits (230), Expect = 7.309e-23
Identity = 46/119 (38.66%), Postives = 72/119 (60.50%), Query Frame = 1
Query:   31 IEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            +EKV +S RL  SPC ++ STYGW+ NMERIMKAQA + S  +     +  KK LEIN +H ++  L+      ++    + L   L++TALL SG+ +D+  + S +++ +IK  + I
Sbjct:  553 VEKVTVSNRLVASPCCIVTSTYGWTANMERIMKAQALRDSSTMG---YMAAKKHLEINPEHPIVETLRQKAEADKNDKSVKDLIILLFETALLSSGFSLDDPQTHSNRIYRMIKLGLGI 668          
BLAST of HATPase_c domain-containing protein vs. Ensembl Yeast
Match: HSP82 (Hsp90 chaperone; redundant in function with Hsc82p; required for pheromone signaling, negative regulation of Hsf1p; docks with Tom70p for mitochondrial preprotein delivery; promotes telomerase DNA binding, nucleotide addition; protein abundance increases in response to DNA replication stress; contains two acid-rich unstructured regions that promote solubility of chaperone-substrate complexes; HSP82 has a paralog, HSC82, that arose from the whole genome duplication [Source:SGD;Acc:S000006161])

HSP 1 Score: 83.9593 bits (206), Expect = 7.135e-20
Identity = 46/124 (37.10%), Postives = 72/124 (58.06%), Query Frame = 1
Query:   19 LKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRK-LAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            L D +EKV +S +L  +P  +    +GWS NMERIMKAQA +   +   +  ++ KK  EI+ +  +I+ LK     G   ++T K L K LY+TALL SG+ +D   SF+ +++ +I   + I
Sbjct:  558 LGDQVEKVVVSYKLLDAPAAIRTGQFGWSANMERIMKAQALR---DSSMSSYMSSKKTFEISPKSPIIKELKKRVDEGGAQDKTVKDLTKLLYETALLTSGFSLDEPTSFASRINRLISLGLNI 678          
BLAST of HATPase_c domain-containing protein vs. Ensembl Yeast
Match: HSC82 (Cytoplasmic chaperone of the Hsp90 family; plays a role in determining prion variants; redundant in function and nearly identical with Hsp82p, and together they are essential; expressed constitutively at 10-fold higher basal levels than HSP82 and induced 2-3 fold by heat shock; contains two acid-rich unstructured regions that promote the solubility of chaperone-substrate complexes; HSC82 has a paralog, HSP82, that arose from the whole genome duplication [Source:SGD;Acc:S000004798])

HSP 1 Score: 78.9518 bits (193), Expect = 4.632e-18
Identity = 43/124 (34.68%), Postives = 71/124 (57.26%), Query Frame = 1
Query:   19 LKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRK-LAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            L D +EKV +S +L  +P  +    +GWS NMERIMKAQA +   +   +  ++ KK  EI+ +  +I+ LK     G   ++T K L   L++TALL SG+ ++   SF+ +++ +I   + I
Sbjct:  554 LGDQVEKVVVSYKLLDAPAAIRTGQFGWSANMERIMKAQALR---DSSMSSYMSSKKTFEISPKSPIIKELKKRVDEGGAQDKTVKDLTNLLFETALLTSGFSLEEPTSFASRINRLISLGLNI 674          
BLAST of HATPase_c domain-containing protein vs. Ensembl Nematostella
Match: EDO45344 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT97])

HSP 1 Score: 134.42 bits (337), Expect = 5.863e-37
Identity = 61/131 (46.56%), Postives = 86/131 (65.65%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKIPL 393
            WLK   LKD IEK  ISERL  SPC L+AS+YGWSGNMERIM++QAY KS +    Y   QKK LE+N +H L++ L       +D    + L++ L++TA LRSGY++ + A F+ ++  +++ SM + L
Sbjct:  638 WLKEDALKDQIEKATISERLHDSPCALVASSYGWSGNMERIMRSQAYAKSSDPSNEYYATQKKTLEVNPRHPLVKQLLKRVEENKDDQTAKDLSRILFETATLRSGYLVKDSADFAGRIERMLRLSMGVDL 768          
BLAST of HATPase_c domain-containing protein vs. Ensembl Nematostella
Match: HSP90 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ66])

