TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30008172
Length (bp)2958
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30008172) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30008172) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30008172) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30008172) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008172

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30008172h1SMcG0018984 SmedASXL_064094SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30008172h1SMcG0018984 SmedASXL_064094SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30008172h1SMcG0018984 dd_Smed_v4_10424_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30008172h1SMcG0018984 dd_Smed_v4_10424_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30008172h1SMcG0018984 dd_Smed_v4_10424_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30008172h1SMcG0018984 dd_Smed_v4_10424_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 105.531 bits (262), Expect = 2.823e-24
Identity = 95/351 (27.07%), Postives = 154/351 (43.87%), Query Frame = 1
Query: 1291 KCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLN--PDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLL---------------VSKIPYIQSSIHDLKEDLENNKNIITELFS-----------ISKSIQELIMKKFSINAEKCLQNEFRSGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGYNCKCKFIHLGIWIVE 2259
            +C +C   LR A QT CG R C  CI + +     KCP  DN +LL EN+LF D    REI  L V CP + C  + +L+ +  H   CE+ ++DC +C++     H   H +  C  R V+C+ C  S+   +   IH    P    +C+        N    ++     + L+C      C F+   C+  +K+ + +L  H  +N   H  +L               +S++   Q +IH L+  L    + I EL +           + ++I+ L  K   I A++C      +G +IWKI NF   +   +  +   I S  FY+ + GY   C  +HL +   +
Sbjct:   69 ECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCP-VDNEILL-ENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDK-EIHDQNCPLANVICE------YCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCH--EKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQC------NGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKL-CMRLHLQLPTAQ 401          

HSP 2 Score: 28.4906 bits (62), Expect = 2.823e-24
Identity = 10/32 (31.25%), Postives = 19/32 (59.38%), Query Frame = 3
Query: 2259 GSHLSVSFEIINGDYDQILSWPFKHNIQIGIF 2354
             +++S+    + G+YD  L WPF+  I++ I 
Sbjct:  404 ANYISLFVHTMQGEYDSHLPWPFQGTIRLTIL 435          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 105.531 bits (262), Expect = 2.823e-24
Identity = 95/351 (27.07%), Postives = 154/351 (43.87%), Query Frame = 1
Query: 1291 KCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLN--PDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLL---------------VSKIPYIQSSIHDLKEDLENNKNIITELFS-----------ISKSIQELIMKKFSINAEKCLQNEFRSGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGYNCKCKFIHLGIWIVE 2259
            +C +C   LR A QT CG R C  CI + +     KCP  DN +LL EN+LF D    REI  L V CP + C  + +L+ +  H   CE+ ++DC +C++     H   H +  C  R V+C+ C  S+   +   IH    P    +C+        N    ++     + L+C      C F+   C+  +K+ + +L  H  +N   H  +L               +S++   Q +IH L+  L    + I EL +           + ++I+ L  K   I A++C      +G +IWKI NF   +   +  +   I S  FY+ + GY   C  +HL +   +
Sbjct:   69 ECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCP-VDNEILL-ENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDK-EIHDQNCPLANVICE------YCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCH--EKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQC------NGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKL-CMRLHLQLPTAQ 401          

HSP 2 Score: 28.4906 bits (62), Expect = 2.823e-24
Identity = 10/32 (31.25%), Postives = 19/32 (59.38%), Query Frame = 3
Query: 2259 GSHLSVSFEIINGDYDQILSWPFKHNIQIGIF 2354
             +++S+    + G+YD  L WPF+  I++ I 
Sbjct:  404 ANYISLFVHTMQGEYDSHLPWPFQGTIRLTIL 435          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF2 (TNF receptor associated factor 2 [Source:HGNC Symbol;Acc:HGNC:12032])

HSP 1 Score: 75.485 bits (184), Expect = 2.938e-19
Identity = 79/363 (21.76%), Postives = 144/363 (39.67%), Query Frame = 1
Query: 1294 CKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSC-------DNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSI-GVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDY-VSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKI----PYIQSSIHDLKEDLE----------NNKNII-------------------------TELFSISKSIQEL----IMKKFSIN--AEKCLQNEFRS--GNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGY 2214
            C  C  VLR   Q +CG R C  C+   L++G + C +C       +   +L  +  F D A  RE+  L  VCP D C ++  L+     H   C   + +C  CK  +    ++ H  + C  R ++C +C+      ++   H      E+C  + ++       +  +   + H+  C   +  C F+ I C  ++ +  E    H  +    H  +L+S +    P +    H   E L+            +NI+                          ++ ++S  +Q+L     +K  ++    +K L+ E  +  G FIWKI +F +   +       +IFS +FY+  +GY
Sbjct:   34 CSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHH------EVCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGC--LETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGY 388          

HSP 2 Score: 41.2022 bits (95), Expect = 2.938e-19
Identity = 29/110 (26.36%), Postives = 50/110 (45.45%), Query Frame = 3
Query: 2214 QLQMQIYPFGYLDCRGSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSRCQTIAPEIDSPHENQFVGIQNFLSFTELHSFIFK---------DKSIYLKLIVN 2516
            ++ ++IY  G    RG+HLS+ F ++ G  D +L WPF   + + +  +  RE        P++ S    + V   N  S   L   + K         D +I++K IV+
Sbjct:  389 KMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNRE-HVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 497          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF4 (TNF receptor associated factor 4 [Source:HGNC Symbol;Acc:HGNC:12034])

HSP 1 Score: 72.7886 bits (177), Expect = 1.187e-16
Identity = 84/358 (23.46%), Postives = 151/358 (42.18%), Query Frame = 1
Query: 1261 FEFTNAPDR-CKCKLCFKVLRNAKQ-TECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVC--PLDLCQFRSKLQSIGVHMNSCEYRVIDC-RKCKQKITAIHEQDHNINLCEMRIVTCEYC-----------------QRSIKLN-----EMIPIHLNPDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLV----------SKIPYIQSSIHDLKEDLENNKNIITELFSISKS-IQELI--MKKFSINAEKCLQNEFRSGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGY 2214
            ++F   P R   C LC K +R   Q + CG R C  C+QE+L+ G  KCP  ++ + L+  K++ D     ++  L + C    + C++   L+ +  H+N+C + VI C  +C  K++      H  + C  R + CE+C                 Q S+         M+   L       C      C     +     I+ H  +C      CP NQ    T+   ++E+L  H   +    NT LV           + P +  + H ++E ++ +  ++  L S  +  +QEL   +++ S+ ++         G  IWKI ++ + + + K       FS +FY+ ++GY
Sbjct:    6 YKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCP--EDQLPLDYAKIYPDPELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVIPCPNRCPMKLSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGMCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCTYCTKEFVFDTIQSHQYQCPRLPVACP-NQCGVGTV---AREDLPGHLKDS---CNTALVLCPFKDSGCKHRCPKLAMARH-VEESVKPHLAMMCALVSRQRQELQELRRELEELSVGSD---------GVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGY 344          

HSP 2 Score: 35.4242 bits (80), Expect = 1.187e-16
Identity = 15/61 (24.59%), Postives = 30/61 (49.18%), Query Frame = 3
Query: 2214 QLQMQIYPFGYLDCRGSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSRCQTIA 2396
            +LQ+  +  G     G+HLS+   ++ G +D +L WPF   +   +  +    L++ Q + 
Sbjct:  345 KLQVSAFLNGNGSGEGTHLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVT 405          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF4 (TNF receptor associated factor 4 [Source:HGNC Symbol;Acc:HGNC:12034])

HSP 1 Score: 72.7886 bits (177), Expect = 3.833e-16
Identity = 84/358 (23.46%), Postives = 151/358 (42.18%), Query Frame = 1
Query: 1261 FEFTNAPDR-CKCKLCFKVLRNAKQ-TECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVC--PLDLCQFRSKLQSIGVHMNSCEYRVIDC-RKCKQKITAIHEQDHNINLCEMRIVTCEYC-----------------QRSIKLN-----EMIPIHLNPDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLV----------SKIPYIQSSIHDLKEDLENNKNIITELFSISKS-IQELI--MKKFSINAEKCLQNEFRSGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGY 2214
            ++F   P R   C LC K +R   Q + CG R C  C+QE+L+ G  KCP  ++ + L+  K++ D     ++  L + C    + C++   L+ +  H+N+C + VI C  +C  K++      H  + C  R + CE+C                 Q S+         M+   L       C      C     +     I+ H  +C      CP NQ    T+   ++E+L  H   +    NT LV           + P +  + H ++E ++ +  ++  L S  +  +QEL   +++ S+ ++         G  IWKI ++ + + + K       FS +FY+ ++GY
Sbjct:    6 YKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCP--EDQLPLDYAKIYPDPELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVIPCPNRCPMKLSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGMCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCTYCTKEFVFDTIQSHQYQCPRLPVACP-NQCGVGTV---AREDLPGHLKDS---CNTALVLCPFKDSGCKHRCPKLAMARH-VEESVKPHLAMMCALVSRQRQELQELRRELEELSVGSD---------GVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGY 344          

HSP 2 Score: 33.4982 bits (75), Expect = 3.833e-16
Identity = 20/79 (25.32%), Postives = 34/79 (43.04%), Query Frame = 3
Query: 2214 QLQMQIYPFGYLDCRGSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSRCQTIAPEIDS----PHENQFVGI 2438
            +LQ+  +  G     G+HLS+   ++ G +D +L WPF          R      R  +   E+ +    P  ++ VGI
Sbjct:  345 KLQVSAFLNGNGSGEGTHLSLYIRVLPGAFDNLLEWPFARRGLSPFLGRADMPWCRSHSTRTEVPAQVLCPKSHKGVGI 423          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 65.0846 bits (157), Expect = 8.205e-16
Identity = 69/327 (21.10%), Postives = 130/327 (39.76%), Query Frame = 1
Query: 1279 PDRCKCKLCFKVLRNAKQTECGCRVCGQCIQ-EYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDL--CQFRSKLQSIGVHMNSCEYR-VIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDYV--SXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKIPYIQSSIHDLKEDLENNKNIITELFSISKSIQELIMKKFSINAEKCLQNEFRSGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGYN---CKCKF 2232
            P  C C +C + LR+  +  C    C QC + E    G   C +C    ++       D+A  ++I  L VVC  +   C +  +L ++  H++ C ++  + C KC ++      + H    CE+    C +C ++I+ ++         + + C   +           + ++ I+ H   C N    CPF    C       KE++  H +   + H   L  +I  ++ +   ++ D+ +  +  T + S +++  E+   +                  IWKI+   +   + K     +IFS  F S  FGY    C C F
Sbjct:   13 PADCTCPICEQALRDPIKLNCDHHYCRQCFENENRTPG---CAAC--QTIIQPELCQHDRAKQKQILALPVVCTFESSGCPWDGQLGTLHDHLSECTFKSSLKCEKCGRQFAKNDLEKHRAK-CELNRAVCSFCNKTIRDSD------RERHPKTCPQVIISCPFQCGLTDRPRLEIEAHCPSCPNVDNVCPFVPYGCTFAG--GKESIQQHLSDEPVRHLMYLCDEITDLKGTYELMERDMGSFNDRQTRILSAAETCTEMFGPQ-----------------LIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLF 308          

HSP 2 Score: 38.891 bits (89), Expect = 8.205e-16
Identity = 28/107 (26.17%), Postives = 47/107 (43.93%), Query Frame = 3
Query: 2238 FGYLDCRGSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSRCQ---TIAPEIDSPHE----------NQFVGIQNFLSFTELHSFIFKDKSIYLKLIVNK 2519
            FG     G  +S+   ++ G++D  L WPF   I+I +  +  R   R      I P     +E          N   G Q+F S   L +++ KD  IY+++ V++
Sbjct:  308 FGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRVNITYVIDPRKLKANEKFLARPRGERNAAFGSQSFCSLAILQNYV-KDDKIYVQIDVDR 413          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf6 (gene:FBgn0265464 transcript:FBtr0071188)

