5'-3' exoribonuclease

Overview
Name5'-3' exoribonuclease
Smed IDSMED30008183
Length (bp)807
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008183

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30008183SMESG000008668.1 dd_Smed_v4_95450_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30008183SMESG000008668.1 dd_Smed_v4_95450_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30008183SMESG000008668.1 dd_Smed_v6_95450_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 5'-3' exoribonuclease vs. Ensembl Human
Match: XRN2 (5'-3' exoribonuclease 2 [Source:HGNC Symbol;Acc:HGNC:12836])

HSP 1 Score: 107.842 bits (268), Expect = 8.927e-26
Identity = 62/194 (31.96%), Postives = 97/194 (50.00%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRSDHSNFNLDKTVYYSQMKKDMKM--DSASHVQSKSTDNMKAITAARTITSLFPEISQNIFNNVVLCYTFTD 577
            P+ YAP+ASDF  I D  + F+  T P +P EQLM V P  S + +P  W+ LM+D DS I DFY +      +  K+  +   +LPF  E RL   L E Y  LT EE +RN  G    F+   H   +    +Y +   + +++  +    +Q K + + +AI   + + S  P + +++  N V+   F D
Sbjct:  565 PFHYAPFASDFEGIADMPSDFEKGTKPFKPLEQLMGVFPAASGNFLPPSWRKLMSDPDSSIIDFYPEDFAIDLNGKKYAWQGVALLPFVDERRLRAALEEVYPDLTPEETRRNSLGGDVLFVGKHHPLHDFILELYQTGSTEPVEVPPELCHGIQGKFSLDEEAILPDQIVCSPVPML-RDLTQNTVVSINFKD 757          
BLAST of 5'-3' exoribonuclease vs. Ensembl Human
Match: XRN1 (5'-3' exoribonuclease 1 [Source:HGNC Symbol;Acc:HGNC:30654])

HSP 1 Score: 95.1301 bits (235), Expect = 2.296e-21
Identity = 49/115 (42.61%), Postives = 70/115 (60.87%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQH 346
            PY YAP+ SD  NI+  +  F+    P +PFEQL+AVLP  SK+L+P  +Q+LMT+ DSPI ++Y    K+  +  +   +   ++PF  E RLL+ +     SL  EE KRNQH
Sbjct:  482 PYHYAPFLSDIHNISTLKIHFELGK-PFKPFEQLLAVLPAASKNLLPACYQHLMTNEDSPIIEYYPPDFKTDLNGKQQEWEAVVLIPFIDEKRLLEAMETCNHSLKKEERKRNQH 595          
BLAST of 5'-3' exoribonuclease vs. Ensembl Human
Match: XRN1 (5'-3' exoribonuclease 1 [Source:HGNC Symbol;Acc:HGNC:30654])

HSP 1 Score: 95.1301 bits (235), Expect = 2.364e-21
Identity = 49/115 (42.61%), Postives = 70/115 (60.87%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQH 346
            PY YAP+ SD  NI+  +  F+    P +PFEQL+AVLP  SK+L+P  +Q+LMT+ DSPI ++Y    K+  +  +   +   ++PF  E RLL+ +     SL  EE KRNQH
Sbjct:  482 PYHYAPFLSDIHNISTLKIHFELGK-PFKPFEQLLAVLPAASKNLLPACYQHLMTNEDSPIIEYYPPDFKTDLNGKQQEWEAVVLIPFIDEKRLLEAMETCNHSLKKEERKRNQH 595          
BLAST of 5'-3' exoribonuclease vs. Ensembl Celegans
Match: xrn-2 (5'-3' exoribonuclease 2 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q9U299])

HSP 1 Score: 113.235 bits (282), Expect = 4.584e-28
Identity = 57/147 (38.78%), Postives = 80/147 (54.42%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRSDHSNFNLDKTVYYSQMKKDMKMD 442
            PY YAP+ASDF  + +F+  F   T P  P EQLM+V P  SK  +P+ WQ LM   DSPI D Y    +   +  K+  +   +LPF  E+RLL  L+  Y +LT EE +RN  G  + FI  +H +F   + V  S+    + +D
Sbjct:  591 PYHYAPFASDFETVGEFQPDFTRPTKPFNPLEQLMSVFPAASKQHLPVEWQKLMIQDDSPIIDLYPADFRIDLNGKKYAWQGVALLPFVDETRLLATLQSVYPTLTAEEKQRNTRGPNRIFIGRNHKSFEFFQQVAESKSDDLVPLD 737          
BLAST of 5'-3' exoribonuclease vs. Ensembl Celegans
Match: xrn-1 (5'-3' exoribonuclease 1 [Source:UniProtKB/TrEMBL;Acc:Q9BHK7])

HSP 1 Score: 77.411 bits (189), Expect = 8.689e-16
Identity = 44/126 (34.92%), Postives = 64/126 (50.79%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTD--VDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRS 373
            P+ YAP+ SD          F+ +  P  PFEQL+AVLP  S   +P   + LM+     SPI DFY    ++  +  ++  +   ++PF  E RLL+ +  +   LT EEN RN HG+    I S
Sbjct:  544 PHHYAPFISDVRGFVGMRMEFELSE-PFHPFEQLLAVLPEASADCLPRPLRELMSSDPAKSPICDFYPANFETDLNGKRNEWEAVVLIPFIEEKRLLEAIEAKRSRLTSEENARNSHGSHIQCISS 668          
BLAST of 5'-3' exoribonuclease vs. Ensembl Celegans
Match: xrn-1 (5'-3' exoribonuclease 1 [Source:UniProtKB/TrEMBL;Acc:Q9BHK7])

HSP 1 Score: 77.411 bits (189), Expect = 8.689e-16
Identity = 44/126 (34.92%), Postives = 64/126 (50.79%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTD--VDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRS 373
            P+ YAP+ SD          F+ +  P  PFEQL+AVLP  S   +P   + LM+     SPI DFY    ++  +  ++  +   ++PF  E RLL+ +  +   LT EEN RN HG+    I S
Sbjct:  544 PHHYAPFISDVRGFVGMRMEFELSE-PFHPFEQLLAVLPEASADCLPRPLRELMSSDPAKSPICDFYPANFETDLNGKRNEWEAVVLIPFIEEKRLLEAIEAKRSRLTSEENARNSHGSHIQCISS 668          
BLAST of 5'-3' exoribonuclease vs. Ensembl Fly
Match: Rat1 (gene:FBgn0031868 transcript:FBtr0079345)

HSP 1 Score: 119.013 bits (297), Expect = 5.486e-30
Identity = 69/201 (34.33%), Postives = 99/201 (49.25%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRSDHSNFNLDKTVYYSQMKKDMKMDSASHVQSKSTDNMKAITAARTITSLFPEISQ-------NIFNNVVLCYTFTDTD 583
            PY YAP+ASDF NI    T F+  T P  P EQLM V P  S S +P  W  LM+D +SPI DFY +  K   +  K   +   +LPF  E RL K L   YD LT EE KRN+ G    +I         +++ +Y ++KK  + D  S  ++ S D M+       + +    + +       +I +N+ +  TF D +
Sbjct:  544 PYHYAPFASDFVNIQGLSTMFEKGTKPFNPLEQLMGVFPAASSSHVPEPWAKLMSDPESPIIDFYPEDFKIDLNGKKFAWQGVALLPFVDEKRLFKALVPYYDQLTGEEVKRNKRGDNYLYIS--------NQSPHYKKVKKISEKDDESVCKAISFDGMRGTLGKTELNTAISGVLKSPISGLSDINDNITVTTTFRDPE 736          
BLAST of 5'-3' exoribonuclease vs. Ensembl Fly
Match: Rat1 (gene:FBgn0031868 transcript:FBtr0332324)