HSP 1 Score: 71.2478 bits (173), Expect = 5.513e-15
Identity = 42/119 (35.29%), Postives = 70/119 (58.82%), Query Frame = 1
Query:   31 IEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            IEKV +S RL +SPC ++ S +GW+ NMERIMKAQA + +  +     +  KK LEIN  H+++  L+      ++    + L   LY+T+LL SG+ +++    S +++ +I   + I
Sbjct:  577 IEKVVVSSRLVSSPCCIVTSQFGWTANMERIMKAQALRDNSTMG---YMAAKKHLEINPDHAIMDSLRKKVEADKNDKSLKDLVMLLYETSLLTSGFTLEDPQVHSGRIYRMIGLGLGI 692          
BLAST of HATPase_c domain-containing protein vs. Ensembl Medaka
Match: hsp90b1 (heat shock protein 90 beta family member 1 [Source:NCBI gene;Acc:101166123])

HSP 1 Score: 133.265 bits (334), Expect = 4.274e-36
Identity = 61/131 (46.56%), Postives = 87/131 (66.41%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKIPL 393
            WLK   LKD IEK  +S+RLT SPC L+AS YGWSGNMERIMKAQAYQ  +++  +Y  +QKK LEIN +H LI+ +    ++  +      LA  L++TA LRSGY + +  ++  ++  +++ SM +PL
Sbjct:  625 WLKDKALKDKIEKAVLSQRLTDSPCALVASQYGWSGNMERIMKAQAYQTGKDISTSYYASQKKTLEINPKHPLIKQMLGRVNDDAEDQTASDLAVVLFETATLRSGYQLADTKAYGDRIERMLRLSMNVPL 755          
BLAST of HATPase_c domain-containing protein vs. Ensembl Medaka
Match: hsp90ab1 (heat shock protein 90 alpha family class B member 1 [Source:NCBI gene;Acc:100125466])

HSP 1 Score: 91.6633 bits (226), Expect = 1.179e-21
Identity = 46/119 (38.66%), Postives = 73/119 (61.34%), Query Frame = 1
Query:   31 IEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            +EKV +S RL +SPC ++ STYGW+ NMERIMKAQA + +  +   Y +  KK LEIN  H ++  L+      ++    + L   L++TALL SG+ +D+  + S +++ +IK  + I
Sbjct:  572 VEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTM--GYMM-AKKHLEINPDHPIMETLRQKAETDKNDKAVKDLVILLFETALLSSGFSLDDPQTHSNRIYRMIKLGLGI 687          
BLAST of HATPase_c domain-containing protein vs. Ensembl Medaka
Match: hsp90ab1 (heat shock protein 90 alpha family class B member 1 [Source:NCBI gene;Acc:100125466])

HSP 1 Score: 91.6633 bits (226), Expect = 1.220e-21
Identity = 46/119 (38.66%), Postives = 73/119 (61.34%), Query Frame = 1
Query:   31 IEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            +EKV +S RL +SPC ++ STYGW+ NMERIMKAQA + +  +   Y +  KK LEIN  H ++  L+      ++    + L   L++TALL SG+ +D+  + S +++ +IK  + I
Sbjct:  556 VEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTM--GYMM-AKKHLEINPDHPIMETLRQKAETDKNDKAVKDLVILLFETALLSSGFSLDDPQTHSNRIYRMIKLGLGI 671          
BLAST of HATPase_c domain-containing protein vs. Ensembl Medaka
Match: hsp90aa1.2 (heat shock protein HSP 90-alpha [Source:NCBI gene;Acc:101169506])