HSP 1 Score: 50.0618 bits (118), Expect = 9.272e-6
Identity = 32/96 (33.33%), Postives = 45/96 (46.88%), Query Frame = 1
Query: 1285 RCKCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDL--CQFRSKLQSIGVHMNSCEYR 1566
            R +C +C   L     T CG R C  C+  ++   ++ CP  DN  L  E+ +F D  T REI QL+  CP     C   +    +  H+ SC YR
Sbjct:  101 RYECAICIDWLNEPVLTSCGHRFCRSCLTAWMQKNNQCCP-MDNKRLSAEHDIFPDNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPSCPYR 195          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 84.3445 bits (207), Expect = 2.505e-16
Identity = 81/361 (22.44%), Postives = 149/361 (41.27%), Query Frame = 1
Query: 1291 KCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDYVSXXXXXXXXXXXXXXXRHL-LECINKKKKCPFNQINCNTIDKLSKENLVSH--------------FNKNEIYHNTLLVSKIPYIQSSIHDLKEDLENNKNIITELFSISKSIQEL---IMKKFSINAEKCLQNEFR--------------------------SGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGYNCKCKFIHL 2241
            +C +C   LR+A QT CG R C  CI++ +    +KCP  DN VLL E +LF D    REI  L V C    C  + +L+ +  H++ C +    C +C++ +   H  +H    C  RI+TC  C  S          +  ++E+ C    ++C     +  +  +  H   +C+     C F+   C   +K+++  L  H              F +++  +N  + S   ++ S          ++     EL ++ +++ EL   ++++     E C+ N+ +                           G ++W++ENF   +   +  +   + S  FY+   GY   C  +HL
Sbjct:   70 ECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCP-VDNEVLLEE-QLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCPQCQESVPISHLDEHKSQHCLQRIMTCPDCAGSFVYA------VKQNHEQFCPFANTVCEYCEMELIRDQLALHCDTDCLKAPVACTFSTFGCR--EKMTRNELAQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSPDSCQCKQELLNLRETVLELEGRLVRQDQQIRELCIHNDTQKNQVTELRRKLVSLEESTRELEAQQYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKL-CLRLHL 419          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 84.3445 bits (207), Expect = 2.505e-16
Identity = 81/361 (22.44%), Postives = 149/361 (41.27%), Query Frame = 1
Query: 1291 KCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDYVSXXXXXXXXXXXXXXXRHL-LECINKKKKCPFNQINCNTIDKLSKENLVSH--------------FNKNEIYHNTLLVSKIPYIQSSIHDLKEDLENNKNIITELFSISKSIQEL---IMKKFSINAEKCLQNEFR--------------------------SGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGYNCKCKFIHL 2241
            +C +C   LR+A QT CG R C  CI++ +    +KCP  DN VLL E +LF D    REI  L V C    C  + +L+ +  H++ C +    C +C++ +   H  +H    C  RI+TC  C  S          +  ++E+ C    ++C     +  +  +  H   +C+     C F+   C   +K+++  L  H              F +++  +N  + S   ++ S          ++     EL ++ +++ EL   ++++     E C+ N+ +                           G ++W++ENF   +   +  +   + S  FY+   GY   C  +HL
Sbjct:   70 ECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCP-VDNEVLLEE-QLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCPQCQESVPISHLDEHKSQHCLQRIMTCPDCAGSFVYA------VKQNHEQFCPFANTVCEYCEMELIRDQLALHCDTDCLKAPVACTFSTFGCR--EKMTRNELAQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSPDSCQCKQELLNLRETVLELEGRLVRQDQQIRELCIHNDTQKNQVTELRRKLVSLEESTRELEAQQYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKL-CLRLHL 419          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 84.3445 bits (207), Expect = 2.505e-16
Identity = 81/361 (22.44%), Postives = 149/361 (41.27%), Query Frame = 1
Query: 1291 KCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDYVSXXXXXXXXXXXXXXXRHL-LECINKKKKCPFNQINCNTIDKLSKENLVSH--------------FNKNEIYHNTLLVSKIPYIQSSIHDLKEDLENNKNIITELFSISKSIQEL---IMKKFSINAEKCLQNEFR--------------------------SGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGYNCKCKFIHL 2241
            +C +C   LR+A QT CG R C  CI++ +    +KCP  DN VLL E +LF D    REI  L V C    C  + +L+ +  H++ C +    C +C++ +   H  +H    C  RI+TC  C  S          +  ++E+ C    ++C     +  +  +  H   +C+     C F+   C   +K+++  L  H              F +++  +N  + S   ++ S          ++     EL ++ +++ EL   ++++     E C+ N+ +                           G ++W++ENF   +   +  +   + S  FY+   GY   C  +HL
Sbjct:   70 ECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCP-VDNEVLLEE-QLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCPQCQESVPISHLDEHKSQHCLQRIMTCPDCAGSFVYA------VKQNHEQFCPFANTVCEYCEMELIRDQLALHCDTDCLKAPVACTFSTFGCR--EKMTRNELAQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSPDSCQCKQELLNLRETVLELEGRLVRQDQQIRELCIHNDTQKNQVTELRRKLVSLEESTRELEAQQYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKL-CLRLHL 419          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2a (Tnf receptor-associated factor 2a [Source:ZFIN;Acc:ZDB-GENE-071120-2])

HSP 1 Score: 82.0333 bits (201), Expect = 1.615e-15
Identity = 70/270 (25.93%), Postives = 121/270 (44.81%), Query Frame = 1
Query: 1282 DRCKCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSC-------DNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGV-HMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLN--PDNEEMCDDYVSX-XXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKIPYIQSSIHDLK-EDLENNKNIITELFSISKSIQELIMK 2055
            D+  C +C K+LR   Q +CG R C  C  + +++G +KC +C       +   +L +   F D A  RE+  LE VC  + C +   ++     H   C++R++ C  CK+ + A   + HN   C  R + C+YC+         P H      ++E+C  Y  I       +  +     H+  C   +  C F+ + C+    + KE +  H       H  LL+  I  I+ ++  L+ + LE   + I EL    +S++EL +K
Sbjct:   30 DKHLCNICLKILRRPFQAQCGHRFCSYCFNKAVSSGPQKCSACIKEDIFEEPTSILKQGCAFPDNAAKREVEALEAVCINEECSWTGTIKEYEANHEGKCDFRILPCPSCKELLRANELERHNERECPERTLNCKYCKE--------PFHFKNIKAHDEICPKYPMICEGCAKKKIPREKYVDHIKLCTKFRTPCRFHVVGCDMT--VEKEKIHDHEQACSYEHLNLLLHFIMGIKVNLESLQPQSLELASHKIHELH---QSLRELELK 286          

HSP 2 Score: 41.9726 bits (97), Expect = 2.445e-7
Identity = 31/111 (27.93%), Postives = 53/111 (47.75%), Query Frame = 3
Query: 2214 QLQMQIYPFGYLDCRGSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSRCQTIAPEIDSPHENQFVGIQNFLSFTEL----------HSFIFKDKSIYLKLIVN 2516
            ++ ++IY  G    RG+HLS+ F ++ G  D +L WPF   + + +  +  RE        P+I S    + V   N  S   L          +S+I +D +I++K IV+
Sbjct:  463 KMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNRE-HIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYI-RDDTIFIKAIVD 571          

HSP 3 Score: 33.8834 bits (76), Expect = 2.445e-7
Identity = 13/37 (35.14%), Postives = 21/37 (56.76%), Query Frame = 1
Query: 2104 GNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGY 2214
            G F+WKI +F K           ++FS +FY+ ++GY
Sbjct:  426 GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGY 462          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 72.7886 bits (177), Expect = 8.898e-13
Identity = 83/384 (21.61%), Postives = 159/384 (41.41%), Query Frame = 1
Query: 1261 FEFTNAPDR-CKCKLCFKVLRNAKQ-TECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVC--PLDLCQFRSKLQSIGVHMNSCEYRVIDC-RKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLN--PDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPF------------NQINCN----------TIDKLSKENLVSHFNKNEIYHNTLLV---------SKIPYIQSSIHDLKEDLENNKNIITELFSISKSIQELI-----MKKFSINAEKCLQNEFRSGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGY----------NCKCKFIHLGIWI 2253
            ++F   P R  +C LC K +R   Q + CG R C  C+QE+L+ G  KCP  ++ + L+  K++ D    ++I  L + C    + C++  +++ +  H ++C + VI C  +C  K+T     +H  + C  R V CE+C       E    H    P     C++            Q       + EC  + + C +            +Q +C               +++E+L +H    E   + L++          + P +    H L+E  +++  ++  L  + +  QE++     M++ S++ +         G  IWK+ ++ + + + K+      FS  FY+  +GY          N   +  HL I+I
Sbjct:    6 YKFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCP--EDQLPLDYAKIYPDPELEQQILALPIRCIHSEEGCRWTGQMKQLQSHFSTCAFNVIPCPNRCSVKLTRRDLPEHLQHDCPKRKVKCEFCGSEF-TGEAYENHQGICPQESVYCENKCGARMMRRLLSQHT-----MTECPKRTQPCKYCGKEFVYDTIQNHQYHCPRFPVQCPNQCGTPNIAREDLANHV--KESCGSALVLCPFKEAGCKHRCPKMAIGRH-LEESTKSHLTMMCSL--VGRQRQEILELRREMEELSVSHD---------GVLIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYI 367          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: egf (epidermal growth factor [Source:Xenbase;Acc:XB-GENE-951823])

HSP 1 Score: 88.9669 bits (219), Expect = 1.557e-17
Identity = 88/374 (23.53%), Postives = 150/374 (40.11%), Query Frame = 1
Query: 1291 KCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCD-DYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKIPYIQSSI-----------------------------------HDLKEDLENNKNIITE----LFSISKSIQELIMK-----------KFSI----NAEKCLQNEFRSGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGYNCKCKFIHLGI 2247
            +C +C   LR A QT CG R C  CI + +     KCP  DN  L+ EN+LF D    REI  L V CP   C    +L+ +  H+  C++  ++C +C+        Q H    C  R + CE C  ++ L + +      ++++ C   YV+      N  ++     + ++C      C + +  C   +K+ + +L  H  +    H  ++   +    SS+                                   +D  ++  N +  I +    L      I+ELI K           K +I    N    ++++  SG FIW+I NF+ L+   +      I S+ FY+ + GY   C  +HL +
Sbjct:   71 ECPICLMALREAVQTPCGHRFCKACILKSIRDAGHKCP-VDNESLM-ENQLFPDNFAKREILSLRVKCPSQGCTETMELRHLERHLVRCDFAGVECSQCQSSFPKYSLQKHKFEECPRRQIFCENCALAMALEDKL------NHDQTCPLAYVTCEYCQTNLIREQMPAHYSMDCTMAPIPCMYYEFGCT--EKMQRNDLARHLQEFTQAHMRMMAQTLRSFSSSVTPTSHMPDISFCDPSQFEPAPPSVATVHSSHTPSQNDCTQETRNLRETIEQLEGRLVRQDHQIRELIAKMETQCTYVNELKHTIRSLDNRLGEMESQQCSGIFIWRINNFNSLLKNQEEERPVVIHSQGFYTGKPGYKL-CLRLHLQL 433          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: sytl2 (synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-945155])

HSP 1 Score: 87.8113 bits (216), Expect = 1.863e-17
Identity = 85/375 (22.67%), Postives = 161/375 (42.93%), Query Frame = 1
Query: 1294 CKLCFKVLRNAKQ-TECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVC--PLDLCQFRSKLQSIGVHMNSCEYRVIDC-RKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLN--PDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPF------------NQINCN----------TIDKLSKENLVSHFNKNE-------IYHNTLLVSKIPYIQSSIHDLKEDLENNKNIITELFSISKSIQELI-----MKKFSINAEKCLQNEFRSGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGYNCKCKFIHLGIWIVEAVICLFPLKLLTG 2298
            C LC K +R   Q + CG R C  C+QE+L+ G  KCP  ++ + L+  K++ D+    ++  L + C    + C++  +L+ +  H+N C + VI C  +C  K+      +H  + C  R V CE+C       E    H    P     C++            Q       L+EC  + + CP+            +Q  C            I  +++E+L +H   +         + ++    + P I  S H L+E++  + ++++ L  +S+  QE++     +++ S+++E         G  IWKI ++ + + + K+   F  FS  FY+ ++GY  +      G    E       +++L G
Sbjct:   18 CPLCGKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCP--EDQLPLDYAKIYPDRDLETQVMGLSIRCIHSEEGCRWSGQLKQLQPHLNICAFNVIPCPNRCSTKLIRRDLPEHMQHDCPKRKVRCEFCGADF-TGEAYEDHQGCCPQESVYCENKCGARMMRRVLSQHS-----LVECPKRTQPCPYCNKEFVFDTIQSHQYQCPRYPTPCPNQCGIASIAREDLSNHLKDSCSSALVLCPFKDSGCKHRGPKITISRH-LEENMRAHLSMMSSL--VSRQRQEILELRKQVEELSVSSE---------GVLIWKISDYSRKVQEAKVRGNFESFSPPFYTHKYGYKLQVSAFLNGNGSGEGSYLSVYIRVLPG 372          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 74.7146 bits (182), Expect = 3.734e-13
Identity = 67/246 (27.24%), Postives = 119/246 (48.37%), Query Frame = 1
Query: 1291 KCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDL--CQFRSKLQSIGVHMNS-CEYRVIDCRK--CKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDYVSX--XXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKIPYIQSSIHDLK-EDLENNKNI 2004
            KC+ C  VL N +QTECG R C  C+   L++ S +C +C++ +   ++K+F D    RE+  L++ C  +   C+    L ++ +H+ S C++  + C +  CK+K+      DH    C+ R   C++C+  + L EM   H + D    C   V       +     +  +  HLLEC+N    C F +  C    K + + + +H   + + H  L+     Y+++ +  L+ E  E NK+I
Sbjct:   47 KCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQCMACEDNI--TKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFEELSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQK-HEDVD----CPSVVISCPHMCSVKSLLRSELNAHLLECVNAPSTCSFKRYGCTF--KGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKSI 283          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 63.5438 bits (153), Expect = 1.091e-9
Identity = 43/143 (30.07%), Postives = 78/143 (54.55%), Query Frame = 1
Query: 1282 DRCKCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDL--CQFRSKLQSIGVHMNS-CEYRVIDCRK--CKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEM 1695
            ++ KC+ C  VL N +QTECG R C  C+   L++ S +C +C++ +   ++K+F D    RE+  L++ C  +   C+    L ++ +H+ S C++  + C +  CK+K+      DH    C+ R   C++C+  + L EM
Sbjct:   44 EKYKCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQCMACEDNI--TKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFEELSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEM 184          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 41.5874 bits (96), Expect = 6.201e-9
Identity = 79/343 (23.03%), Postives = 127/343 (37.03%), Query Frame = 1
Query: 1294 CKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTI---DK-LSKEN--LVSHFNKNEIYHNT------------------LLVSKIPYIQSSIHDLKEDLENNKNIITELF----SISKSIQELIMKKFSINAE---KCLQNEFRS--GNFIWKIENFDKL---IIKGKMCERFSIFSKSFYSDEFGY 2214
            C  C  +LR   Q +CG R C  C+ + +            +V  N             + +   VC  +   +   L S+G H   C Y +  C  CK  I A +   H+   C  R + C YC+ S    + I  H     +E+C  +   C     +K      R L  C+     C +  + C  +   DK L  EN  L  H  K                          L  K    ++ +  L  ++E + +   EL     +    ++  + +K  I AE   +  ++E  +  G FIWKI  F K     I G+ C   ++FS  FY++++GY
Sbjct:   37 CSDCKNLLRRPLQAQCGHRYCSHCLNKII-----------RWVARNWGG----------VPECPAVC--ERSDWTGALISVG-HEGKCPYLLAPCPACKTIIRAANRDLHSERECPERKLNCRYCKLSFYFPD-IKAH-----DEICPKFPMTCEGCGRKKIPREKVR-LFVCM----PCRYAAVGCTEMVENDKCLEHENKSLAEHLAKGSPAPPANAPPNNSAKVAEMLLKFDTLDKKNTTFENIVSVLNREVERSSHAAEELARQLRAADTRLERTLGQKELIVAELETRMQESELSTYDGVFIWKISEFGKKRQDAINGR-CP--AMFSPPFYTNKYGY 341          