HSP 1 Score: 119.013 bits (297), Expect = 5.486e-30
Identity = 69/201 (34.33%), Postives = 99/201 (49.25%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRSDHSNFNLDKTVYYSQMKKDMKMDSASHVQSKSTDNMKAITAARTITSLFPEISQ-------NIFNNVVLCYTFTDTD 583
            PY YAP+ASDF NI    T F+  T P  P EQLM V P  S S +P  W  LM+D +SPI DFY +  K   +  K   +   +LPF  E RL K L   YD LT EE KRN+ G    +I         +++ +Y ++KK  + D  S  ++ S D M+       + +    + +       +I +N+ +  TF D +
Sbjct:  544 PYHYAPFASDFVNIQGLSTMFEKGTKPFNPLEQLMGVFPAASSSHVPEPWAKLMSDPESPIIDFYPEDFKIDLNGKKFAWQGVALLPFVDEKRLFKALVPYYDQLTGEEVKRNKRGDNYLYIS--------NQSPHYKKVKKISEKDDESVCKAISFDGMRGTLGKTELNTAISGVLKSPISGLSDINDNITVTTTFRDPE 736          
BLAST of 5'-3' exoribonuclease vs. Ensembl Fly
Match: pcm (gene:FBgn0020261 transcript:FBtr0074784)

HSP 1 Score: 87.4261 bits (215), Expect = 3.849e-19
Identity = 46/123 (37.40%), Postives = 67/123 (54.47%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHG---AFKY 361
            P+ Y P+ SD  NI   E  F   T P  PF+QL+AVLP  S  L+P+ + +LM    SP+ +FY    +S  +  KH  +   ++PF  E RLL  +      L++EE +RN+HG    +KY
Sbjct:  462 PFHYTPFISDLKNIEQVEIAFHMGT-PFLPFQQLLAVLPAASAKLLPVAYHDLMLLPTSPLAEFYPLEFESDLNGKKHDWEAVVLIPFIDEGRLLAAMLPCEAQLSLEERERNRHGPMYVYKY 583          
BLAST of 5'-3' exoribonuclease vs. Ensembl Fly
Match: pcm (gene:FBgn0020261 transcript:FBtr0302082)

HSP 1 Score: 87.4261 bits (215), Expect = 3.849e-19
Identity = 46/123 (37.40%), Postives = 67/123 (54.47%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHG---AFKY 361
            P+ Y P+ SD  NI   E  F   T P  PF+QL+AVLP  S  L+P+ + +LM    SP+ +FY    +S  +  KH  +   ++PF  E RLL  +      L++EE +RN+HG    +KY
Sbjct:  462 PFHYTPFISDLKNIEQVEIAFHMGT-PFLPFQQLLAVLPAASAKLLPVAYHDLMLLPTSPLAEFYPLEFESDLNGKKHDWEAVVLIPFIDEGRLLAAMLPCEAQLSLEERERNRHGPMYVYKY 583          
BLAST of 5'-3' exoribonuclease vs. Ensembl Zebrafish
Match: xrn2 (5'-3' exoribonuclease 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2874])

HSP 1 Score: 99.7525 bits (247), Expect = 3.807e-23
Identity = 50/139 (35.97%), Postives = 75/139 (53.96%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRSDHSNFNLDKTVYYSQ 418
            P+ YAP+ASDF +I    + F+  T P +P EQLM V P  S + +P  W+ LM+D +S I DFY        +  K+  +   +LPF  E RL   L E Y+ LT EE +RN  G+   F+   H+  +  + +Y ++
Sbjct:  573 PFHYAPFASDFKDIKGMFSDFEKGTKPFKPLEQLMGVFPAASGNFLPTTWRALMSDPESSIIDFYPDDFAIDLNGKKYAWQGVALLPFVDERRLRAALAEVYNDLTPEEVRRNSLGSDVMFVGRSHALCDFIQELYRAE 711          
BLAST of 5'-3' exoribonuclease vs. Ensembl Zebrafish
Match: xrn1 (5'-3' exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1203])

HSP 1 Score: 84.3445 bits (207), Expect = 5.780e-18
Identity = 45/115 (39.13%), Postives = 64/115 (55.65%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQH 346
            PY YAP+ SD  NI+     FD    P  PFEQL+AVLP  SK L+P  +Q+LMT + SPI ++Y +  K+  +  +   +   ++PF  E  LL  +     +LT  E  RN+H
Sbjct:  484 PYHYAPFLSDVRNISGLSLTFDL-AKPFMPFEQLLAVLPSASKDLLPQCYQHLMTSLSSPIVEYYPQDFKTDLNGKQQEWEAVVLIPFIDEKCLLAAMEPYTHNLTPSEKARNRH 597          
BLAST of 5'-3' exoribonuclease vs. Ensembl Zebrafish
Match: xrn1 (5'-3' exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1203])

HSP 1 Score: 72.4034 bits (176), Expect = 4.611e-14
Identity = 36/88 (40.91%), Postives = 52/88 (59.09%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPF 265
            PY YAP+ SD  NI+     FD    P  PFEQL+AVLP  SK L+P  +Q+LMT + SPI ++Y +  K+  +  +   +   ++PF
Sbjct:  395 PYHYAPFLSDVRNISGLSLTFDL-AKPFMPFEQLLAVLPSASKDLLPQCYQHLMTSLSSPIVEYYPQDFKTDLNGKQQEWEAVVLIPF 481          
BLAST of 5'-3' exoribonuclease vs. Ensembl Xenopus
Match: rpl29 (ribosomal protein L29 [Source:Xenbase;Acc:XB-GENE-5789751])

HSP 1 Score: 100.523 bits (249), Expect = 2.776e-23
Identity = 56/123 (45.53%), Postives = 72/123 (58.54%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTG-PLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHG-AFKYF 364
            PY YAPY SD  NI+  +  F  N G P  PFEQL+AVLP  SK L+PL +QNLM   DSPI D+Y +  K+  +  +   +   ++PF  E RLL+ +     SL  EE KRNQH    KY+
Sbjct:  483 PYHYAPYLSDICNISHLKLTF--NLGKPFMPFEQLLAVLPAASKDLLPLTYQNLMISSDSPIIDYYPQDFKTDLNGKQQEWEAVVLIPFIDEKRLLEAMVSCNRSLAEEEKKRNQHSECIKYW 603          
BLAST of 5'-3' exoribonuclease vs. Ensembl Xenopus
Match: rpl29 (ribosomal protein L29 [Source:Xenbase;Acc:XB-GENE-5789751])

HSP 1 Score: 100.523 bits (249), Expect = 2.869e-23
Identity = 56/123 (45.53%), Postives = 72/123 (58.54%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTG-PLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHG-AFKYF 364
            PY YAPY SD  NI+  +  F  N G P  PFEQL+AVLP  SK L+PL +QNLM   DSPI D+Y +  K+  +  +   +   ++PF  E RLL+ +     SL  EE KRNQH    KY+
Sbjct:  478 PYHYAPYLSDICNISHLKLTF--NLGKPFMPFEQLLAVLPAASKDLLPLTYQNLMISSDSPIIDYYPQDFKTDLNGKQQEWEAVVLIPFIDEKRLLEAMVSCNRSLAEEEKKRNQHSECIKYW 598          
BLAST of 5'-3' exoribonuclease vs. Ensembl Xenopus
Match: rpl29 (ribosomal protein L29 [Source:Xenbase;Acc:XB-GENE-5789751])