HSP 1 Score: 88.9669 bits (219), Expect = 9.726e-21
Identity = 44/123 (35.77%), Postives = 74/123 (60.16%), Query Frame = 1
Query:   19 LKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            L+  +EKV +S RL +SPC ++ STYGW+ NMERIMKAQA + +  +     +  KK LEIN  H ++  L+      ++    + L   L++TALL SG+ +++  + + +++ +IK  + I
Sbjct:  571 LEKKVEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMG---YMAAKKHLEINPDHPIMETLRQKAEADKNDKSVKDLVILLFETALLSSGFTLEDPQTHANRIYRMIKLGLGI 690          
BLAST of HATPase_c domain-containing protein vs. Ensembl Medaka
Match: hsp90aa1.2 (heat shock protein HSP 90-alpha [Source:NCBI gene;Acc:101169506])

HSP 1 Score: 88.9669 bits (219), Expect = 1.011e-20
Identity = 44/123 (35.77%), Postives = 74/123 (60.16%), Query Frame = 1
Query:   19 LKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            L+  +EKV +S RL +SPC ++ STYGW+ NMERIMKAQA + +  +     +  KK LEIN  H ++  L+      ++    + L   L++TALL SG+ +++  + + +++ +IK  + I
Sbjct:  571 LEKKVEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMG---YMAAKKHLEINPDHPIMETLRQKAEADKNDKSVKDLVILLFETALLSSGFTLEDPQTHANRIYRMIKLGLGI 690          
BLAST of HATPase_c domain-containing protein vs. Planmine SMEST
Match: SMESG000054819.1 (SMESG000054819.1)

HSP 1 Score: 334.339 bits (856), Expect = 4.368e-111
Identity = 176/176 (100.00%), Postives = 176/176 (100.00%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKIPLXXXXXXXXXXXXXTPRQTGTEKLNNENIAPKFDEENKSDKSSAKD 528
            WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKIPLDDSIIDDEEIIEDTPRQTGTEKLNNENIAPKFDEENKSDKSSAKD
Sbjct:  626 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKIPLDDSIIDDEEIIEDTPRQTGTEKLNNENIAPKFDEENKSDKSSAKD 801          
BLAST of HATPase_c domain-containing protein vs. Planmine SMEST
Match: SMESG000041107.1 (SMESG000041107.1)

HSP 1 Score: 142.124 bits (357), Expect = 2.345e-39
Identity = 66/130 (50.77%), Postives = 90/130 (69.23%), Query Frame = 1
Query:    1 WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKIP 390
            WLK + L + IEK EISERL+TSPC ++ASTYGW+GNMERIMKAQAYQ +      YQ +QKKILEIN +H LI+ LK          + + +A  LY+TA+LRSGY +     F+ ++ +I+++S+ IP
Sbjct:  622 WLKDSVLNEQIEKAEISERLSTSPCAVVASTYGWTGNMERIMKAQAYQSASNSYNEYQSSQKKILEINPKHPLIKELKRQVEKNPTDEKAKDIALTLYETAILRSGYSLPASGGFADRIEKILRSSLNIP 751          
BLAST of HATPase_c domain-containing protein vs. Planmine SMEST
Match: SMESG000024822.1 (SMESG000024822.1)

HSP 1 Score: 93.5893 bits (231), Expect = 2.320e-22
Identity = 46/119 (38.66%), Postives = 72/119 (60.50%), Query Frame = 1
Query:   31 IEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            +EKV +S RL +SPC ++ S +GWS NMERIMKAQA + S  +     +  KK LEIN  HS+++ LK      ++    + L   LY+T+LL SG+ +++    + ++H +IK  + I
Sbjct:  566 VEKVTVSNRLVSSPCCIVTSQFGWSANMERIMKAQALRDSSTMG---YMAAKKHLEINPDHSVMKALKTRVDADKNDKSVKDLVMLLYETSLLSSGFALEDPQIHANRIHRMIKLGLGI 681          
BLAST of HATPase_c domain-containing protein vs. Planmine SMEST
Match: SMESG000071533.1 (SMESG000071533.1)