HSP 2 Score: 40.4318 bits (93), Expect = 6.201e-9
Identity = 27/110 (24.55%), Postives = 51/110 (46.36%), Query Frame = 3
Query: 2214 QLQMQIYPFGYLDCRGSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSRCQTIAPEIDSPHENQFVGIQNFLSFTELHSFIFK---------DKSIYLKLIVN 2516
            ++ ++IY  G    R +HLS+ F ++ G+ D +L WPF   + + +  +  RE        P++ S    + +   N  S   L   + K         D +I++K+IV+
Sbjct:  342 KMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQNNRE-HVIDAFRPDVSSSSFQRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIVD 450          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf6 (TNF receptor-associated factor 6 [Source:MGI Symbol;Acc:MGI:108072])

HSP 1 Score: 93.9745 bits (232), Expect = 4.912e-21
Identity = 96/360 (26.67%), Postives = 150/360 (41.67%), Query Frame = 1
Query: 1291 KCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLN--PDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKI-----------------------PYIQSSIHDLKEDLENNKNIITELFS-----------ISKSIQELIMKKFSINAEKCLQNEFRSGNFIWKIENFDKLIIKGKMCER-FSIFSKSFYSDEFGYNCKCKFIHLGIWIVE 2259
            +C +C   LR A QT CG R C  CI + +     KCP  DN +LL EN+LF D    REI  L V CP   C  + +L+ +  H   CE+ +++C +C++         H I  C  R V+C  C  S+   E   IH    P    +C +Y           ++     + L+C      C F+   C+  +K+ + +L  H  +N   H  LL   +                       P  + +I  L+  L    + I EL +           + ++I+ L  K   + A++C      +G +IWKI NF  + +K +  ER   I S  FY+   GY   C  +HL +   +
Sbjct:   69 ECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCP-VDNEILL-ENQLFPDNFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCPQCQRPFQKCQVNTHIIEDCPRRQVSCVNCAVSMAYEEK-EIHDQSCPLANIIC-EYCG-----TILIREQMPNHYDLDCPTAPIPCTFSVFGCH--EKMQRNHLARHLQENTQLHMRLLAQAVHNVNLALRPCDAASPSRGCRPEDPNYEETIKQLESRLVRQDHQIRELTAKMETQSMYVGELKRTIRTLEDKVAEMEAQQC------NGIYIWKIGNFG-MHLKSQEEERPVVIHSPGFYTGRPGYKL-CMRLHLQLPTAQ 409          

HSP 2 Score: 28.4906 bits (62), Expect = 4.912e-21
Identity = 10/32 (31.25%), Postives = 19/32 (59.38%), Query Frame = 3
Query: 2259 GSHLSVSFEIINGDYDQILSWPFKHNIQIGIF 2354
             +++S+    + G+YD  L WPF+  I++ I 
Sbjct:  412 ANYISLFVHTMQGEYDSHLPWPFQGTIRLTIL 443          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 80.8777 bits (198), Expect = 9.255e-21
Identity = 79/363 (21.76%), Postives = 147/363 (40.50%), Query Frame = 1
Query: 1294 CKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSC-------DNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSI-GVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDY-VSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKIPYIQSSIHDLKE---DLENNKNIITELFSISKSIQELI---MKKFSINAEKC-------------LQNEFR----------------------------SGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGY 2214
            C  C  +LR   Q +CG R C  C+   L++G + C +C       +   +L  +  F D A  RE+  L  VCP D C ++  L+     H   C + + +C  CK  +    ++ H    C  R ++C++C R+   +  + +H      E+C  + ++       +  +   + H+  C   +  C F+ + C+ +  +  ENL  H  +    H  LL+S     Q+S   L +   +L     I+ +  +  ++I  ++   +++ ++ AE C             L N+ +                             G FIWKI +F +   +       +IFS +FY+  +GY
Sbjct:   34 CSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHC-RAPCSHVDLEVHY-----EVCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEM--VETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGY 388          

HSP 2 Score: 40.4318 bits (93), Expect = 9.255e-21
Identity = 28/110 (25.45%), Postives = 49/110 (44.55%), Query Frame = 3
Query: 2214 QLQMQIYPFGYLDCRGSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSRCQTIAPEIDSPHENQFVGIQNFLSFTELHSFIFK---------DKSIYLKLIVN 2516
            ++ +++Y  G    RG+HLS+ F ++ G  D +L WPF   + + +     RE        P++ S    + V   N  S   L   + K         D +I++K IV+
Sbjct:  389 KMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNRE-HVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 497          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 73.9442 bits (180), Expect = 1.134e-18
Identity = 79/370 (21.35%), Postives = 147/370 (39.73%), Query Frame = 1
Query: 1294 CKLCFKVLRNAKQTECGCRVCGQCIQEYL-------AAGSRKCPSC-------DNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSI-GVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDY-VSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKIPYIQSSIHDLKE---DLENNKNIITELFSISKSIQELI---MKKFSINAEKC-------------LQNEFR----------------------------SGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGY 2214
            C  C  +LR   Q +CG R C  C+   L       ++G + C +C       +   +L  +  F D A  RE+  L  VCP D C ++  L+     H   C + + +C  CK  +    ++ H    C  R ++C++C R+   +  + +H      E+C  + ++       +  +   + H+  C   +  C F+ + C+ +  +  ENL  H  +    H  LL+S     Q+S   L +   +L     I+ +  +  ++I  ++   +++ ++ AE C             L N+ +                             G FIWKI +F +   +       +IFS +FY+  +GY
Sbjct:   34 CSACKNILRRPFQAQCGHRYCSFCLTSILRCASILSSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHC-RAPCSHVDLEVHY-----EVCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEM--VETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGY 395          

HSP 2 Score: 40.4318 bits (93), Expect = 1.134e-18
Identity = 28/110 (25.45%), Postives = 49/110 (44.55%), Query Frame = 3
Query: 2214 QLQMQIYPFGYLDCRGSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSRCQTIAPEIDSPHENQFVGIQNFLSFTELHSFIFK---------DKSIYLKLIVN 2516
            ++ +++Y  G    RG+HLS+ F ++ G  D +L WPF   + + +     RE        P++ S    + V   N  S   L   + K         D +I++K IV+
Sbjct:  396 KMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNRE-HVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 504          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 81.2629 bits (199), Expect = 3.081e-15
Identity = 69/247 (27.94%), Postives = 118/247 (47.77%), Query Frame = 1
Query: 1282 DRCKCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLD--LCQFRSKLQSIGVHM-NSCEYRVIDCRK--CKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKIPYIQSSIHDLK-EDLENNKNI 2004
            D+ KC+ C  VL N KQTECG R C  C+   L++ S KC +C   ++  ++K+F D    REI  L+V C  +   C  +  L  + VH+ N C++  + C +  CK+K+     +DH    C+ R  TC +C+  +    MI +  + D +  C         +     +  +  HL EC+N    C F +  C  + + + + + +H   + + H  LL      ++  +  L+ E +E NK+I
Sbjct:   48 DKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQESII--KDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVP---MIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGC--VFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSI 287          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf4 (TNF receptor associated factor 4 [Source:MGI Symbol;Acc:MGI:1202880])

HSP 1 Score: 71.633 bits (174), Expect = 2.205e-12
Identity = 85/378 (22.49%), Postives = 156/378 (41.27%), Query Frame = 1
Query: 1261 FEFTNAPDR-CKCKLCFKVLRNAKQ-TECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVC--PLDLCQFRSKLQSIGVHMNSCEYRVIDC-RKCKQKITAIHEQDHNINLCEMRIVTCEYC-----------------QRSIKLN-----EMIPIHLNPDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKN-------EIYHNTLLVSKIPYIQSSIHDLKEDLENNKNIITELFSISKS-IQELI--MKKFSINAEKCLQNEFRSGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGY----------NCKCKFIHLGIWI 2253
            ++F   P R   C LC K +R   Q + CG R C  C+QE+L+ G  KCP  ++ + L+  K++ D     ++  L + C    + C++   L+ +  H+N+C + V+ C  +C  K++      H  + C  R + CE+C                 Q S+         M+   L       C      C     +     I+ H  +C      CP NQ    T+   ++E+L +H   +         +  +    + P +    H ++E ++ +  ++  L S  +  +QEL   +++ SI ++         G  IWKI ++ + + + K       FS +FY+ ++GY          N   +  HL I+I
Sbjct:    6 YKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCP--EDQLPLDYAKIYPDPELEVQVLGLAIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVVPCPNRCPAKLSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGVCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCAYCTKEFVYDTIQSHQYQCPRLPVPCP-NQCGVGTV---AREDLPTHLKDSCSTAFVLCPFKESGCKHRCPKLAMGRH-VEESVKPHLAMMCALVSRQRQELQELRRELEELSIGSD---------GVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSIYI 367          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q9Y4K3|TRAF6_HUMAN (TNF receptor-associated factor 6 OS=Homo sapiens OX=9606 GN=TRAF6 PE=1 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 1.248e-23
Identity = 95/351 (27.07%), Postives = 154/351 (43.87%), Query Frame = 1
Query: 1291 KCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLN--PDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLL---------------VSKIPYIQSSIHDLKEDLENNKNIITELFS-----------ISKSIQELIMKKFSINAEKCLQNEFRSGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGYNCKCKFIHLGIWIVE 2259
            +C +C   LR A QT CG R C  CI + +     KCP  DN +LL EN+LF D    REI  L V CP + C  + +L+ +  H   CE+ ++DC +C++     H   H +  C  R V+C+ C  S+   +   IH    P    +C+        N    ++     + L+C      C F+   C+  +K+ + +L  H  +N   H  +L               +S++   Q +IH L+  L    + I EL +           + ++I+ L  K   I A++C      +G +IWKI NF   +   +  +   I S  FY+ + GY   C  +HL +   +
Sbjct:   69 ECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCP-VDNEILL-ENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDK-EIHDQNCPLANVICE------YCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCH--EKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQC------NGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKL-CMRLHLQLPTAQ 401          

HSP 2 Score: 28.4906 bits (62), Expect = 1.248e-23
Identity = 10/32 (31.25%), Postives = 19/32 (59.38%), Query Frame = 3
Query: 2259 GSHLSVSFEIINGDYDQILSWPFKHNIQIGIF 2354
             +++S+    + G+YD  L WPF+  I++ I 
Sbjct:  404 ANYISLFVHTMQGEYDSHLPWPFQGTIRLTIL 435          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|B6CJY5|TRAF6_MACMU (TNF receptor-associated factor 6 OS=Macaca mulatta OX=9544 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 2.044e-23
Identity = 95/351 (27.07%), Postives = 153/351 (43.59%), Query Frame = 1
Query: 1291 KCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLN--PDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLL---------------VSKIPYIQSSIHDLKEDLENNKNIITELFS-----------ISKSIQELIMKKFSINAEKCLQNEFRSGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGYNCKCKFIHLGIWIVE 2259
            +C +C   LR A QT CG R C  CI + +     KCP  DN +LL EN+LF D    REI  L V CP + C  + +L+ +  H   CE+ ++DC +C++     H   H +  C  R V+C+ C   +   +   IH    P    +C+        N    ++     + L+C      C F+   C+  +K+ + +L  H  +N   H  +L               VS++   Q +IH L+  L    + I EL +           + ++I+ L  K   I A++C      +G +IWKI NF   +   +  +   I S  FY+ + GY   C  +HL +   +
Sbjct:   69 ECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCP-VDNEILL-ENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALVDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAALVAFEDK-EIHDQNCPLANVICE------YCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCH--EKMQRNHLARHLQENTQSHMRMLAQAVHSLSLIPDSGYVSEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSTYVSELKRTIRTLEDKVAEIEAQQC------NGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKL-CMRLHLQLPTAQ 401          