HSP 1 Score: 100.523 bits (249), Expect = 2.932e-23
Identity = 56/123 (45.53%), Postives = 72/123 (58.54%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTG-PLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHG-AFKYF 364
            PY YAPY SD  NI+  +  F  N G P  PFEQL+AVLP  SK L+PL +QNLM   DSPI D+Y +  K+  +  +   +   ++PF  E RLL+ +     SL  EE KRNQH    KY+
Sbjct:  467 PYHYAPYLSDICNISHLKLTF--NLGKPFMPFEQLLAVLPAASKDLLPLTYQNLMISSDSPIIDYYPQDFKTDLNGKQQEWEAVVLIPFIDEKRLLEAMVSCNRSLAEEEKKRNQHSECIKYW 587          
BLAST of 5'-3' exoribonuclease vs. Ensembl Xenopus
Match: rpl29 (ribosomal protein L29 [Source:Xenbase;Acc:XB-GENE-5789751])

HSP 1 Score: 100.523 bits (249), Expect = 2.986e-23
Identity = 56/123 (45.53%), Postives = 72/123 (58.54%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTG-PLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHG-AFKYF 364
            PY YAPY SD  NI+  +  F  N G P  PFEQL+AVLP  SK L+PL +QNLM   DSPI D+Y +  K+  +  +   +   ++PF  E RLL+ +     SL  EE KRNQH    KY+
Sbjct:  467 PYHYAPYLSDICNISHLKLTF--NLGKPFMPFEQLLAVLPAASKDLLPLTYQNLMISSDSPIIDYYPQDFKTDLNGKQQEWEAVVLIPFIDEKRLLEAMVSCNRSLAEEEKKRNQHSECIKYW 587          
BLAST of 5'-3' exoribonuclease vs. Ensembl Xenopus
Match: rpl29 (ribosomal protein L29 [Source:Xenbase;Acc:XB-GENE-5789751])

HSP 1 Score: 100.523 bits (249), Expect = 3.005e-23
Identity = 56/123 (45.53%), Postives = 72/123 (58.54%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTG-PLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHG-AFKYF 364
            PY YAPY SD  NI+  +  F  N G P  PFEQL+AVLP  SK L+PL +QNLM   DSPI D+Y +  K+  +  +   +   ++PF  E RLL+ +     SL  EE KRNQH    KY+
Sbjct:  468 PYHYAPYLSDICNISHLKLTF--NLGKPFMPFEQLLAVLPAASKDLLPLTYQNLMISSDSPIIDYYPQDFKTDLNGKQQEWEAVVLIPFIDEKRLLEAMVSCNRSLAEEEKKRNQHSECIKYW 588          
BLAST of 5'-3' exoribonuclease vs. Ensembl Mouse
Match: Xrn2 (5'-3' exoribonuclease 2 [Source:MGI Symbol;Acc:MGI:894687])

HSP 1 Score: 108.997 bits (271), Expect = 2.390e-26
Identity = 65/194 (33.51%), Postives = 96/194 (49.48%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRSDH--SNFNLDKTVYYSQMKKDMKMDSASHVQSKSTDNMKAITAARTITSLFPEISQNIFNNVVLCYTFTD 577
            P+ YAP+ASDF  I D  + F+  T P +P EQLM V P  S + +P  W+ LM+D DS I DFY +      +  K+  +   +LPF  E RL   L E Y  LT EEN+RN  G    F+   H   +F L+     S    D+  +    +Q   + + +AI   +T+ S  P + +++  N  +   F D
Sbjct:  565 PFHYAPFASDFEGIADMSSEFEKGTKPFKPLEQLMGVFPAASGNFLPPTWRKLMSDPDSSIIDFYPEDFAIDLNGKKYAWQGVALLPFVDERRLRAALEEVYPDLTPEENRRNSLGGDVLFVGKLHPLRDFILELYQTGSTEPVDVPPELCHGIQGTFSLDEEAILPDQTVCSPVPML-RDLTQNTAVSINFKD 757          
BLAST of 5'-3' exoribonuclease vs. Ensembl Mouse
Match: Xrn1 (5'-3' exoribonuclease 1 [Source:MGI Symbol;Acc:MGI:891964])

HSP 1 Score: 92.8189 bits (229), Expect = 9.258e-21
Identity = 48/115 (41.74%), Postives = 70/115 (60.87%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQH 346
            PY YAP+ SD  +I+  +  F+    P +PFEQL+AVLP  SK+L+P  +Q+LMT  DSPI ++Y    K+  +  +   +   ++PF  E+RLL+ +     SL  EE KRNQH
Sbjct:  482 PYHYAPFLSDIRSISTLKIHFELGK-PFKPFEQLLAVLPSASKNLLPTCYQHLMTSEDSPIIEYYPPDFKTDLNGKQQEWEAVVLIPFIDETRLLEAMETCNHSLKKEERKRNQH 595          
BLAST of 5'-3' exoribonuclease vs. Ensembl Mouse
Match: Xrn1 (5'-3' exoribonuclease 1 [Source:MGI Symbol;Acc:MGI:891964])

HSP 1 Score: 92.8189 bits (229), Expect = 1.066e-20
Identity = 48/115 (41.74%), Postives = 70/115 (60.87%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQH 346
            PY YAP+ SD  +I+  +  F+    P +PFEQL+AVLP  SK+L+P  +Q+LMT  DSPI ++Y    K+  +  +   +   ++PF  E+RLL+ +     SL  EE KRNQH
Sbjct:  482 PYHYAPFLSDIRSISTLKIHFELGK-PFKPFEQLLAVLPSASKNLLPTCYQHLMTSEDSPIIEYYPPDFKTDLNGKQQEWEAVVLIPFIDETRLLEAMETCNHSLKKEERKRNQH 595          
BLAST of 5'-3' exoribonuclease vs. Ensembl Mouse
Match: Xrn1 (5'-3' exoribonuclease 1 [Source:MGI Symbol;Acc:MGI:891964])