HSP 1 Score: 92.4337 bits (228), Expect = 5.525e-22
Identity = 45/119 (37.82%), Postives = 71/119 (59.66%), Query Frame = 1
Query:   31 IEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            +EKV +S RL +SPC ++ S +GWS NMERIMKAQA + S  +     +  KK LEIN  HS+++ LK      ++    + L   L++T+LL SG+ +++      ++H +IK  + I
Sbjct:  567 VEKVTVSNRLVSSPCCIVTSQFGWSANMERIMKAQALRDSSTMG---YMAAKKHLEINPDHSIMKSLKLRVDADKNDKSVKDLVMLLFETSLLSSGFSLEDPQVHGNRIHRMIKLGLGI 682          
BLAST of HATPase_c domain-containing protein vs. Planmine SMEST
Match: SMESG000071531.1 (SMESG000071531.1)

HSP 1 Score: 92.0485 bits (227), Expect = 6.052e-22
Identity = 45/119 (37.82%), Postives = 71/119 (59.66%), Query Frame = 1
Query:   31 IEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKSEEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDTALLRSGYIMDNVASFSKQVHEIIKTSMKI 387
            +EKV +S RL +SPC ++ S +GWS NMERIMKAQA + S  +     +  KK LEIN  HS+++ LK      ++    + L   L++T+LL SG+ +++      ++H +IK  + I
Sbjct:  548 VEKVTVSNRLVSSPCCIVTSQFGWSANMERIMKAQALRDSSTMG---YMAAKKHLEINPDHSIMKSLKLRVDADKNDKSVKDLVMLLFETSLLSSGFSLEDPQVHGNRIHRMIKLGLGI 663          
The following BLAST results are available for this feature:
BLAST of HATPase_c domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSP90B11.179e-3445.74heat shock protein 90 beta family member 1 [Source... [more]
HSP90B11.365e-2341.84heat shock protein 90 beta family member 1 [Source... [more]
HSP90AA14.354e-2239.02heat shock protein 90 alpha family class A member ... [more]
HSP90AA15.946e-2239.02heat shock protein 90 alpha family class A member ... [more]
HSP90AB16.730e-2138.66heat shock protein 90 alpha family class B member ... [more]
back to top
BLAST of HATPase_c domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
enpl-12.254e-3242.64Endoplasmin homolog [Source:UniProtKB/Swiss-Prot;... [more]
enpl-12.254e-3242.64Endoplasmin homolog [Source:UniProtKB/Swiss-Prot;... [more]
enpl-12.254e-3242.64Endoplasmin homolog [Source:UniProtKB/Swiss-Prot;... [more]
enpl-12.254e-3242.64Endoplasmin homolog [Source:UniProtKB/Swiss-Prot;... [more]
enpl-12.254e-3242.64Endoplasmin homolog [Source:UniProtKB/Swiss-Prot;... [more]
back to top
BLAST of HATPase_c domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Gp933.193e-3138.76gene:FBgn0039562 transcript:FBtr0085254[more]
Hsp839.278e-2034.96gene:FBgn0001233 transcript:FBtr0332873[more]
Hsp839.278e-2034.96gene:FBgn0001233 transcript:FBtr0073040[more]
back to top
BLAST of HATPase_c domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp90b11.862e-3344.27heat shock protein 90, beta (grp94), member 1 [Sou... [more]
hsp90b12.120e-3344.27heat shock protein 90, beta (grp94), member 1 [Sou... [more]
hsp90aa1.27.722e-2237.82heat shock protein 90, alpha (cytosolic), class A ... [more]
hsp90ab12.224e-2138.66heat shock protein 90, alpha (cytosolic), class A ... [more]
hsp90ab12.224e-2138.66heat shock protein 90, alpha (cytosolic), class A ... [more]
back to top
BLAST of HATPase_c domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp90b11.100e-3446.56heat shock protein 90kDa beta (Grp94), member 1 [S... [more]
hsp90b11.418e-3446.56heat shock protein 90kDa beta (Grp94), member 1 [S... [more]
hsp90b11.510e-3446.56heat shock protein 90kDa beta (Grp94), member 1 [S... [more]
hsp90b11.575e-3446.56heat shock protein 90kDa beta (Grp94), member 1 [S... [more]
hsp90b14.227e-3346.56heat shock protein 90kDa beta (Grp94), member 1 [S... [more]
back to top
BLAST of HATPase_c domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hsp90b16.535e-3545.74heat shock protein 90, beta (Grp94), member 1 [Sou... [more]
Hsp90b11.060e-2659.74heat shock protein 90, beta (Grp94), member 1 [Sou... [more]
Hsp90aa13.967e-2239.02heat shock protein 90, alpha (cytosolic), class A ... [more]
Hsp90aa13.967e-2239.02heat shock protein 90, alpha (cytosolic), class A ... [more]