HSP 2 Score: 28.4906 bits (62), Expect = 2.044e-23
Identity = 10/32 (31.25%), Postives = 19/32 (59.38%), Query Frame = 3
Query: 2259 GSHLSVSFEIINGDYDQILSWPFKHNIQIGIF 2354
             +++S+    + G+YD  L WPF+  I++ I 
Sbjct:  404 ANYISLFVHTMQGEYDSHLPWPFQGTIRLTIL 435          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|B6CJY4|TRAF6_CERAT (TNF receptor-associated factor 6 OS=Cercocebus atys OX=9531 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 2.112e-23
Identity = 95/351 (27.07%), Postives = 153/351 (43.59%), Query Frame = 1
Query: 1291 KCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLN--PDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLL---------------VSKIPYIQSSIHDLKEDLENNKNIITELFS-----------ISKSIQELIMKKFSINAEKCLQNEFRSGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGYNCKCKFIHLGIWIVE 2259
            +C +C   LR A QT CG R C  CI + +     KCP  DN +LL EN+LF D    REI  L V CP + C  + +L+ +  H   CE+ ++DC +C++     H   H +  C  R V+C+ C   +   +   IH    P    +C+        N    ++     + L+C      C F+   C+  +K+ + +L  H  +N   H  +L               VS++   Q +IH L+  L    + I EL +           + ++I+ L  K   I A++C      +G +IWKI NF   +   +  +   I S  FY+ + GY   C  +HL +   +
Sbjct:   69 ECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCP-VDNEILL-ENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALVDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAALVAFEDK-EIHDQNCPLANVICE------YCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCH--EKMQRNHLARHLQENTQSHMRMLAQAVHSLSLIPDSGYVSEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSTYVSELKRTIRTLEDKVAEIEAQQC------NGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKL-CMRLHLQLPTAQ 401          

HSP 2 Score: 28.4906 bits (62), Expect = 2.112e-23
Identity = 10/32 (31.25%), Postives = 19/32 (59.38%), Query Frame = 3
Query: 2259 GSHLSVSFEIINGDYDQILSWPFKHNIQIGIF 2354
             +++S+    + G+YD  L WPF+  I++ I 
Sbjct:  404 ANYISLFVHTMQGEYDSHLPWPFQGTIRLTIL 435          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P70196|TRAF6_MOUSE (TNF receptor-associated factor 6 OS=Mus musculus OX=10090 GN=Traf6 PE=1 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 2.997e-20
Identity = 96/360 (26.67%), Postives = 150/360 (41.67%), Query Frame = 1
Query: 1291 KCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLN--PDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKI-----------------------PYIQSSIHDLKEDLENNKNIITELFS-----------ISKSIQELIMKKFSINAEKCLQNEFRSGNFIWKIENFDKLIIKGKMCER-FSIFSKSFYSDEFGYNCKCKFIHLGIWIVE 2259
            +C +C   LR A QT CG R C  CI + +     KCP  DN +LL EN+LF D    REI  L V CP   C  + +L+ +  H   CE+ +++C +C++         H I  C  R V+C  C  S+   E   IH    P    +C +Y           ++     + L+C      C F+   C+  +K+ + +L  H  +N   H  LL   +                       P  + +I  L+  L    + I EL +           + ++I+ L  K   + A++C      +G +IWKI NF  + +K +  ER   I S  FY+   GY   C  +HL +   +
Sbjct:   69 ECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCP-VDNEILL-ENQLFPDNFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCPQCQRPFQKCQVNTHIIEDCPRRQVSCVNCAVSMAYEEK-EIHDQSCPLANIIC-EYCG-----TILIREQMPNHYDLDCPTAPIPCTFSVFGCH--EKMQRNHLARHLQENTQLHMRLLAQAVHNVNLALRPCDAASPSRGCRPEDPNYEETIKQLESRLVRQDHQIRELTAKMETQSMYVGELKRTIRTLEDKVAEMEAQQC------NGIYIWKIGNFG-MHLKSQEEERPVVIHSPGFYTGRPGYKL-CMRLHLQLPTAQ 409          

HSP 2 Score: 28.4906 bits (62), Expect = 2.997e-20
Identity = 10/32 (31.25%), Postives = 19/32 (59.38%), Query Frame = 3
Query: 2259 GSHLSVSFEIINGDYDQILSWPFKHNIQIGIF 2354
             +++S+    + G+YD  L WPF+  I++ I 
Sbjct:  412 ANYISLFVHTMQGEYDSHLPWPFQGTIRLTIL 443          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P39429|TRAF2_MOUSE (TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 5.647e-20
Identity = 79/363 (21.76%), Postives = 147/363 (40.50%), Query Frame = 1
Query: 1294 CKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSC-------DNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSI-GVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDY-VSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKIPYIQSSIHDLKE---DLENNKNIITELFSISKSIQELI---MKKFSINAEKC-------------LQNEFR----------------------------SGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGY 2214
            C  C  +LR   Q +CG R C  C+   L++G + C +C       +   +L  +  F D A  RE+  L  VCP D C ++  L+     H   C + + +C  CK  +    ++ H    C  R ++C++C R+   +  + +H      E+C  + ++       +  +   + H+  C   +  C F+ + C+ +  +  ENL  H  +    H  LL+S     Q+S   L +   +L     I+ +  +  ++I  ++   +++ ++ AE C             L N+ +                             G FIWKI +F +   +       +IFS +FY+  +GY
Sbjct:   34 CSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHC-RAPCSHVDLEVHY-----EVCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEM--VETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGY 388          

HSP 2 Score: 40.4318 bits (93), Expect = 5.647e-20
Identity = 28/110 (25.45%), Postives = 49/110 (44.55%), Query Frame = 3
Query: 2214 QLQMQIYPFGYLDCRGSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSRCQTIAPEIDSPHENQFVGIQNFLSFTELHSFIFK---------DKSIYLKLIVN 2516
            ++ +++Y  G    RG+HLS+ F ++ G  D +L WPF   + + +     RE        P++ S    + V   N  S   L   + K         D +I++K IV+
Sbjct:  389 KMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNRE-HVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 497          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: D5JG59 (TNF receptor-associated factor-2-like protein A OS=Dugesia japonica OX=6161 GN=TRAF-2A PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 5.368e-41
Identity = 93/238 (39.08%), Postives = 143/238 (60.08%), Query Frame = 1
Query: 1543 HMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKIPYIQSSIHDLKEDLENNKNIITELFS-----------ISKSIQELIMKKFSINAEKCLQNE---FRSGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGY 2214
            H+ SC+ R I C KC  K  A  + +H+ + CEMR+V C+YC  ++K  ++  IHLNPD +E+C  YV IC NNCN+ +++N+K HL  C NKK +CPF+Q +C  IDK++KE L+ H ++    H + L++K+  ++S I DL+ +L N   I  ELF            I K+I+EL  KK    + + + N+   FR+ +FIWK  +F+   +  +   R S+ S +FY+ EFGY
Sbjct:    4 HIESCDLREITCEKCGIKFGAKEKANHDKDKCEMRMVNCDYCGITMKSKDLNIIHLNPDRDELCSKYVGICSNNCNETRKVNLKDHLKICPNKKLECPFHQFDCK-IDKMTKEKLMKHLDEEYFNHTSSLINKVKDLESKIIDLESELHNQILITKELFEMNKKSSESRLKIEKTIEEL-KKKAPATSIQTIDNKNVIFRNASFIWKFTDFEVRRVDAESGGRVSVTSDAFYTSEFGY 239          

HSP 2 Score: 57.3806 bits (137), Expect = 5.368e-41
Identity = 35/110 (31.82%), Postives = 58/110 (52.73%), Query Frame = 3
Query: 2214 QLQMQIYPFGYLDCRGSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSRCQTIAPEIDS-----PHE--NQFVGIQNF--LSFTELHSFIFKDKSIYLKLIVN 2516
            ++ +++YP G    +G+HLSV F I+ G++D +LSWPFK  + + I  +E+       T  P+  S     P +  N   G   F  LS    +S   K+ +I+LK+ V+
Sbjct:  240 KMCLRVYPAGDGVGKGTHLSVFFAIMKGEFDDLLSWPFKQKVTLSILDQESGSKPHSDTFKPDARSACYQKPTDECNIASGFPKFILLSLIMNNSIYCKNDTIFLKIAVD 349          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: D5JG60 (TNF receptor-associated factor-2-like protein B OS=Dugesia japonica OX=6161 GN=TRAF-2B PE=2 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 3.197e-40
Identity = 113/353 (32.01%), Postives = 184/353 (52.12%), Query Frame = 1
Query: 1237 IMNYDMRLFEFTNAPDRCKCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKIPYIQSSIHDLK-EDLENN------KNIITELFSISKSIQELIMKKFSINAEKCLQNE---FRSGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGYNCKCKFIHLGIWIVEAV 2265
            I  Y  + F F N  D  KC +C ++L  A QT+CGCR C +C++EY A G  KC +     L N   +  D A  REI +L V C    C+    L+ IG H++SC ++ I+C+ C +++T I  ++H    C MR+V+C +C   ++ + +  +HLN   E++C   V  CP  C+  +++N+  H   C  K   C F++I CN +  ++KE+L+ H N+  + H+ LL+ +I  +++ I +LK + LE N          +E+    KS++++        +      E   +R+G FIWKIE F +L  + +   R SI S  FY+ EFGY    K    G  + +  
Sbjct:   12 IKRYRKKHFPF-NISDNLKCIICSQLLLEALQTDCGCRYCKECLKEYQAKGKTKCLTDGCGDLGN---IIPDNAVNREIGKLTVKCLFPGCEHSELLKDIGDHLDSCIHQTINCKSCNEELTKIELKEHTEKKCPMRLVSCTHCGEEMEYSNLTELHLNVHTEKLCAKLVGKCPYKCDNGKEVNLLDHRKSCSKKPVTCLFSEIGCNRV--MTKEDLIKHNNEESLQHSRLLMKEIITMKNDISELKMKTLEFNILKIEFSKFQSEILDKIKSLEKIPRHTSPSTSSVRSSEEKTVYRNGVFIWKIERFSELKSEAERGNRISITSDYFYTKEFGYKMSMKIYPAGDGVGKGT 358          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1DBK6 (TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 3.468e-29
Identity = 114/421 (27.08%), Postives = 199/421 (47.27%), Query Frame = 1
Query: 1282 DRCKCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPS----CDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKIPYIQSSIHDLKEDLENNKNIITELFSISKSIQELI-----MKKFSINAEKCLQNE----FRSGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGYNCKCKFIHLGIWIVEAVICLFPLKLLTG---IMTKYCHGHLNIIYRLEFFTEKRVNCPAVKQLHPKSI----PRTRINLWESKIFYLSLNCIRLFLK 2484
            D  KC +C  +L +A QT+CGCR C +CI  YL  G ++C +    C + +         D+AT +EI+ L+V C  + C F   L+SI  H++ CEYR   C  C  +     E +H  N C +R V C+YC+  +   E    HL  ++ ++C  Y +ICP  C  + ++N+  H   C NK  +CP +  +C  +  + K+ +  H N +   H   +V+++  ++     ++E +    NI+ E   + K+  E++         SI+ +  L+      FR+G ++WKI++F KL       +  +I S++FY+ +FGY    K    G  + +         ++ G    +  +   +  II   + F+ K  N     +  PKSI    P    N+      ++S + ++ FLK
Sbjct:   27 DNLKCVMCQDILLDAIQTDCGCRYCKECIDNYLENGEKECVAEYEDCRSVI----TSYIYDRATNKEISLLKVKCLYEGCVFEDTLKSIKGHLDFCEYRNEMCSLCGMEYIIKEESNHLANECLLREVLCQYCRTLLTFKEYNESHLCFESRDLCGKYEAICPYGCTGESKVNLLHHRKSCENKPLECPLHVFDCKQL--IPKDQMTEHLNTSSYEHTLTIVTELRKLEKQNKHMEERM----NILIEENQLLKATLEVMKLDLPKNSGSISRDTSLKRANKTIFRNGKYMWKIKSFSKLRENAMRGKNPTILSEAFYTSDFGYKMCMKIYPCGDGVGKGTHLSIFFVIMKGDYDDILPWPFKNKVIITIFDDFS-KSTNLSDTFKPDPKSICYQRPEEEYNIASGSPKFISFSELKNFLK 436          