HSP 1 Score: 92.0485 bits (227), Expect = 1.421e-20
Identity = 48/115 (41.74%), Postives = 70/115 (60.87%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQH 346
            PY YAP+ SD  +I+  +  F+    P +PFEQL+AVLP  SK+L+P  +Q+LMT  DSPI ++Y    K+  +  +   +   ++PF  E+RLL+ +     SL  EE KRNQH
Sbjct:  482 PYHYAPFLSDIRSISTLKIHFELGK-PFKPFEQLLAVLPSASKNLLPTCYQHLMTSEDSPIIEYYPPDFKTDLNGKQQEWEAVVLIPFIDETRLLEAMETCNHSLKKEERKRNQH 595          
BLAST of 5'-3' exoribonuclease vs. UniProt/SwissProt
Match: sp|Q9VM71|XRN2_DROME (5'-3' exoribonuclease 2 homolog OS=Drosophila melanogaster OX=7227 GN=Rat1 PE=1 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 5.499e-29
Identity = 69/201 (34.33%), Postives = 99/201 (49.25%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRSDHSNFNLDKTVYYSQMKKDMKMDSASHVQSKSTDNMKAITAARTITSLFPEISQ-------NIFNNVVLCYTFTDTD 583
            PY YAP+ASDF NI    T F+  T P  P EQLM V P  S S +P  W  LM+D +SPI DFY +  K   +  K   +   +LPF  E RL K L   YD LT EE KRN+ G    +I         +++ +Y ++KK  + D  S  ++ S D M+       + +    + +       +I +N+ +  TF D +
Sbjct:  544 PYHYAPFASDFVNIQGLSTMFEKGTKPFNPLEQLMGVFPAASSSHVPEPWAKLMSDPESPIIDFYPEDFKIDLNGKKFAWQGVALLPFVDEKRLFKALVPYYDQLTGEEVKRNKRGDNYLYIS--------NQSPHYKKVKKISEKDDESVCKAISFDGMRGTLGKTELNTAISGVLKSPISGLSDINDNITVTTTFRDPE 736          
BLAST of 5'-3' exoribonuclease vs. UniProt/SwissProt
Match: sp|Q5ZIP4|XRN2_CHICK (5'-3' exoribonuclease 2 OS=Gallus gallus OX=9031 GN=XRN2 PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 4.089e-28
Identity = 66/194 (34.02%), Postives = 97/194 (50.00%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRSDHSNFNLDKTVYYSQMKK--DMKMDSASHVQSKSTDNMKAITAARTITSLFPEISQNIFNNVVLCYTFTD 577
            P+ YAP+ASDF  I D  + F+  + P +P EQLM V P  S + +P  W+ LMTD +S I DFY +      +  K+  +   +LPF  E RL   L E Y  LT EEN+RN  G    F+   H   +     Y S+  +  DM  +    +Q K T N  A+   +T+ S  P + +++  N  +  +F D
Sbjct:  564 PFHYAPFASDFEGIADMPSDFEKGSKPFKPLEQLMGVFPAASGNFLPPTWRKLMTDPESSIIDFYPEDFAIDLNGKKYAWQGVALLPFVDERRLRAALEEVYPDLTPEENRRNSLGGDVLFVGKHHPLCDFIVEQYKSKNTEPVDMPPELCYGIQGKLTPNENAVLPDKTVESPVPML-RDLTQNSAVSISFKD 756          
BLAST of 5'-3' exoribonuclease vs. UniProt/SwissProt
Match: sp|Q60SG7|XRN2_CAEBR (5'-3' exoribonuclease 2 homolog OS=Caenorhabditis briggsae OX=6238 GN=xrn-2 PE=3 SV=2)

HSP 1 Score: 113.62 bits (283), Expect = 4.867e-27
Identity = 57/149 (38.26%), Postives = 82/149 (55.03%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRSDHSNFNLDKTVYYSQMKKDMKMDSA 448
            PY YAP+ASDF  + +F+  F   T P  P EQLM+V P  SK  +P+ WQ LMT+ +SPI D Y    +   +  K+  +   +LPF  E RLL+ L+  Y +LT EE  RN  G  + FI  +H +F   + V  S+    + +D +
Sbjct:  592 PYHYAPFASDFETVGEFKPDFTRPTKPFNPLEQLMSVFPAASKQHLPVEWQKLMTEDESPIIDLYPADFRIDLNGKKYAWQGVALLPFVDEQRLLETLKSVYPTLTDEEKYRNTRGPNRIFIGRNHKSFAFFQQVAESKSNDLVDLDPS 740          
BLAST of 5'-3' exoribonuclease vs. UniProt/SwissProt
Match: sp|Q9U299|XRN2_CAEEL (5'-3' exoribonuclease 2 homolog OS=Caenorhabditis elegans OX=6239 GN=xrn-2 PE=1 SV=2)