Hsp90ab14.446e-2138.66heat shock protein 90 alpha (cytosolic), class B m... [more]
back to top
BLAST of HATPase_c domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P08712|ENPL_MESAU2.876e-3545.74Endoplasmin (Fragment) OS=Mesocricetus auratus OX=... [more]
sp|Q95M18|ENPL_BOVIN4.446e-3445.74Endoplasmin OS=Bos taurus OX=9913 GN=HSP90B1 PE=2 ... [more]
sp|P08113|ENPL_MOUSE4.571e-3445.74Endoplasmin OS=Mus musculus OX=10090 GN=Hsp90b1 PE... [more]
sp|Q29092|ENPL_PIG5.294e-3445.74Endoplasmin OS=Sus scrofa OX=9823 GN=HSP90B1 PE=2 ... [more]
sp|Q5R6F7|ENPL_PONAB5.611e-3445.74Endoplasmin OS=Pongo abelii OX=9601 GN=HSP90B1 PE=... [more]
back to top
BLAST of HATPase_c domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2R4NBU56.122e-6872.73Heat shock protein 902 OS=Dugesia japonica OX=6161... [more]
R7U2A81.934e-3951.15HATPase_c domain-containing protein OS=Capitella t... [more]
A0A2T7NSL78.781e-3749.62HATPase_c domain-containing protein OS=Pomacea can... [more]
A0A0N4UU821.572e-3646.56Uncharacterized protein OS=Enterobius vermicularis... [more]
T1EM753.279e-3651.91HATPase_c domain-containing protein OS=Helobdella ... [more]
back to top
BLAST of HATPase_c domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp90b11.666e-3447.73heat shock protein 90, beta (grp94), member 1 [Sou... [more]
hsp90aa1.23.812e-2238.21Astyanax mexicanus heat shock protein HSP 90-alpha... [more]
hsp90aa1.23.923e-2238.21Astyanax mexicanus heat shock protein HSP 90-alpha... [more]
hsp90ab11.762e-2138.66heat shock protein 90 alpha family class B member ... [more]
hsp90aa1.22.690e-2036.13Astyanax mexicanus heat shock protein HSP 90-alpha... [more]
back to top
BLAST of HATPase_c domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hsp90b17.709e-3245.45heat shock protein 90, beta (grp94), member 1 [Sou... [more]
ENSPMAT00000003399.17.309e-2338.66pep scaffold:Pmarinus_7.0:GL479675:6143:15195:1 ge... [more]
back to top
BLAST of HATPase_c domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
HSP827.135e-2037.10Hsp90 chaperone; redundant in function with Hsc82p... [more]
HSC824.632e-1834.68Cytoplasmic chaperone of the Hsp90 family; plays a... [more]
back to top
BLAST of HATPase_c domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO453445.863e-3746.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
HSP905.513e-1535.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of HATPase_c domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp90b14.274e-3646.56heat shock protein 90 beta family member 1 [Source... [more]
hsp90ab11.179e-2138.66heat shock protein 90 alpha family class B member ... [more]
hsp90ab11.220e-2138.66heat shock protein 90 alpha family class B member ... [more]
hsp90aa1.29.726e-2135.77heat shock protein HSP 90-alpha [Source:NCBI gene;... [more]
hsp90aa1.21.011e-2035.77heat shock protein HSP 90-alpha [Source:NCBI gene;... [more]
back to top
BLAST of HATPase_c domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054819.14.368e-111100.00SMESG000054819.1[more]
SMESG000041107.12.345e-3950.77SMESG000041107.1[more]
SMESG000024822.12.320e-2238.66SMESG000024822.1[more]
SMESG000071533.15.525e-2237.82SMESG000071533.1[more]
SMESG000071531.16.052e-2237.82SMESG000071531.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008204 ID=SMED30008204|Name=HATPase_c domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=529bp
TGGTTGAAAAGTACCGAACTGAAGGACTATATAGAAAAAGTGGAAATATC
CGAAAGACTCACCACCAGTCCTTGCGTATTGATTGCGTCAACATATGGCT
GGTCCGGTAACATGGAGAGAATCATGAAAGCTCAAGCTTATCAGAAATCC
GAGGAAGTCATGCAAACCTATCAAGTAAACCAAAAGAAAATTTTAGAAAT
CAACACACAACATTCTTTGATAAGACATTTGAAATACTCGTTTTCCAACG
GGCAAGACATGAATGAAACAAGAAAATTGGCGAAATTCCTATACGACACA
GCTTTGTTGCGATCAGGGTATATAATGGACAATGTCGCAAGCTTTTCTAA
ACAAGTCCATGAAATCATTAAAACCTCAATGAAAATCCCGCTTGATGATT
CCATAATTGATGACGAAGAGATTATTGAAGATACCCCTCGACAAACGGGA
ACAGAAAAGTTGAATAATGAAAATATTGCACCGAAATTTGATGAAGAAAA
CAAATCTGATAAATCTTCTGCCAAGGATG
back to top