HSP 2 Score: 68.1662 bits (165), Expect = 5.161e-8
Identity = 41/107 (38.32%), Postives = 63/107 (58.88%), Query Frame = 3
Query: 2214 QLQMQIYPFGYLDCRGSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSRCQTIAPEIDS-----PHE--NQFVGIQNFLSFTELHSFIFKDKSIYLKLIV 2513
            ++ M+IYP G    +G+HLS+ F I+ GDYD IL WPFK+ + I IF   ++  +   T  P+  S     P E  N   G   F+SF+EL +F+ KD ++Y+++ V
Sbjct:  341 KMCMKIYPCGDGVGKGTHLSIFFVIMKGDYDDILPWPFKNKVIITIFDDFSKSTNLSDTFKPDPKSICYQRPEEEYNIASGSPKFISFSELKNFLKKD-TLYIQINV 446          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1DF65 (TRAF-2 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 2.924e-28
Identity = 101/342 (29.53%), Postives = 155/342 (45.32%), Query Frame = 1
Query: 1261 FEFTNAPDRCKCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDN--EEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKIPYIQSSIHDLKEDL----ENNKNIITE----LFSISKSIQEL--IMKKFSINAEKCLQNEF------------RSGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGY 2214
            FE      R  C  C +VL    QT+CGCR+C  C++E        CP C+  +    N    DKA  +EI +L ++C    C++  K++ +  H+ +CEY    C  C +       + H    C+M I TCE C   +   ++   H N +   + +C  +  ICP  C++   +NIK HLL C  +  +C  N++ C  +  L +E +  HFN    YH  LL+  +  ++    DL   +    E N   I E    L S+   I++L   +K+F    EK L+NE             R G + WK+EN  + +   K      I S+SFYS   GY
Sbjct:   21 FECEQQKQRISCVKCHQVLIEPYQTQCGCRLCSNCLEECSKDEESHCPGCNETMNSPSNYSKHDKAIEKEILELNIICTNKGCEYTCKVKDLDNHLETCEYIEKRCTACNESYPRKELKKHEEFTCKMIITTCEDCGLELSKGDLEKKHKNVNELIDNVCSKWRDICPFKCSEDTLVNIKDHLLTCERRPVECSLNEMGCRKV--LPREEMREHFNLEANYHTVLLMDALFLLRKEHQDLSVSVSVQNERNSAEIKELKEKLSSLLTEIEDLKTKLKQFQSMYEK-LENERNLAKCSLSETKERYGEYTWKVENIMEKVNDAKKGVNTQILSESFYSSNPGY 359          

HSP 2 Score: 41.9726 bits (97), Expect = 2.924e-28
Identity = 33/109 (30.28%), Postives = 51/109 (46.79%), Query Frame = 3
Query: 2214 QLQMQIYPFGYLDCRGSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSRCQTIAPEIDS-----PHE--NQFVGIQNFLSFTEL--HSFIFKDKSIYLKLIV 2513
            ++ ++IYP G     G++LSV F ++ G YD  + WPF   I I + +   R   R   + P I+      P E  N   G   F+S  +L       KD +I L++ V
Sbjct:  360 RMCLKIYPNGDGSAFGNYLSVYFVLMKGKYDDQIQWPFNSIISIRLVNIARRGEDRVLNMRPNINDQCYGRPKEEHNLAAGQPKFVSHLQLVNEDDFIKDGAIILRVNV 468          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T2M357 (TNF receptor-associated factor 6 (Fragment) OS=Hydra vulgaris OX=6087 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 2.120e-23
Identity = 105/368 (28.53%), Postives = 155/368 (42.12%), Query Frame = 1
Query: 1276 APDRCKCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVC---PLDLCQFRSKLQSIGVHMNSCEYRVIDCR-KCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDY----------VSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKEN---------------------LVSHFNKNEIYHNTLLVSK----IPY---IQSSIHDLKEDLENNKNIITELFSISKS-----IQELIMKKFSINAEKCLQNEF--------RSGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGY 2214
            APD  +C +C  VL    QTECG R C  CI + L  G   CP  DNY  +NE +++ D   +REI +L+V C       C++   L+S+  HM SCEY +  C   C +K+T      H +N C  R+++CEYC+  I   ++       D+ E C+ +          V I         ++   R +L+C  K   C F        + L  EN                     ++  F + EI  N    S      P+    ++SI    ++LE   N +     + +S       EL  +  SI+ E   QNE           GNFIW+I NFD+L  +    E  +I S  FY+   GY
Sbjct:   40 APDVYECPICLLVLNAPVQTECGHRFCRGCILKVLREGRPNCP-IDNYS-INEEQIYPDNFALREILELKVRCQNSKTHNCKWLGSLKSLKEHMMSCEYNLFPCSNNCGEKMTRNALDKHILNDCPKRVISCEYCKLKIVFKKL------QDHYERCEGFPVNCPNVCEVVVIPRGKLKIHMEVECSRAILKCSYKDTGCEFQGTRDEVANHLKTENHQTMLLQMLCDLKLKVANQEKVIESFKEKEITFNKEFQSSNGAGYPFSLKPEASIVGRFDELEKKINQVKATSEVCRSELKHTRSELESRIESISIEVKAQNEVINEVSARTWKGNFIWRISNFDQLFRQALSGEVPAIHSLPFYTGVPGY 399          

HSP 2 Score: 36.1946 bits (82), Expect = 2.120e-23
Identity = 14/47 (29.79%), Postives = 29/47 (61.70%), Query Frame = 3
Query: 2259 GSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSR-CQTIA 2396
            G+H+S+   ++ G++D ++ WPF  N+   I  ++TR+    C+T+ 
Sbjct:  415 GTHVSMFVHMMQGEFDSLIEWPFPGNVIFTILDQDTRDPQHVCETLT 461          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 63.1586 bits (152), Expect = 4.856e-16
Identity = 72/352 (20.45%), Postives = 130/352 (36.93%), Query Frame = 1
Query: 1282 DRCKCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSI-GVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLN--PDNEEMCDDYVSX-XXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLV----SKIPYIQSSIHDLKEDLENNKNIITEL---FSISKSIQELIMKKFSINAEK--CLQNEFR----------------------------SGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGY 2214
            D+  C +C K+LR   Q +CG R                          +    F D A  RE+  LE VC  + C +   ++     H   C++ +I C  CK+ + A   + HN   C  R + C+YC+         P H      ++E+C  Y  I       +  +     H+  C   +  C F+ + C+      + NL+      ++ + +  V    +K+  +     +L+  +   +NI+  L      S +  E   ++  ++ +K   L N+ R                             G F+WKI +F K           ++FS +FY+ ++GY
Sbjct:   30 DKHLCNICQKILRRPFQAQCGHR-------------------------FSPASAFPDNAAKREVEALEAVCINEGCSWTGTIKEYEATHEGQCDFMIIPCPSCKELLRANELERHNERECPERTLNCKYCKE--------PFHFKNIKAHDEICPKYPMICEGCAKKKIPREKYVDHIKLCTKFRTPCRFHVVGCDMSVSKPQWNLI--LTPRDLLYTSFTVPLSQTKVAELSRRCQELELKVGTFENIVCVLNREMERSATTMEAYNRQHRLDQDKIEILNNKVRQLERTVGLRDLSIVEMEGKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGY 346          

HSP 2 Score: 41.9726 bits (97), Expect = 4.856e-16
Identity = 31/111 (27.93%), Postives = 53/111 (47.75%), Query Frame = 3
Query: 2214 QLQMQIYPFGYLDCRGSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSRCQTIAPEIDSPHENQFVGIQNFLSFTEL----------HSFIFKDKSIYLKLIVN 2516
            ++ ++IY  G    RG+HLS+ F ++ G  D +L WPF   + + +  +  RE        P+I S    + V   N  S   L          +S+I +D +I++K IV+
Sbjct:  347 KMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNRE-HIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYI-RDDTIFIKAIVD 455          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 82.4185 bits (202), Expect = 9.514e-16
Identity = 72/282 (25.53%), Postives = 125/282 (44.33%), Query Frame = 1
Query: 1282 DRCKCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSC-------DNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSI-GVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLN--PDNEEMCDDYVSX-XXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKIPYIQSSIHDLK-EDLENNKNIITELFSISKSIQELIMKKFSINAEKCLQN 2091
            D+  C +C K+LR   Q +CG R C  C  + +++G +KC +C       +   +L +   F D A  RE+  LE VC  + C +   ++     H   C++ +I C  CK+ + A   + HN   C  R + C+YC+         P H      ++E+C  Y  I       +  +     H+  C   +  C F+ + C+    + KE +  H       H  LL+  I  I+ ++  L+ + LE   + I EL    +S++EL +K   ++A   +Q 
Sbjct:   30 DKHLCNICQKILRRPFQAQCGHRFCSYCFNKTVSSGPQKCSACIKEDIFEEPTSILKQGCAFPDNAAKREVEALEAVCINEGCSWTGTIKEYEATHEGQCDFMIIPCPSCKELLRANELERHNERECPERTLNCKYCKE--------PFHFKNIKAHDEICPKYPMICEGCAKKKIPREKYVDHIKLCTKFRTPCRFHVVGCDM--SVEKEKIHDHERACSYEHLNLLLHFIMGIKVNLESLQPQSLELASHKIQELH---QSLRELELKMGQLSAGAPVQG 298          

HSP 2 Score: 41.5874 bits (96), Expect = 2.324e-7
Identity = 31/111 (27.93%), Postives = 53/111 (47.75%), Query Frame = 3
Query: 2214 QLQMQIYPFGYLDCRGSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSRCQTIAPEIDSPHENQFVGIQNFLSFTEL----------HSFIFKDKSIYLKLIVN 2516
            ++ ++IY  G    RG+HLS+ F ++ G  D +L WPF   + + +  +  RE        P+I S    + V   N  S   L          +S+I +D +I++K IV+
Sbjct:  460 KMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNRE-HIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYI-RDDTIFIKAIVD 568          

HSP 3 Score: 33.8834 bits (76), Expect = 2.324e-7
Identity = 13/37 (35.14%), Postives = 21/37 (56.76%), Query Frame = 1
Query: 2104 GNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGY 2214
            G F+WKI +F K           ++FS +FY+ ++GY
Sbjct:  423 GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGY 459          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 78.9518 bits (193), Expect = 1.046e-14
Identity = 58/231 (25.11%), Postives = 100/231 (43.29%), Query Frame = 1
Query: 1291 KCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCD-------NYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGV-HMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDY-VSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKIPYIQ 1956
            +C+ C  VLR   Q +CG R C  C ++  ++G   C +C         + +L+  + F D A  REI+ L   CP D C +   L+   V H   CE+  + C  C+  I    +  HN   CE R + C+YC+ +    + I  H     +E+C  + +        +  +     H   C   K  C F++I C  +    K++   H   + I H  L+++ +  ++
Sbjct:   41 QCQQCKGVLRKPFQAQCGHRFCVFCFKQLTSSGPIPCEACRAEGIFEMEHSMLSITEAFPDNAARREIDGLPAKCPNDGCSWNGTLKEYEVQHEGRCEFERVKCEACQMMILLSDKDRHNERECEARTLNCKYCKVTFSFKD-IKAH-----DEICQKFPMQCKDCGKKKIPREKFAEHSKSCAKSKSACQFSEIGCRAVVDNGKQH--EHEQSSIIEHLRLMLAVLSTVR 263          

HSP 2 Score: 45.8246 bits (107), Expect = 1.901e-8
Identity = 30/110 (27.27%), Postives = 51/110 (46.36%), Query Frame = 3
Query: 2214 QLQMQIYPFGYLDCRGSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSRCQTIAPEIDSPHENQFVGIQNFLSFTEL---------HSFIFKDKSIYLKLIVN 2516
            ++ +++Y  G    RGSHLS+ F ++ G YD +L WPF   + + +  +  RE        P+I S    + +   N  S   L          S   +D +I++K IV+
Sbjct:  419 KMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQNNRE-HIIDAFRPDISSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVD 527          

HSP 3 Score: 33.8834 bits (76), Expect = 1.901e-8
Identity = 13/37 (35.14%), Postives = 21/37 (56.76%), Query Frame = 1
Query: 2104 GNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGY 2214
            G F+WKI +F +           ++FS +FYS ++GY
Sbjct:  382 GVFVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGY 418          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:103024022])