HSP 1 Score: 113.235 bits (282), Expect = 5.831e-27
Identity = 57/147 (38.78%), Postives = 80/147 (54.42%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRSDHSNFNLDKTVYYSQMKKDMKMD 442
            PY YAP+ASDF  + +F+  F   T P  P EQLM+V P  SK  +P+ WQ LM   DSPI D Y    +   +  K+  +   +LPF  E+RLL  L+  Y +LT EE +RN  G  + FI  +H +F   + V  S+    + +D
Sbjct:  591 PYHYAPFASDFETVGEFQPDFTRPTKPFNPLEQLMSVFPAASKQHLPVEWQKLMIQDDSPIIDLYPADFRIDLNGKKYAWQGVALLPFVDETRLLATLQSVYPTLTAEEKQRNTRGPNRIFIGRNHKSFEFFQQVAESKSDDLVPLD 737          
BLAST of 5'-3' exoribonuclease vs. UniProt/SwissProt
Match: sp|Q5R4L5|XRN2_PONAB (5'-3' exoribonuclease 2 OS=Pongo abelii OX=9601 GN=XRN2 PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.343e-25
Identity = 65/194 (33.51%), Postives = 96/194 (49.48%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRSDHS--NFNLDKTVYYSQMKKDMKMDSASHVQSKSTDNMKAITAARTITSLFPEISQNIFNNVVLCYTFTD 577
            P+ YAP+ASDF  I D  + F+  T P +P EQLM V P  S + +P  W+ LM+D DS I DFY +      +  K+  +   +LPF  E RL   L E Y  LT EE +RN  G    F+   H   +F L+     S    D+  +    +Q K + + +AI   + + S  P + +++  N V+   F D
Sbjct:  565 PFHYAPFASDFEGIADMPSDFEKGTKPFKPLEQLMGVFPAASGNFLPPSWRKLMSDPDSSIIDFYPEDFAIDLNGKKYAWQGVALLPFVDERRLRAALEEVYPDLTPEETRRNSLGGDVLFVGKHHPLHDFILELYQTGSTEPVDVPPELCHGIQGKFSLDEEAILPDQIVCSPVPML-RDLTQNTVVSINFKD 757          
BLAST of 5'-3' exoribonuclease vs. TrEMBL
Match: D5JG37 (Exoribonuclease-2 (Fragment) OS=Dugesia japonica OX=6161 GN=XRN-2 PE=2 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 2.023e-30
Identity = 67/173 (38.73%), Postives = 99/173 (57.23%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRSDHSNFNLDKTVYYSQMKKDMKMDSA--SHVQSKSTDNMKAITAARTITS 514
            PY YAP+A DF N+++ +  F+  T P  P EQLM V P +SKS +P  WQ+LMTD +SP+ D Y    K   +  ++      +LPF  E RLL+VL+ERY  LT +E +RN  G  +YF+RSDH   +L K +Y  +   D  +D +  + V  +   ++K+     T+ S
Sbjct:  421 PYHYAPFAVDFVNLSEADVTFEKKTKPFNPLEQLMGVFPADSKSHVPPVWQDLMTDSESPVIDLYPTNFKIDLNGKRYDWMGVALLPFVDEVRLLQVLKERYSMLTEDEKERNVIGPDRYFVRSDHPVADLIKVIYELEDNSDSVIDPSLTNGVVGRIWKDLKSYQPGSTVNS 593          
BLAST of 5'-3' exoribonuclease vs. TrEMBL
Match: A0A131XMG1 (5'-3' exoribonuclease OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 8.439e-30
Identity = 70/196 (35.71%), Postives = 103/196 (52.55%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRSDHSNFNLDKTVYYS----QMKKDMKMDSASHVQSKSTDNMKAITAARTITSLFPEISQNIFNNVVLCYTFTD 577
            PY YAP+ASDF N+ D +  F+  T P +P EQLM+V P  SK  +PL W +LM D DSPI DFY    K   +  K+  +   +LPF  E RLL+ ++  Y  LT +E KRN  G   +++R  H  +N    +Y +     M+ D++      +  K   +  A+     + S+ P +  NI  N+V+C  F D
Sbjct:  578 PYHYAPFASDFINVGDLKIEFERGTQPFKPMEQLMSVFPAASKQHLPLPWGDLMDDPDSPIIDFYPTDFKIDLNGKKYAWQGVALLPFVDEKRLLETVQTVYPFLTEDEKKRNTRGDDVFYVRKGHRGYNYLLGLYEACKDYNMEFDLEPKYFGGIAGKILLSHNAVGPGDDVRSVIPGLD-NIPGNMVVCVRFRD 772          
BLAST of 5'-3' exoribonuclease vs. TrEMBL
Match: A0A0A1WD90 (5'-3' exoribonuclease OS=Zeugodacus cucurbitae OX=28588 GN=Rat1 PE=3 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 1.257e-29
Identity = 77/198 (38.89%), Postives = 101/198 (51.01%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRSDHSNFNLDKTVYYS--QMKKDMK--MDSASHVQSKSTDNMKAITAARTITSLFPEISQNIFNNVVLCYTFTDTD 583
            PY YAP+ASDF NIT   T FD  T P  P EQLM V P  S S +P  W  LM+D DSPI DFY +  K   +  K   +   +LPF  E RL K L   Y  LT EE +RN+ G  + +I   H  F   K    S   M+K++K  +D  +    K+ DN+K   + R+     P    NI +N V+ + F D +
Sbjct:  550 PYHYAPFASDFVNITGLSTNFDKGTKPFNPLEQLMGVFPAASSSHVPDPWATLMSDPDSPIIDFYPEDFKIDLNGKKFAWQGVALLPFVDERRLFKALEPYYKKLTEEEVRRNKRGDNRLYIGPLHHKFEWLKHQLKSLNSMEKEIKVVLDGMAGSILKAEDNIKISGSLRSPILGLP----NIMSNEVVTFRFRDPE 743          
BLAST of 5'-3' exoribonuclease vs. TrEMBL
Match: A0A224YGB6 (5'-3' exoribonuclease OS=Rhipicephalus zambeziensis OX=60191 PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 3.812e-29
Identity = 69/196 (35.20%), Postives = 104/196 (53.06%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRSDHSNFNLDKTVYYS----QMKKDMKMDSASHVQSKSTDNMKAITAARTITSLFPEISQNIFNNVVLCYTFTD 577
            PY YAP+ASDF N+ D +  F+  T P +P EQLM+V P  SK  +PL W +LM D DSPI DFY    K   +  K+  +   +LPF  E RLL+ ++  Y  LT +E KRN  G   +++R  H  ++    +Y +     M+ D++    S +  K   +  A+     + S+ P +  +I  N+V+C  F D
Sbjct:  578 PYHYAPFASDFINVGDLKIEFERGTQPFKPMEQLMSVFPAASKQHLPLPWADLMDDPDSPIIDFYPTDFKIDLNGKKYAWQGVALLPFVDEKRLLETVQTVYPHLTEDEKKRNTRGDDVFYVRKGHRGYSYLLGLYEACKDYNMEFDLEPKYFSGIGGKILLSHNAVGPGDDVRSVIPGLD-DIPGNMVVCVRFRD 772          
BLAST of 5'-3' exoribonuclease vs. TrEMBL
Match: A0A131YAX2 (5'-3' exoribonuclease OS=Rhipicephalus appendiculatus OX=34631 PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 3.849e-29
Identity = 69/196 (35.20%), Postives = 104/196 (53.06%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRSDHSNFNLDKTVYYS----QMKKDMKMDSASHVQSKSTDNMKAITAARTITSLFPEISQNIFNNVVLCYTFTD 577
            PY YAP+ASDF N+ D +  F+  T P +P EQLM+V P  SK  +PL W +LM D DSPI DFY    K   +  K+  +   +LPF  E RLL+ ++  Y  LT +E KRN  G   +++R  H  ++    +Y +     M+ D++    S +  K   +  A+     + S+ P +  +I  N+V+C  F D
Sbjct:  578 PYHYAPFASDFINVGDLKIEFERGTQPFKPMEQLMSVFPAASKQHLPLPWADLMDDPDSPIIDFYPTDFKIDLNGKKYAWQGVALLPFVDEKRLLETVQTVYPHLTEDERKRNTRGDDVFYVRKGHRGYSYLVGLYEACKDYNMEFDLEPKYFSGIGGKILLSHNAVGPGDDVRSVIPGLD-DIPGNMVVCVRFRD 772          
BLAST of 5'-3' exoribonuclease vs. Ensembl Cavefish
Match: xrn2 (5'-3' exoribonuclease 2 [Source:NCBI gene;Acc:103036099])

HSP 1 Score: 100.523 bits (249), Expect = 1.587e-23
Identity = 52/142 (36.62%), Postives = 75/142 (52.82%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRSDHSNFNLDKTVYYSQMKK 427
            P+ YAP+ASDF +I D    F+  T P +P EQLM V P  S + +P  W+ LM++ DS I DFY        +  K+  +   +LPF  E RL   L + Y  LT EE +RN  G+   F+   H   +  K +Y S+ ++
Sbjct:  576 PFHYAPFASDFKDIKDMFKEFEKGTMPFKPLEQLMGVFPAASGNFLPETWRALMSNPDSSIIDFYPDDFAIDLNGKKYAWQGVALLPFVDERRLRGALADVYPDLTTEEIRRNSLGSDVVFVGKSHPLCDFIKELYSSESRE 717          
BLAST of 5'-3' exoribonuclease vs. Ensembl Cavefish
Match: xrn2 (5'-3' exoribonuclease 2 [Source:NCBI gene;Acc:103036099])

HSP 1 Score: 100.138 bits (248), Expect = 2.153e-23
Identity = 52/142 (36.62%), Postives = 75/142 (52.82%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRSDHSNFNLDKTVYYSQMKK 427
            P+ YAP+ASDF +I D    F+  T P +P EQLM V P  S + +P  W+ LM++ DS I DFY        +  K+  +   +LPF  E RL   L + Y  LT EE +RN  G+   F+   H   +  K +Y S+ ++
Sbjct:  576 PFHYAPFASDFKDIKDMFKEFEKGTMPFKPLEQLMGVFPAASGNFLPETWRALMSNPDSSIIDFYPDDFAIDLNGKKYAWQGVALLPFVDERRLRGALADVYPDLTTEEIRRNSLGSDVVFVGKSHPLCDFIKELYSSESRE 717          
BLAST of 5'-3' exoribonuclease vs. Ensembl Cavefish
Match: xrn1 (5'-3' exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1203])

HSP 1 Score: 79.7221 bits (195), Expect = 2.334e-16
Identity = 45/116 (38.79%), Postives = 60/116 (51.72%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHE-SRLLKVLRERYDSLTIEENKRNQH 346
            PY YAP+ SD  NI      FD    P  PFEQL+ VLP  SK L+P  +Q+LMT   SPI ++Y    K+  +  +   +   ++PF  E  RLL  +    D L   E  RN+H
Sbjct:  456 PYHYAPFLSDVRNIAGLRLTFDLGK-PFMPFEQLLGVLPAASKDLLPKCYQHLMTSEGSPIIEYYPLDFKTDLNGKQQEWEAVVLIPFIDEVKRLLAAMELYTDQLNKSEKSRNRH 570          
BLAST of 5'-3' exoribonuclease vs. Ensembl Cavefish
Match: xrn1 (5'-3' exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1203])