protein sequence of SMED30008204-orf-1

>SMED30008204-orf-1 ID=SMED30008204-orf-1|Name=SMED30008204-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=176bp
WLKSTELKDYIEKVEISERLTTSPCVLIASTYGWSGNMERIMKAQAYQKS
EEVMQTYQVNQKKILEINTQHSLIRHLKYSFSNGQDMNETRKLAKFLYDT
ALLRSGYIMDNVASFSKQVHEIIKTSMKIPLDDSIIDDEEIIEDTPRQTG
TEKLNNENIAPKFDEENKSDKSSAKD
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR037196HSP90_C
IPR001404Hsp90_fam
Vocabulary: biological process
TermDefinition
GO:0006950response to stress
GO:0006457protein folding
Vocabulary: molecular function
TermDefinition
GO:0051082unfolded protein binding
GO:0005524ATP binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001404Heat shock protein Hsp90 familyPFAMPF00183HSP90coord: 1..148
e-value: 1.9E-41
score: 142.6
IPR001404Heat shock protein Hsp90 familyPANTHERPTHR11528HEAT SHOCK PROTEIN 90 FAMILY MEMBERcoord: 1..172
IPR037196HSP90, C-terminal domainGENE3DG3DSA:1.20.120.790coord: 1..128
e-value: 2.1E-42
score: 146.4
IPR037196HSP90, C-terminal domainSUPERFAMILYSSF110942HSP90 C-terminal domaincoord: 6..123
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 158..176
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 141..176
NoneNo IPR availablePANTHERPTHR11528:SF96ENDOPLASMINcoord: 1..172