HSP 1 Score: 75.8702 bits (185), Expect = 8.501e-14
Identity = 83/389 (21.34%), Postives = 159/389 (40.87%), Query Frame = 1
Query: 1237 IMNYDMRLFEFTNAPDRCKCKLCFKVLRNAKQ-TECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVC--PLDLCQFRSKLQSIGVHMNSCEYRVIDC-RKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLN--PDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPF------------NQINCN----------TIDKLSKENLVSHFNKN-------EIYHNTLLVSKIPYIQSSIHDLKEDLENNKNIITELFSISKSIQELI-----MKKFSINAEKCLQNEFRSGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGY----------NCKCKFIHLGIWI 2253
            +  YD +  E      R +C LC K +R   Q + CG R C  C+QE+L+ G  KCP  ++ + L+  K++ D    ++I  L + C    + C++  +++ +  H ++C + VI C  +C  K+T     +H  + C  R V CE+C       E    H    P     C++            Q       + EC  + + C +            +Q +C               +++E+L +H  ++         + +     + P +    H L+E  +++  ++  L  + +  QE+I     M++ S++ +         G  IWK+ ++ + + + K+      FS  FY+  +GY          N   +  HL I+I
Sbjct:    1 MPGYDYKFLE--KPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCP--EDQLPLDYAKIYPDPELEQQILALPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCAVKLTRRDLPEHLQHDCPKRKVKCEFCGSEF-TGEAFENHQGICPQESVYCENKCGARMMRRLLAQHT-----MAECPKRTQPCKYCGKEFVYDTIQNHQYHCPRFPVQCPNQCGTPNIAREDLATHVKESCGSALVLCPFKDAGCKHRCPKLAIGRH-LEETTKSHLTMMCSL--VGRQRQEIIELRREMEELSVSHD---------GVLIWKLNDYSRKLQEAKLHNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYI 367          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 70.8626 bits (172), Expect = 3.906e-12
Identity = 43/130 (33.08%), Postives = 69/130 (53.08%), Query Frame = 1
Query: 1291 KCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSI 1680
            +C +C   LR+A QT CG R C  CI++ +    +KCP  DN VL  E++LF D    REI  L V C    C  + +L+ +  H+  C++  + C +C++ +     ++H    C  R++TC  C  +I
Sbjct:   69 ECPICLMGLRSAVQTPCGHRFCNCCIRKSIRDTGQKCP-VDNEVL-TEDQLFPDNFAKREILSLTVRCRNVGCMEKMELRHLENHIPHCKFATVPCPQCQESVWKSELEEHINQECSHRLITCPDCAENI 196          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 78.5666 bits (192), Expect = 3.693e-15
Identity = 64/221 (28.96%), Postives = 101/221 (45.70%), Query Frame = 1
Query: 1291 KCKLCFKVLRNAKQTECGCRVCGQCI--QEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDYVSXXXXXXXXXXXXXXXRHL-LECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKI 1944
            +C +C   LR   QT CG R C  CI     L     KCP  DN VL +E +LF D    REI  L V CP   C  R +L+++  H   CEY  + C +C+  +       H    C  RIVTC +C   +   +      + ++E+MC   V  C +   +  +  +  HL ++C   +  C F+ + C    ++ +  L +H +++   H  LL + +
Sbjct:   64 ECPICLMALREPVQTPCGHRFCRACILHSMRLRDAGPKCP-VDNAVL-HEGQLFPDNFAKREILSLTVRCPNKPCGHRGELRALQEHQLRCEYAQVPCVRCEMPVCRRDLAKHEEQECMRRIVTCLHCCEKMAYKD------SKNHEQMCPLVVVNCKHCQQELIREQLGPHLEVDCQQAQVPCTFSPLGCEA--QMVRSLLAAHMHEHTQVHMRLLANGL 274          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.6766 bits (117), Expect = 1.125e-10
Identity = 31/113 (27.43%), Postives = 52/113 (46.02%), Query Frame = 3
Query: 2235 PFGYLDC-----------RGSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSRCQTIAPEIDSPH-------ENQFVGIQNFLSFTELHSFIF-KDKSIYLKLIVN 2516
            PFGY  C           RG+HLS+ F ++ G+YD +L WPF+  + + +  +         T  P+  S          N   G   F+S   L S  + +D +I++K++V+
Sbjct:  358 PFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDTFKPDPASSSFRRPTSDMNIASGCPLFVSHVALESASYLQDDTIFIKVVVD 470          

HSP 2 Score: 35.039 bits (79), Expect = 1.125e-10
Identity = 17/69 (24.64%), Postives = 34/69 (49.28%), Query Frame = 1
Query: 2008 TELFSISKSIQELIMKKFSINAEKCLQNEFRSGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGY 2214
            T+LF+    + E+ ++ F +     L+    +G  +WKI ++ +           S++S+ FY+  FGY
Sbjct:  299 TQLFAHDTRLAEMDLR-FQV-----LETASYNGKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGY 361          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.8246 bits (107), Expect = 5.241e-10
Identity = 30/113 (26.55%), Postives = 52/113 (46.02%), Query Frame = 3
Query: 2235 PFGYLDC-----------RGSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSRCQTIAPEIDS-----PHENQFV--GIQNFLSFTELH-SFIFKDKSIYLKLIVN 2516
            PFGY  C           RG+HLS+ F ++ G+YD +L WPF+  + + +  +         T  P+  S     P  +  V  G   F+S   L  S    D +++++++V+
Sbjct:  301 PFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDTFTPDPASGSFRRPDGDMNVASGCPLFVSHVALEGSSYLVDDTVFVRVVVD 413          

HSP 2 Score: 36.1946 bits (82), Expect = 5.241e-10
Identity = 13/46 (28.26%), Postives = 24/46 (52.17%), Query Frame = 1
Query: 2077 KCLQNEFRSGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGY 2214
            + L+    SG  +WKI ++ +   +       S++S+ FY+  FGY
Sbjct:  259 QVLETAGYSGKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGY 304          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008091.1 (pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 gene:ENSPMAG00000007312.1 transcript:ENSPMAT00000008091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 9.266e-8
Identity = 38/143 (26.57%), Postives = 64/143 (44.76%), Query Frame = 1
Query: 1285 RCKCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSC---DNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGV-HMNSCEYRVIDCRKCKQKITAIHEQDHN--INLCEMRIVTCEYCQRSIKLNEM 1695
            R  C  C  +LR+A QT CG R C  CI   + +  R C       N+++ +  + F D A  RE+  L V C  + C++R +L    V H+  C++ ++ C      +     + H      C +R V C  C + +   ++
Sbjct:    2 RFACGSCQGLLRDAVQTHCGHRFCKPCIARLITSVHRSCNDTLMNSNFLVYSPTQFFPDAALRREMGVLPVRCVSEGCEWRGRLLEYDVAHVERCDWVLVPCLLAGCALLLPRAELHRHVAQECSVRPVPCAACAQLLPYRQL 144          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO31690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX76])

HSP 1 Score: 60.8474 bits (146), Expect = 1.986e-16
Identity = 80/336 (23.81%), Postives = 128/336 (38.10%), Query Frame = 1
Query: 1243 NYDMRLFEFTNAPDRCKCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSR-KCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDC--RKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKIPYIQSSIH-DLKEDLENNKNIIT---ELFSISKSIQELIMKKFSINAEKCLQNEFRSGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGYNCKCK 2229
             ++   FE   +P+   C +C  V+     T CG   C  C  ++        CP   +Y  L  N+   DK T R++  L V C    C ++ +L+    H+  C + VI C    C  ++     + H    CE +IVTCE+C         +P    P  EE                      +H  +C      C F+ I C    +  +   V+H       H  +    I      I  + K+   NNK I T   EL + +++I+EL  K   +            G F+W+I ++  L           I+S SFY+ ++GY  + K
Sbjct:   11 GFNPEQFETPPSPE-LMCGICLMVVNKPVLTYCGHSFCNFCFNKWRNGKDVVTCPV--DYKQLETNQFMADKKTERQVLSLCVKCMNGPCSWKGELRDKKKHLTKCGHEVIKCVFDGCDTRLARNSMEKHE-ETCEWKIVTCEFCD--------VPY---PKREE-------------------ETVKHRGDCPLAILPCKFSDIGCTFEGR--QHAHVAHCENAVQAHLDMACGTIRDNNKEIRKNNKKIRGNNKEIETLHKELNTANQTIRELKGKMAKL-----------IGTFVWRICDYKDLY--------GEIYSPSFYTSKYGYKVQLK 291          

HSP 2 Score: 43.8986 bits (102), Expect = 1.986e-16
Identity = 32/115 (27.83%), Postives = 52/115 (45.22%), Query Frame = 3
Query: 2205 IWLQLQMQIYPFGYLDCRGSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSRCQTIAPEIDSPHE-----------NQFVGIQNFLSFTELHSFIF-KDKSIYLKLIV 2513
            + L+  ++  PF      G+HLS+   I+ G+YD +L WPF+  I + +  +  +       I P+   P             N   G+  FLS  EL S  F KD  +++K +V
Sbjct:  288 VQLKANLRTNPFN----GGTHLSLYACIMVGEYDALLEWPFRRKITLYVIDQSDQRKHETLLINPDDVLPDRKKCFHRPITGNNVGYGLTRFLSLEELTSGGFIKDGVMFIKAVV 398          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48773 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI91])

HSP 1 Score: 65.4698 bits (158), Expect = 7.153e-15
Identity = 80/339 (23.60%), Postives = 132/339 (38.94%), Query Frame = 1
Query: 1264 EFTNAP--DRCKCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLD---LCQFRSKLQSIGVHMNSCEYRVIDC-RKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLN--PDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKIPYIQSSIHDLKEDLENNKNIITELF-------------SISKSIQELIMKKFSINAEKC-LQNEFRSGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGY 2214
            EF + P   + +C +C   LR+  QT CG R C  CI+  +     KCP  DN   L+E +L+ D    RE+    V C L     C ++  L+ +  H+  C     +C  +C   +       H    C  R V C++C+  + +++ I  HL   P  +  C +            Q+  + +H  E       CP   + C+     S +   SH  +    H   L  +    QS+    + D+  ++      F             S  + I EL  K   +   +  L+    +G FIWK++NF +           +I S  FY+  +GY
Sbjct:   46 EFFDPPLESKYECPICLLGLRDPVQTPCGHRFCFNCIRRSIRDAGPKCP-VDN-TPLSERELYRDNFAKREMMSFIVWCRLKKERGCTWKGALKELEEHLKGCPCMDTNCPNECGAVMQRKEVDKHCAEACPNRSVPCDHCKMKVTISK-IEEHLKGCPCMDTNCPNECG------AVMQRKEVDKHCAEA------CPNRSVPCDHCKMKSSKEQASHGPQEHTPHEAELRREA-LFQSANMQREVDMLGSRGDEYRQFLAYLERKVEDVKTSSDRRIAELTHKLMRLETREIELEGRVCNGTFIWKLDNFRQCREGSIAGLTAAIHSPPFYTSMYGY 368          

HSP 2 Score: 34.2686 bits (77), Expect = 7.153e-15
Identity = 20/66 (30.30%), Postives = 29/66 (43.94%), Query Frame = 3
Query: 2259 GSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSRCQTIAPEIDSPHENQFVGIQNFLSF 2456
            G H+S+   ++ GD+D IL WPF   I + I  +  +  SR          P     V   N L+F
Sbjct:  384 GEHVSLFIHMMQGDWDGILEWPFIGRITLSILDQSDQIDSR---------RPISETLVAKPNLLAF 440          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO32849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV3])

HSP 1 Score: 60.4622 bits (145), Expect = 1.580e-13
Identity = 78/344 (22.67%), Postives = 141/344 (40.99%), Query Frame = 1
Query: 1294 CKLCFKVLRNAKQ-TECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFD-DKATVREINQLEVVCPLD--LCQFRSKLQSIGVHMNSCEYRVIDC-RKCKQKITAIHEQDHNINLCEMRIVTCEYC-QRSIKLNE--------MIPIHLNPDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKIPYIQSSIHDLKEDLENNKNIITELFSISKSIQELIMKKFSINAEKCLQNEFRSGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGY----------NCKCKFIHLGIWI 2253
            C +C  +  +  Q  ECG R+C  C +    +   KCP C   +   ++K+ D D+A   ++N+L   C      C+       +  H   CEY  I C   C  K     +Q H    C  +I++C YC  R ++ N+        +IP+         CD  ++I     ++  +        EC   K  C F  + C    + S+E +  H  K+EI      +  +  I   + + KE L+N+     E  +I K +   +      + EK   ++      IW+IE++ + + + K     ++FS +F + + GY          + K K  H+ +++
Sbjct:   55 CPVCEDIFVSPVQIKECGHRLCQHCYKTIWRSPEPKCPKCSGDL---DDKIPDVDQAFENDMNELPCRCINHEWGCKVEVPFTQMITHKGECEYSDILCDNDCGAKFQRRFKQKHLDKDCPKKIISCPYCDDRHLRENKKEHLEDCLLIPLPC----PNKCDKTLTIPRGQLDEHIEK-------ECPRAKLMCEFESLGCQH--RCSREKMAKHM-KSEI------IGHVKMIFGVVLEQKEKLDNHAQKFEEHETIMKQVDSRVG-----DLEKIAHSQ-----IIWRIEDYTRKLKEAKAGNAETLFSPTFTTSKHGYRLCASVCLNGDGKGKGTHMSVFV 365          

HSP 2 Score: 34.6538 bits (78), Expect = 1.580e-13
Identity = 25/101 (24.75%), Postives = 47/101 (46.53%), Query Frame = 3
Query: 2256 RGSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSRCQ---TIAPE--------IDSP--HENQFVGIQNFLSFTELHSFIF-KDKSIYLKLIVN 2516
            +G+H+SV   ++ G +D +L WPF + +   + ++      R     +I P         +  P   +N   G   F+   E+ S  F KD +++LK+ V+
Sbjct:  357 KGTHMSVFVSVLKGAFDALLKWPFHYRVTFFLLNQHENPEERKHVKFSIKPNPIPDNEPFLGRPRLEKNASFGGAKFIKHEEIESGNFIKDDTVFLKVSVD 457          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO45915 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRA4])

HSP 1 Score: 72.7886 bits (177), Expect = 2.084e-13
Identity = 85/372 (22.85%), Postives = 153/372 (41.13%), Query Frame = 1
Query: 1207 LPIFQIIFYIIMNYDMRLFEFTNAPDRCKCKLCFKVLRNAKQ-TECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCP--LDLCQFRSKLQSIGVHMN-SCEYRVIDCRK-CKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKIPYIQSS----------IHDLKEDLENNKNIITEL-----FSISKSIQELIMKKFSINAE--KCLQNEFRSGNFIWKIENFDKLIIKGKMCERF-SIFSKSFYSDEFGYNCKCKFIHLGIWI 2253
            +P +++ F + ++   + FE         C +C   LR+  Q T CG RVC  CI+  +     +CP  DN + LN  K+F D A  R+I  ++++CP   D C+++  +  +  H+   C    + C K C   +     + H    C  R+V C +C + +   +M                                  HL  C +    CP   + C   D L+KE L  H N+       LLV    + ++              ++E L ++  ++ +L       IS   + L+++K  I  +  +C ++   +G FIWKI+ F + ++  K       + S++FY+   GY      +  G+W+
Sbjct:    1 MPGYEVRFVVPLD---KSFE---------CPVCLMALRDPVQVTPCGHRVCQTCIKPIIRNRRPRCP-LDN-LTLNVGKIFPDNACHRQILSMDILCPHHGDGCEWQGTISDLEKHLERGCNLSEVRCPKDCGASVERGKLEGHYPE-CSRRLVNCTHCNKEVVFADM--------------------------------NVHLQSCASFPISCP---LTCGAKD-LTKEALAVHLNQE----CPLLVIPCRFAEAGCTFKAKRQKMAAHVQESLTSHVAMLCDLVCEQKLQISAQKERLLLQKEHIQLQIVEC-RSRCANGEFIWKIQCFSRKLMDAKTGRASEPMISEAFYTSPHGYK-----MCAGVWL 311          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO37750 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SER6])