HSP 1 Score: 71.2478 bits (173), Expect = 1.038e-13
Identity = 37/94 (39.36%), Postives = 51/94 (54.26%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRL 283
            PY YAP+ SD  NI      FD    P  PFEQL+ VLP  SK L+P  +Q+LMT   SPI ++Y    K+  +  +   +   ++PF  E+ L
Sbjct:  376 PYHYAPFLSDVRNIAGLRLTFDLGK-PFMPFEQLLGVLPAASKDLLPKCYQHLMTSEGSPIIEYYPLDFKTDLNGKQQEWEAVVLIPFIDEAHL 468          
BLAST of 5'-3' exoribonuclease vs. Ensembl Sea Lamprey
Match: xrn1 (5'-3' exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1203])

HSP 1 Score: 89.7373 bits (221), Expect = 1.793e-20
Identity = 52/156 (33.33%), Postives = 85/156 (54.49%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTG-PLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRSDHSNFNLDKTVYYSQMKKDMKMDSASHVQSK 466
            PY YAP+ SD   I+  E     N G P  P++QL+AVLP  SK L+P  +Q+L++D  SP+ DFY K   +  +  +H  +   ++PF  E RLL+ ++     LT EE +RN H A   ++ +   +  +   +  +    ++ MD A HV+++
Sbjct:  520 PYHYAPFVSDVRGISKLE--LKLNLGQPFLPYQQLLAVLPSLSKQLLPQAYQSLVSDETSPLHDFYPKDFNTDLNGKQHEWEAVVLVPFICEKRLLEAMQSCEHLLTEEERQRNVHSACLEYLSNRTPSPQMQARIVQANRCVEVPMD-AWHVKTR 672          
BLAST of 5'-3' exoribonuclease vs. Ensembl Yeast
Match: RAT1 (Nuclear 5' to 3' single-stranded RNA exonuclease; involved in RNA metabolism, including rRNA and snoRNA processing, as well as poly (A+) dependent and independent mRNA transcription termination; required for cotranscriptional pre-rRNA cleavage; displaces Cdk1p from elongating transcripts, especially as RNAPII reaches the poly(A) site, negatively regulates phosphorylation of the CTD of RNAPII, and inhibits RNAPII transcriptional elongation [Source:SGD;Acc:S000005574])

HSP 1 Score: 82.4185 bits (202), Expect = 2.613e-18
Identity = 46/129 (35.66%), Postives = 69/129 (53.49%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRSDHSNF 388
            PY YAP A+DF   +  E  F+  T P  P+EQLM+VLP  S   +P  +++LM++ DS I DFY +      +  K   +   +LPF  + RLL  +R +Y  L+  E  RN  G     I + ++N+
Sbjct:  654 PYHYAPLATDFHGFSHLEIKFEEGT-PFLPYEQLMSVLPAASGHALPKIFRSLMSEPDSEIIDFYPEEFPIDMNGKKMSWQGIALLPFIDQDRLLTAVRAQYPLLSDAERARNIRGEPVLLISNKNANY 781          
BLAST of 5'-3' exoribonuclease vs. Ensembl Yeast
Match: XRN1 (Evolutionarily-conserved 5'-3' exonuclease; component of cytoplasmic processing (P) bodies involved in mRNA decay; also enters the nucleus and positively regulates transcription initiation and elongation; plays a role in microtubule-mediated processes, filamentous growth, ribosomal RNA maturation, and telomere maintenance; activated by the scavenger decapping enzyme Dcs1p [Source:SGD;Acc:S000003141])

HSP 1 Score: 74.3294 bits (181), Expect = 1.697e-15
Identity = 44/116 (37.93%), Postives = 62/116 (53.45%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHG 349
            P+ YAP  SD     D +  FD  + P  PF+QLMAVLP  SK+LIP  ++ LM D  SPI DFY   ++   +      +   ++ F  E RL++ ++     L+ EE  RNQ G
Sbjct:  560 PHHYAPRISDLAKGLDQDIEFDL-SKPFTPFQQLMAVLPERSKNLIPPAFRPLMYDEQSPIHDFYPAEVQLDKNGKTADWEAVVLISFVDEKRLIEAMQPYLRKLSPEEKTRNQFG 674          
BLAST of 5'-3' exoribonuclease vs. Ensembl Medaka
Match: xrn2 (5'-3' exoribonuclease 2 [Source:NCBI gene;Acc:101163131])

HSP 1 Score: 102.064 bits (253), Expect = 4.651e-24
Identity = 52/142 (36.62%), Postives = 75/142 (52.82%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRSDHSNFNLDKTVYYSQMKK 427
            P+ YAP+ASDF +I +  T F+ +T P +P EQLM+V P  S + +P  W+NLM   +S I DFY        +  K+  +   +LPF  E RL   L E Y  LT EE +RN  G+   F+   H  ++    +Y  +  K
Sbjct:  576 PFHYAPFASDFKDIKEMFTEFEKDTMPFKPLEQLMSVFPAASGNFLPPTWRNLMVSPESSIIDFYPDDFAIDLNGKKYAWQGVALLPFVDERRLRAALAEVYPDLTPEEARRNSLGSDVLFVGKSHPLYDFIHELYRDECNK 717          
BLAST of 5'-3' exoribonuclease vs. Ensembl Medaka
Match: xrn2 (5'-3' exoribonuclease 2 [Source:NCBI gene;Acc:101163131])

HSP 1 Score: 101.679 bits (252), Expect = 5.348e-24
Identity = 52/142 (36.62%), Postives = 75/142 (52.82%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRSDHSNFNLDKTVYYSQMKK 427
            P+ YAP+ASDF +I +  T F+ +T P +P EQLM+V P  S + +P  W+NLM   +S I DFY        +  K+  +   +LPF  E RL   L E Y  LT EE +RN  G+   F+   H  ++    +Y  +  K
Sbjct:  576 PFHYAPFASDFKDIKEMFTEFEKDTMPFKPLEQLMSVFPAASGNFLPPTWRNLMVSPESSIIDFYPDDFAIDLNGKKYAWQGVALLPFVDERRLRAALAEVYPDLTPEEARRNSLGSDVLFVGKSHPLYDFIHELYRDECNK 717          
BLAST of 5'-3' exoribonuclease vs. Ensembl Medaka
Match: xrn2 (5'-3' exoribonuclease 2 [Source:NCBI gene;Acc:101163131])

HSP 1 Score: 100.523 bits (249), Expect = 1.448e-23
Identity = 52/142 (36.62%), Postives = 75/142 (52.82%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRSDHSNFNLDKTVYYSQMKK 427
            P+ YAP+ASDF +I +  T F+ +T P +P EQLM+V P  S + +P  W+NLM   +S I DFY        +  K+  +   +LPF  E RL   L E Y  LT EE +RN  G+   F+   H  ++    +Y  +  K
Sbjct:  576 PFHYAPFASDFKDIKEMFTEFEKDTMPFKPLEQLMSVFPAASGNFLPPTWRNLMVSPESSIIDFYPDDFAIDLNGKKYAWQGVALLPFVDERRLRAALAEVYPDLTPEEARRNSLGSDVLFVGKSHPLYDFIHELYRDECNK 717          
BLAST of 5'-3' exoribonuclease vs. Ensembl Medaka
Match: xrn1 (5'-3' exoribonuclease 1 [Source:NCBI gene;Acc:101169885])