HSP 1 Score: 72.7886 bits (177), Expect = 2.891e-13
Identity = 85/372 (22.85%), Postives = 153/372 (41.13%), Query Frame = 1
Query: 1294 CKLCFKVLRNAKQTE-CGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPL--DLCQFRSKLQSIGVHMNSCEYRVIDCR-KCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNE-EMCDDYVSXXXXXXXXXXXXXXXRHLLE-CINKKKKCPFNQINCNT----IDKLSKENLVSHFNKNEIYHNTLLVSKIPYIQSSIHDLKEDLENNKNIITELF------------SISKSIQELIMKKFSINAEKCLQNE---------------FRSGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGYNCKCKFIHLGIWIVEAVICLFPLKLLTG 2298
            C++C   +RNA Q   CG R C  C+   L     +CP  DN   ++ ++++ D  T + I  L V+C      C+++ +L+ +  H+  C++   DC   C  +I      +H    C  R V C  C+  +   E + + L   NE  +  D+V+   N   + +  +  RH+ E C+N+   C +    CNT     D+ +       F  +    N   V++IP  +  +H L  D  +N  I+   F            S+ + I+E + +   + +E  +Q +               +     +W+I++F +   +GK      + S  FY+  +GY  K      G    E       ++LL G
Sbjct:   18 CRICHLPVRNAVQVSVCGHRFCDSCLNHALGETRLRCP-VDN-TAIDYSQVYADDVTNQMIMSLTVICDYYQAGCKWKGQLRKLQGHLAECKFVSADCSNSCGARIQKRRMSEHTSKDCPKRRVCCARCKAEMSY-EQLRVSLRYRNEGALVSDHVTCPRNCGERMRVQDKARHMREDCLNRWVFCQY----CNTEIVFRDRQTHHQSCPSFPLS--CPNNCGVAQIPRGEVELH-LSRDCRSN--IMQCPFRHVGCHKQFPQRSLQRHIEESVQQHLELVSELAIQQQKEINSLKEIVRHCKPYHDSKLLWRIDDFWEAFDEGKRKPGTELHSPVFYTSNYGYKFKVVLFPYGNGSGEGTHLSLYIRLLPG 377          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 85.5001 bits (210), Expect = 1.095e-16
Identity = 74/280 (26.43%), Postives = 122/280 (43.57%), Query Frame = 1
Query: 1282 DRCKCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSC-------DNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSI-GVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDYVSX-XXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKIPYIQSSIHDLK-EDLENNKNIITELFSISKSIQELIMKKFSINAEKCLQN 2091
            D+  C  C K+LR   Q +CG R C  C    +++G +KC +C       +   +L +   F D A  RE+  L  VCP + C +   ++     H  SC++ +I C  CK+ + A  ++ HN   C  R + C+YC+    L   I  H     +E+C  Y  +       +  +     H+  C   K  C F+ + C+T   + KE +  H  +    H  LL+  I  I+ S+  L+ + LE     + EL    + + EL M +   +    LQ 
Sbjct:   31 DKHLCNSCEKILRRPLQAQCGHRFCCFCFNRTVSSGPQKCSACIKEDLFEEPTSILKQGGAFHDNAARREVEALAAVCPNEGCTWTGTVKEYEASHEGSCDFTIIMCPSCKELMRANEQERHNERECPERTLNCKYCKEPFLLKN-IKAH-----DEICPKYPMMCEGCAKKKIPREKYVDHIKFCSKFKAPCRFHVVGCDT--SVEKEKIHDHERQCSYEHLNLLLHFIMGIKVSLESLQPQRLEVASQKLHELHQSLRDL-ELRMSQLGRSGTAPLQG 301          

HSP 2 Score: 42.3578 bits (98), Expect = 1.485e-7
Identity = 31/111 (27.93%), Postives = 54/111 (48.65%), Query Frame = 3
Query: 2214 QLQMQIYPFGYLDCRGSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSRCQTIAPEIDSPHENQFVGIQNFLSFTEL----------HSFIFKDKSIYLKLIVN 2516
            ++ ++IY  G    RG+HLS+ F ++ G  D +L WPF   + + +  +  RE        P+I S    + V   N  S   L          +S+I +D++I++K IV+
Sbjct:  457 KMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNRE-HIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYI-RDETIFIKAIVD 565          

HSP 3 Score: 34.2686 bits (77), Expect = 1.485e-7
Identity = 14/37 (37.84%), Postives = 21/37 (56.76%), Query Frame = 1
Query: 2104 GNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGY 2214
            G FIWKI +F K           ++FS +FY+ ++GY
Sbjct:  420 GIFIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGY 456          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 83.9593 bits (206), Expect = 2.347e-16
Identity = 56/230 (24.35%), Postives = 100/230 (43.48%), Query Frame = 1
Query: 1282 DRCKCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSC-------DNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGV-HMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDY-VSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKI 1944
            D+ KC+ C +VLR   Q +CG R C  C ++  ++G + C +C       +   +LN ++ F D A  REI  L   C    C +   ++     H   CE+  I C  C+  +    +  HN   CE R + C+YC+ +    + I  H     +E+C  + +        +  +     H   C   K  CPF+++ C ++  +    +  H + + + H  LL+  +
Sbjct:   26 DKYKCQQCLQVLRKPVQAQCGHRFCVHCFRQLTSSGPKPCQACRKEEIYEEPMSILNSSEAFPDNAAGREIASLPARCLNQGCDWTGSIKEYEAKHEGRCEFEQIQCEACQALVLRKDKDRHNDRECEERTLNCKYCKVTFNFKD-IKAH-----DEICQKFPLQCKDCGKKKIPREKFNDHAKSCAKSKSACPFSEVGCKSV--VENGKISEHEHSSTMEHLRLLLPMV 247          

HSP 2 Score: 41.9726 bits (97), Expect = 1.189e-7
Identity = 29/110 (26.36%), Postives = 50/110 (45.45%), Query Frame = 3
Query: 2214 QLQMQIYPFGYLDCRGSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSRCQTIAPEIDSPHENQFVGIQNFLSFTEL---------HSFIFKDKSIYLKLIVN 2516
            ++ +++Y  G    RG+HLS+ F ++   YD +L WPF   + + +  +  RE        P+I S    + V   N  S   L          S   +D +I++K IV+
Sbjct:  404 KMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNRE-HIIDAFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIVD 512          

HSP 3 Score: 34.6538 bits (78), Expect = 1.189e-7
Identity = 27/116 (23.28%), Postives = 56/116 (48.28%), Query Frame = 1
Query: 1879 ENLVSHFNKNEIYHNTLLVSKIPYIQSSIHDLKEDLENNKNIITELFSISKSIQELIMKKFSINAEKCLQNEFR----SGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGY 2214
            EN+V   N+ E+  ++L       +++  H  + D E  +N+  ++  + +S   L +K   ++  + +  E +     G F+WKI +F     +       ++FS +FYS ++GY
Sbjct:  298 ENIVCVLNR-EVERSSLT------LEAFSHQHRLDQEKIENLSNKIRQLERS---LTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGY 403          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 83.9593 bits (206), Expect = 2.390e-16
Identity = 56/230 (24.35%), Postives = 100/230 (43.48%), Query Frame = 1
Query: 1282 DRCKCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSC-------DNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGV-HMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDY-VSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKI 1944
            D+ KC+ C +VLR   Q +CG R C  C ++  ++G + C +C       +   +LN ++ F D A  REI  L   C    C +   ++     H   CE+  I C  C+  +    +  HN   CE R + C+YC+ +    + I  H     +E+C  + +        +  +     H   C   K  CPF+++ C ++  +    +  H + + + H  LL+  +
Sbjct:   33 DKYKCQQCLQVLRKPVQAQCGHRFCVHCFRQLTSSGPKPCQACRKEEIYEEPMSILNSSEAFPDNAAGREIASLPARCLNQGCDWTGSIKEYEAKHEGRCEFEQIQCEACQALVLRKDKDRHNDRECEERTLNCKYCKVTFNFKD-IKAH-----DEICQKFPLQCKDCGKKKIPREKFNDHAKSCAKSKSACPFSEVGCKSV--VENGKISEHEHSSTMEHLRLLLPMV 254          

HSP 2 Score: 41.9726 bits (97), Expect = 1.258e-7
Identity = 29/110 (26.36%), Postives = 50/110 (45.45%), Query Frame = 3
Query: 2214 QLQMQIYPFGYLDCRGSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSRCQTIAPEIDSPHENQFVGIQNFLSFTEL---------HSFIFKDKSIYLKLIVN 2516
            ++ +++Y  G    RG+HLS+ F ++   YD +L WPF   + + +  +  RE        P+I S    + V   N  S   L          S   +D +I++K IV+
Sbjct:  411 KMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNRE-HIIDAFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIVD 519          

HSP 3 Score: 34.6538 bits (78), Expect = 1.258e-7
Identity = 27/116 (23.28%), Postives = 56/116 (48.28%), Query Frame = 1
Query: 1879 ENLVSHFNKNEIYHNTLLVSKIPYIQSSIHDLKEDLENNKNIITELFSISKSIQELIMKKFSINAEKCLQNEFR----SGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGY 2214
            EN+V   N+ E+  ++L       +++  H  + D E  +N+  ++  + +S   L +K   ++  + +  E +     G F+WKI +F     +       ++FS +FYS ++GY
Sbjct:  305 ENIVCVLNR-EVERSSLT------LEAFSHQHRLDQEKIENLSNKIRQLERS---LTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGY 410          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 58.9214 bits (141), Expect = 2.651e-15
Identity = 71/359 (19.78%), Postives = 147/359 (40.95%), Query Frame = 1
Query: 1261 FEFTNAPDR-CKCKLCFKVLRNAKQ-TECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVC--PLDLCQFRSKLQSIGVHMNSCEYRVIDC-RKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLN--PDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPF------------NQINCN----------TIDKLSKENLVSHFNKN-------EIYHNTLLVSKIPYIQSSIHDLKEDLENNKNIITELFSISKSIQELI-----MKKFSINAEKCLQNEFRSGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGY 2214
            ++F   P R  +C LC K +R   Q + CG R C  C+QE+L+           + +    +++ D    ++I  L + C    + C++  +++ +  H ++C + VI C  +C  K+T     DH  + C  R V CE+C       E    H    P     C++            +++  +  + EC  + + C +            +Q +C               +++E+L +H   N         + +     + P +    H L++  +++  ++  L  +S+  QE++     M++ S++ +         G  IWK+ ++ + + + K+      FS  FY+  +GY
Sbjct:    6 YKFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSI---------FFPMGLLPQIYPDPELEQQILSLPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCSVKLTRRDLPDHLQHDCPKRKVKCEFCGSEF-TGEAFENHQGVCPQESVYCENKCG-----ARMMRRLLSQHGMAECPKRTQPCKYCGKEFVFDTIQNHQFHCPRFPVQCPNQCGTPNIAREDLANHVKDNCGSALVLCPFKDAGCKHRCPKLAIGRH-LEDTTKSHLTMMCNL--VSRQRQEILELRREMEELSVSHD---------GVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGY 337          

HSP 2 Score: 43.5134 bits (101), Expect = 2.651e-15
Identity = 21/61 (34.43%), Postives = 32/61 (52.46%), Query Frame = 3
Query: 2214 QLQMQIYPFGYLDCRGSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSRCQTIA 2396
            +LQ+  +  G     GSHLSV   ++ G+YD +L WPF + +   I  +    LS+ Q I 
Sbjct:  338 KLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHIT 398          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:101161132])

HSP 1 Score: 80.1073 bits (196), Expect = 4.797e-15
Identity = 42/126 (33.33%), Postives = 69/126 (54.76%), Query Frame = 1
Query: 1291 KCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYC 1668
            +C +C   LRNA QT CG R C  CI++ +    ++CP  DN  +L+E++LF D    REI  L V CP   C  + +L+ +  H+  C++  + C +C+Q +   + ++H    C  R ++C  C
Sbjct:   77 ECPICLMALRNAIQTRCGHRFCKSCIEKSIRDTGQRCP-VDNE-MLSEDQLFPDNFAKREILSLTVRCPNSDCGEKMELRHLEKHLAQCQFATVPCSQCQQPVRKSYLEEHATVECPRRPMSCPDC 200          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000027149.1 (SMESG000027149.1)