HSP 1 Score: 83.9593 bits (206), Expect = 7.235e-18
Identity = 44/115 (38.26%), Postives = 64/115 (55.65%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQH 346
            PY YAP+ SD  NI+D +  F+    P  PF+QL+AVLP  S  L+P  +++LMT  +SPI ++Y    K+  +  +   +   ++PF  E RLL  +      LT EE  RN H
Sbjct:  482 PYHYAPFLSDIRNISDLKLTFELGE-PFMPFQQLLAVLPAASMGLLPECYRHLMTSENSPIIEYYPVDFKTDLNGKQQEWEAVVLIPFIDEKRLLAAMEPYNHKLTKEEKDRNGH 595          
BLAST of 5'-3' exoribonuclease vs. Ensembl Medaka
Match: xrn1 (5'-3' exoribonuclease 1 [Source:NCBI gene;Acc:101169885])

HSP 1 Score: 83.9593 bits (206), Expect = 7.381e-18
Identity = 44/115 (38.26%), Postives = 64/115 (55.65%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQH 346
            PY YAP+ SD  NI+D +  F+    P  PF+QL+AVLP  S  L+P  +++LMT  +SPI ++Y    K+  +  +   +   ++PF  E RLL  +      LT EE  RN H
Sbjct:  482 PYHYAPFLSDIRNISDLKLTFELGE-PFMPFQQLLAVLPAASMGLLPECYRHLMTSENSPIIEYYPVDFKTDLNGKQQEWEAVVLIPFIDEKRLLAAMEPYNHKLTKEEKDRNGH 595          
BLAST of 5'-3' exoribonuclease vs. Planmine SMEST
Match: SMESG000008668.1 (SMESG000008668.1)

HSP 1 Score: 433.721 bits (1114), Expect = 9.518e-151
Identity = 205/205 (100.00%), Postives = 205/205 (100.00%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRSDHSNFNLDKTVYYSQMKKDMKMDSASHVQSKSTDNMKAITAARTITSLFPEISQNIFNNVVLCYTFTDTDLCIHFRYEGQS 616
            PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRSDHSNFNLDKTVYYSQMKKDMKMDSASHVQSKSTDNMKAITAARTITSLFPEISQNIFNNVVLCYTFTDTDLCIHFRYEGQS
Sbjct:  380 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRSDHSNFNLDKTVYYSQMKKDMKMDSASHVQSKSTDNMKAITAARTITSLFPEISQNIFNNVVLCYTFTDTDLCIHFRYEGQS 584          
BLAST of 5'-3' exoribonuclease vs. Planmine SMEST
Match: SMESG000047308.1 (SMESG000047308.1)

HSP 1 Score: 130.954 bits (328), Expect = 4.066e-34
Identity = 72/191 (37.70%), Postives = 105/191 (54.97%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHGAFKYFIRSDHSNFNLDKTVYYSQMKKDMKMDS--ASHVQSKSTDNMKAITAARTITSLFPEISQNIFN-NVVLCY 565
            PY YAP+A DF N++D +  F+ ++ P  P EQLM V P +SK+ +P  WQ+LMTD +SP+ D Y    K   +  ++      +LPF  E RLLKVLRER+  LT EE +RN  G  +YF+RSDH   ++ K +Y      D  +D    + V  +   ++KA     T+        ++I N  VV C+
Sbjct:  570 PYHYAPFAVDFVNLSDADVEFEKDSKPFNPLEQLMGVFPADSKAHVPPAWQDLMTDHESPVIDLYPTNFKIDLNGKRYDWMGVALLPFVDEVRLLKVLRERHSLLTEEEKERNIIGPDRYFVRSDHPVADVIKVIYELGDTTDSVIDPNLTNGVTGRIWKDLKAYQPGDTVKCPINGSCEDIPNVKVVSCF 760          
BLAST of 5'-3' exoribonuclease vs. Planmine SMEST
Match: SMESG000080199.1 (SMESG000080199.1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.603e-18
Identity = 44/119 (36.97%), Postives = 68/119 (57.14%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITD--FETCFDSNTG-PLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHG 349
            P  YAP+ SD +N+++   E   D   G P  PFEQLMAVLP +S  L+P  + +LM + +SPI DFY K  ++  +  K   +   ++PF  E RLL+ +  +   ++  + +RN HG
Sbjct:  422 PQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHG 540          
BLAST of 5'-3' exoribonuclease vs. Planmine SMEST
Match: SMESG000080199.1 (SMESG000080199.1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.681e-18
Identity = 44/119 (36.97%), Postives = 68/119 (57.14%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITD--FETCFDSNTG-PLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHG 349
            P  YAP+ SD +N+++   E   D   G P  PFEQLMAVLP +S  L+P  + +LM + +SPI DFY K  ++  +  K   +   ++PF  E RLL+ +  +   ++  + +RN HG
Sbjct:  428 PQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHG 546          
BLAST of 5'-3' exoribonuclease vs. Planmine SMEST
Match: SMESG000080199.1 (SMESG000080199.1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.704e-18
Identity = 44/119 (36.97%), Postives = 68/119 (57.14%), Query Frame = 2
Query:    2 PYEYAPYASDFTNITD--FETCFDSNTG-PLRPFEQLMAVLPIESKSLIPLGWQNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRERYDSLTIEENKRNQHG 349
            P  YAP+ SD +N+++   E   D   G P  PFEQLMAVLP +S  L+P  + +LM + +SPI DFY K  ++  +  K   +   ++PF  E RLL+ +  +   ++  + +RN HG
Sbjct:  561 PQHYAPFISDISNLSNDLKENGIDFQIGRPFLPFEQLMAVLPADSSELLPFCYHSLMKEENSPIIDFYPKKFRTDLNGKKKEWEAVVLIPFIEEKRLLEAMESKQSQISPSDIRRNVHG 679          
The following BLAST results are available for this feature:
BLAST of 5'-3' exoribonuclease vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
XRN28.927e-2631.965'-3' exoribonuclease 2 [Source:HGNC Symbol;Acc:HG... [more]
XRN12.296e-2142.615'-3' exoribonuclease 1 [Source:HGNC Symbol;Acc:HG... [more]
XRN12.364e-2142.615'-3' exoribonuclease 1 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of 5'-3' exoribonuclease vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
xrn-24.584e-2838.785'-3' exoribonuclease 2 homolog [Source:UniProtKB... [more]
xrn-18.689e-1634.925'-3' exoribonuclease 1 [Source:UniProtKB/TrEMBL;... [more]
xrn-18.689e-1634.925'-3' exoribonuclease 1 [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of 5'-3' exoribonuclease vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Rat15.486e-3034.33gene:FBgn0031868 transcript:FBtr0079345[more]
Rat15.486e-3034.33gene:FBgn0031868 transcript:FBtr0332324[more]
pcm3.849e-1937.40gene:FBgn0020261 transcript:FBtr0074784[more]
pcm3.849e-1937.40gene:FBgn0020261 transcript:FBtr0302082[more]
back to top
BLAST of 5'-3' exoribonuclease vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
xrn23.807e-2335.975'-3' exoribonuclease 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
xrn15.780e-1839.135'-3' exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
xrn14.611e-1440.915'-3' exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of 5'-3' exoribonuclease vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpl292.776e-2345.53ribosomal protein L29 [Source:Xenbase;Acc:XB-GENE-... [more]
rpl292.869e-2345.53ribosomal protein L29 [Source:Xenbase;Acc:XB-GENE-... [more]
rpl292.932e-2345.53ribosomal protein L29 [Source:Xenbase;Acc:XB-GENE-... [more]
rpl292.986e-2345.53ribosomal protein L29 [Source:Xenbase;Acc:XB-GENE-... [more]
rpl293.005e-2345.53ribosomal protein L29 [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of 5'-3' exoribonuclease vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Xrn22.390e-2633.515'-3' exoribonuclease 2 [Source:MGI Symbol;Acc:MGI... [more]
Xrn19.258e-2141.745'-3' exoribonuclease 1 [Source:MGI Symbol;Acc:MGI... [more]
Xrn11.066e-2041.745'-3' exoribonuclease 1 [Source:MGI Symbol;Acc:MGI... [more]
Xrn11.421e-2041.745'-3' exoribonuclease 1 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of 5'-3' exoribonuclease vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VM71|XRN2_DROME5.499e-2934.335'-3' exoribonuclease 2 homolog OS=Drosophila mela... [more]
sp|Q5ZIP4|XRN2_CHICK4.089e-2834.025'-3' exoribonuclease 2 OS=Gallus gallus OX=9031 G... [more]
sp|Q60SG7|XRN2_CAEBR4.867e-2738.265'-3' exoribonuclease 2 homolog OS=Caenorhabditis ... [more]
sp|Q9U299|XRN2_CAEEL5.831e-2738.785'-3' exoribonuclease 2 homolog OS=Caenorhabditis ... [more]
sp|Q5R4L5|XRN2_PONAB1.343e-2533.515'-3' exoribonuclease 2 OS=Pongo abelii OX=9601 GN... [more]
back to top
BLAST of 5'-3' exoribonuclease vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D5JG372.023e-3038.73Exoribonuclease-2 (Fragment) OS=Dugesia japonica O... [more]
A0A131XMG18.439e-3035.715'-3' exoribonuclease OS=Hyalomma excavatum OX=257... [more]
A0A0A1WD901.257e-2938.895'-3' exoribonuclease OS=Zeugodacus cucurbitae OX=... [more]
A0A224YGB63.812e-2935.205'-3' exoribonuclease OS=Rhipicephalus zambeziensi... [more]
A0A131YAX23.849e-2935.205'-3' exoribonuclease OS=Rhipicephalus appendicula... [more]
back to top
BLAST of 5'-3' exoribonuclease vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
xrn21.587e-2336.625'-3' exoribonuclease 2 [Source:NCBI gene;Acc:1030... [more]
xrn22.153e-2336.625'-3' exoribonuclease 2 [Source:NCBI gene;Acc:1030... [more]
xrn12.334e-1638.795'-3' exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
xrn11.038e-1339.365'-3' exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of 5'-3' exoribonuclease vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
xrn11.793e-2033.335'-3' exoribonuclease 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of 5'-3' exoribonuclease vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RAT12.613e-1835.66Nuclear 5' to 3' single-stranded RNA exonuclease; ... [more]
XRN11.697e-1537.93Evolutionarily-conserved 5'-3' exonuclease; compon... [more]
back to top
BLAST of 5'-3' exoribonuclease vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 5'-3' exoribonuclease vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
xrn24.651e-2436.625'-3' exoribonuclease 2 [Source:NCBI gene;Acc:1011... [more]
xrn25.348e-2436.625'-3' exoribonuclease 2 [Source:NCBI gene;Acc:1011... [more]
xrn21.448e-2336.625'-3' exoribonuclease 2 [Source:NCBI gene;Acc:1011... [more]
xrn17.235e-1838.265'-3' exoribonuclease 1 [Source:NCBI gene;Acc:1011... [more]
xrn17.381e-1838.265'-3' exoribonuclease 1 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of 5'-3' exoribonuclease vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008668.19.518e-151100.00SMESG000008668.1[more]
SMESG000047308.14.066e-3437.70SMESG000047308.1[more]
SMESG000080199.11.603e-1836.97SMESG000080199.1[more]
SMESG000080199.11.681e-1836.97SMESG000080199.1[more]
SMESG000080199.11.704e-1836.97SMESG000080199.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008183 ID=SMED30008183|Name=5'-3' exoribonuclease|organism=Schmidtea mediterranea sexual|type=transcript|length=807bp
TCCATATGAATATGCTCCTTACGCAAGTGATTTTACAAATATTACTGATT
TTGAAACATGCTTTGACAGCAACACTGGACCTTTGAGACCTTTCGAACAG
TTAATGGCAGTACTTCCAATTGAATCTAAATCTCTGATTCCTTTGGGATG
GCAAAATCTGATGACAGATGTTGATTCTCCAATTAAAGATTTTTATCAGA
AAGGTTTAAAATCAACATTTCATGTCGGTAAACATTGTATGAAGACATTT
GAAATGTTGCCATTTGCTCATGAAAGTCGACTTTTGAAAGTTCTACGGGA
GAGATATGATTCATTAACAATAGAAGAGAATAAACGGAATCAACATGGAG
CCTTTAAATATTTTATAAGATCGGATCATTCAAACTTTAACTTAGACAAG
ACAGTGTATTACTCTCAAATGAAGAAAGATATGAAAATGGATTCTGCATC
TCATGTTCAAAGTAAATCAACTGACAATATGAAAGCTATCACGGCAGCTA
GAACTATAACTTCTCTATTTCCTGAAATATCTCAAAATATATTCAATAAT
GTAGTTCTTTGCTACACTTTTACGGATACAGATCTGTGTATTCATTTCCG
ATATGAGGGCCAATCATAAATTTAGACATAATTATATGTGCATTACAACG
TGAAGTAAGCGCTACCAAATATGAAATTTATTAAAACAAAAAATATACAT
TAATTTTTCTCCAAAAACCTCGTTACGGCTTGTTTTCAAGAACAAAAATT
TGTAAAATGTTGTCGGACTCCAAAACTCCTCTTTATTTTGATATGAATAA
ATCAAAT
back to top

protein sequence of SMED30008183-orf-1

>SMED30008183-orf-1 ID=SMED30008183-orf-1|Name=SMED30008183-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=206bp
PYEYAPYASDFTNITDFETCFDSNTGPLRPFEQLMAVLPIESKSLIPLGW
QNLMTDVDSPIKDFYQKGLKSTFHVGKHCMKTFEMLPFAHESRLLKVLRE
RYDSLTIEENKRNQHGAFKYFIRSDHSNFNLDKTVYYSQMKKDMKMDSAS
HVQSKSTDNMKAITAARTITSLFPEISQNIFNNVVLCYTFTDTDLCIHFR
YEGQS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004518nuclease activity
GO:0016787hydrolase activity
GO:0003676nucleic acid binding
GO:0004527exonuclease activity
GO:00045345'-3' exoribonuclease activity
Vocabulary: biological process
TermDefinition
GO:0006397mRNA processing
GO:0006139nucleobase-containing compound metabolic process
GO:0090305nucleic acid phosphodiester bond hydrolysis
GO:0090503RNA phosphodiester bond hydrolysis, exonucleolytic
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR041412Xrn1_helical
IPR0270735_3_exoribonuclease
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR041412Xrn1, helical domainPFAMPF17846XRN_Mcoord: 1..192
e-value: 1.3E-38
score: 133.1
NoneNo IPR availableGENE3DG3DSA:3.30.110.100coord: 9..115
e-value: 8.3E-17
score: 64.0
NoneNo IPR availablePANTHERPTHR12341:SF415'-3' EXORIBONUCLEASE 2coord: 1..194
IPR0270735'-3' exoribonucleasePANTHERPTHR123415'->3' EXORIBONUCLEASEcoord: 1..194