HSP 1 Score: 407.527 bits (1046), Expect = 7.661e-136
Identity = 218/227 (96.04%), Postives = 223/227 (98.24%), Query Frame = 1
Query: 1240 MNYDMRLFEFTNAPDRCKCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYH 1920
            MNYDMRLFEFTNAPDRCKCKLCFKVLRNAKQTECGCRVCGQCIQEYLA+GSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDYVSICPNNCNQKQQINIKRHLLECINKKKKCPFNQINCNTIDKLSKENL++   K+ IY+
Sbjct:    1 MNYDMRLFEFTNAPDRCKCKLCFKVLRNAKQTECGCRVCGQCIQEYLASGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDYVSICPNNCNQKQQINIKRHLLECINKKKKCPFNQINCNTIDKLSKENLLA---KSPIYN 224          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000027149.1 (SMESG000027149.1)

HSP 1 Score: 398.667 bits (1023), Expect = 1.821e-132
Identity = 214/223 (95.96%), Postives = 219/223 (98.21%), Query Frame = 1
Query: 1252 MRLFEFTNAPDRCKCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYH 1920
            MRLFEFTNAPDRCKCKLCFKVLRNAKQTECGCRVCGQCIQEYLA+GSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDYVSICPNNCNQKQQINIKRHLLECINKKKKCPFNQINCNTIDKLSKENL++   K+ IY+
Sbjct:    1 MRLFEFTNAPDRCKCKLCFKVLRNAKQTECGCRVCGQCIQEYLASGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDYVSICPNNCNQKQQINIKRHLLECINKKKKCPFNQINCNTIDKLSKENLLA---KSPIYN 220          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000027153.1 (SMESG000027153.1)

HSP 1 Score: 227.639 bits (579), Expect = 4.011e-70
Identity = 133/336 (39.58%), Postives = 201/336 (59.82%), Query Frame = 1
Query: 1261 FEFTNAPDRCKCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPS----CDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKIPYIQSSIHDLKEDLENNKNIITELFSISK-----------SIQELIMKKFSINAEKCLQNE---FRSGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGY 2214
            F F +  DR KC LC ++L+NAKQT CGC+ C  CI+ YLA G + CPS    C+N +L  +  +  D AT +EI  L+V CP  LC     L+++  H+NSCE+R I C KC+ K+ A  ++ H+ N CEMR + CEYC   +   ++  IHLN D E+ C  Y +ICPNNC+   ++ +K HL  C  KK +CPF+ +NCN +DK++KENL+ H N+  + H + L+SKI  ++++I +L ++LEN K +  EL  ++K           +I++L  K F    +  ++N+   FR+  FIWK  +F+   I  +   + S+ S  FY+ EFGY
Sbjct:   17 FNFPSLSDRLKCVLCQRILKNAKQTSCGCKACENCIKSYLANGPKPCPSKQIDCENVMLHMDEDINADNATNKEIASLKVKCPFKLCSSEMPLRNMVEHINSCEFREISCNKCQSKLQAKDKESHDKNKCEMRKLKCEYCLEEMSFRDLKSIHLNSDREDFCVKYTAICPNNCDVHTKVCLKEHLKLCSKKKLECPFHSLNCN-VDKMTKENLMKHLNEEYVSHTSNLISKIKDMENTIKNLTDELENQKVLTKELLDMNKKSSLSVLKTQETIEKLKTKSFPTPIQ-AVENKSVIFRNATFIWKFTDFESKRIDAESGRKVSVTSDPFYTSEFGY 350          

HSP 2 Score: 58.5362 bits (140), Expect = 4.011e-70
Identity = 35/110 (31.82%), Postives = 55/110 (50.00%), Query Frame = 3
Query: 2214 QLQMQIYPFGYLDCRGSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSRCQTIAPEIDSPHENQFVGIQN---------FLSFTELHSFIFKDKSIYLKLIVN 2516
            ++ ++IYP G    +G+HLSV F I+ G++D +LSWPFK  + + I  +E        T  P+  S    + V   N          LS    +S   K+ +IYLK+ V+
Sbjct:  351 KMCLRIYPAGDGVGKGTHLSVFFAIMKGEFDDLLSWPFKQKVTLSIMDQEAGTKHHSDTFKPDARSACYQKPVDECNIASGSPKFILLSLIMNNSLYCKNDTIYLKIAVD 460          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000027123.1 (SMESG000027123.1)

HSP 1 Score: 172.17 bits (435), Expect = 1.943e-53
Identity = 114/340 (33.53%), Postives = 184/340 (54.12%), Query Frame = 1
Query: 1234 IIMNYDMRLFEFTNAPDRCKCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPS--CDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKIPYIQSSIHDLKEDLENNKNIITEL----FSISKSIQELIMKKFSINAEK-------CLQNEFRSGNFIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGY 2214
            ++ NY +   +  N     KC +C  +L+NAKQT+CGC+VC  CI EYL+ G + CP+  C N +L  +  +++D AT +EI  L++ CP   C     +  I  H+ SCEYR + C  C+++I A  +Q H    CEMRI  CE+C +++ +  +  +HLN    E+C +YV  CPNNC + +++N+K HL  C+N+K           + D+      +  F+  ++ +   L+ +I  +  +  DL   LEN   II E+     ++++   +L  K  ++ AE+          N+FR+G+FIWKI++    I   +  ER SI S  FY+ EFGY
Sbjct:   10 LLTNYSL---DIPNLSSSLKCIICSSLLKNAKQTKCGCKVCENCINEYLSKGPKDCPNKECLNELLSIDKDIYNDNATNKEILNLKIACPFKGCAQLETVFKISQHVKSCEYRDVTCDPCQKRILAKEKQKHIDGECEMRITKCEFCHKTMTIKYLNEMHLNTTKNELCSEYVGHCPNNCGETKELNLKLHLETCLNRK-----------SDDQNDTNYHIQEFSNTQLSN---LLKQIALLNQTSKDLLTKLENQDVIIREMSTKYIALTEDNIKLTKKINALEAERSNPVKIIAKTNDFRNGSFIWKIKDLKSQIQNAERSERLSITSDPFYTSEFGY 332          

HSP 2 Score: 58.151 bits (139), Expect = 1.943e-53
Identity = 33/110 (30.00%), Postives = 57/110 (51.82%), Query Frame = 3
Query: 2214 QLQMQIYPFGYLDCRGSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSRCQTIAPEIDSP-------HENQFVGIQNFLSFTEL--HSFIFKDKSIYLKLIVN 2516
            +L +++YP G    +G+HLSV F ++ G+YD +L WPF+  + + +  +E        T  P+  SP         N   G   F S + L  +S  +K+ +IY+K+ V+
Sbjct:  333 KLCLRVYPSGDGLGKGTHLSVFFALMKGEYDDLLPWPFRQKLTLSLLDQENFTKHYSDTFKPDPKSPCFQRPILDSNIASGSPKFYSISHLSFNSIYYKNDTIYIKITVD 442          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000010523.1 (SMESG000010523.1)

HSP 1 Score: 149.828 bits (377), Expect = 1.662e-44
Identity = 107/345 (31.01%), Postives = 169/345 (48.99%), Query Frame = 1
Query: 1237 IMNYDMRLFEFTNAPDRCKCKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDYVSXXXXXXXXXXXXXXXRHLLECINKKKKCPFNQINCNTIDKLSKENLVSHFNKNEIYHNTLLVSKIPYIQSSIHDLKEDLENNKNIITELFSISKSIQEL---IMKKFSINAEKCLQN------EFRSGN----------FIWKIENFDKLIIKGKMCERFSIFSKSFYSDEFGY 2214
            IM   +R+    +  +R KC  C ++L  A+QT+CGCR+C  C  E +   + KCP CD     +E+    DKAT +EIN L V C +  C+++  ++    H N CEY  I C KC+  IT    ++H+  +C  R   CE+C  + +  ++   H NP  E++CD Y  +C NNC++K ++ +K H  EC  K  KCP    NC T  +L    +  H  +N I H  +++  I  +   +  L+ + +  K II E+    K+ ++     +KK  +  EK +Q       E  + N          FIWKI  F + + + K   +  + S   YS E GY
Sbjct: 3782 IMKNKIRMV--NDIKERLKCCKCKELLIGARQTKCGCRICTDCTIEVIETQTIKCPGCDETFEEDEDPTTMDKATNKEINNLLVQCRVKECEWKGLMKEAESHTNECEYNEILCEKCQTIITKKTMKEHH-KICIKREEKCEFCGVTDEWIKIEMEHRNPKEEQICDLYEGVCANNCDKKDKVKLKEHWNECSGKPVKCPLELFNCQT--QLPMAEMQKHMMENSIEHTEIMMKTIGMLAWEVKSLRTENDAQKAIIREILESRKNFEKSQGDTLKKM-VEMEKKMQQMTNNIKELETNNSITRKHPTAPFIWKITEFAEKLQRAKDGTQRILDSPPIYSWENGY 4120          

HSP 2 Score: 50.447 bits (119), Expect = 1.662e-44
Identity = 31/105 (29.52%), Postives = 54/105 (51.43%), Query Frame = 3
Query: 2214 QLQMQIYPFGYLDCRGSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRELSRCQTIAPEIDSPHE--NQFVGIQNFLSFTELHSFIF-KDKSIYLKLIVNK 2519
            +L +++YP G  +  G+H+SV   +  GDYD++L+WPFK N+ + +  +E           P++  P    N  +G   F     L    F ++ ++Y+KL V K
Sbjct: 4121 KLGIRLYPNGDGNATGTHISVFIRVGRGDYDELLTWPFKQNMILTMKGQEDYRNPIRTGNEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVEK 4225          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF62.823e-2427.07TNF receptor associated factor 6 [Source:HGNC Symb... [more]
TRAF62.823e-2427.07TNF receptor associated factor 6 [Source:HGNC Symb... [more]
TRAF22.938e-1921.76TNF receptor associated factor 2 [Source:HGNC Symb... [more]
TRAF41.187e-1623.46TNF receptor associated factor 4 [Source:HGNC Symb... [more]
TRAF43.833e-1623.46TNF receptor associated factor 4 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
trf-18.205e-1621.10TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Traf69.272e-633.33gene:FBgn0265464 transcript:FBtr0071188[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf62.505e-1622.44TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf62.505e-1622.44TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf62.505e-1622.44TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf2a1.615e-1525.93Tnf receptor-associated factor 2a [Source:ZFIN;Acc... [more]
traf4a8.898e-1321.61tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egf1.557e-1723.53epidermal growth factor [Source:Xenbase;Acc:XB-GEN... [more]
sytl21.863e-1722.67synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-9... [more]
ssh23.734e-1327.24slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
ssh21.091e-930.07slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
TRAF26.201e-923.03TNF receptor associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf64.912e-2126.67TNF receptor-associated factor 6 [Source:MGI Symbo... [more]
Traf29.255e-2121.76TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf21.134e-1821.35TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf33.081e-1527.94TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf42.205e-1222.49TNF receptor associated factor 4 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y4K3|TRAF6_HUMAN1.248e-2327.07TNF receptor-associated factor 6 OS=Homo sapiens O... [more]
sp|B6CJY5|TRAF6_MACMU2.044e-2327.07TNF receptor-associated factor 6 OS=Macaca mulatta... [more]
sp|B6CJY4|TRAF6_CERAT2.112e-2327.07TNF receptor-associated factor 6 OS=Cercocebus aty... [more]
sp|P70196|TRAF6_MOUSE2.997e-2026.67TNF receptor-associated factor 6 OS=Mus musculus O... [more]
sp|P39429|TRAF2_MOUSE5.647e-2021.76TNF receptor-associated factor 2 OS=Mus musculus O... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D5JG595.368e-4139.08TNF receptor-associated factor-2-like protein A OS... [more]
D5JG603.197e-4032.01TNF receptor-associated factor-2-like protein B OS... [more]
T1DBK63.468e-2927.08TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
T1DF652.924e-2829.53TRAF-2 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
T2M3572.120e-2328.53TNF receptor-associated factor 6 (Fragment) OS=Hyd... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2a4.856e-1620.45TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2a9.514e-1625.53TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2b1.046e-1425.11TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf4a8.501e-1421.34TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf63.906e-1233.08TNF receptor associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
traf63.693e-1528.96TNF receptor-associated factor 6 [Source:NCBI gene... [more]
ENSPMAT00000000074.11.125e-1027.43pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
ENSPMAT00000002130.15.241e-1026.55pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
ENSPMAT00000008091.19.266e-826.57pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 ... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO316901.986e-1623.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487737.153e-1523.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328491.580e-1322.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459152.084e-1322.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377502.891e-1322.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000020861.21.095e-1626.43TNF receptor-associated factor 2 [Source:NCBI gene... [more]
traf2b2.347e-1624.35TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b2.390e-1624.35TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf4a2.651e-1519.78TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf64.797e-1533.33TNF receptor associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027149.17.661e-13696.04SMESG000027149.1[more]
SMESG000027149.11.821e-13295.96SMESG000027149.1[more]
SMESG000027153.14.011e-7039.58SMESG000027153.1[more]
SMESG000027123.11.943e-5333.53SMESG000027123.1[more]
SMESG000010523.11.662e-4431.01SMESG000010523.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008172 ID=SMED30008172|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=2958bp
TATTATTTTCAACTATCAAAGAAAGGTTAACATGTTAGTTATAATGAGAA
AAAAAATTAATTACAATCAATTTTGTTTTAATGTAATGATGTCTTTTCCT
TAACCATTTTGAGTTTTAATATGAATATTACTAATCCCGAATCAACATTA
TTACGTCATTGTTAATTGATTTTATGAAAATATCTTAACGTTGTTCTTAA
AGAAATAATATTTACCTGACTAATTTAGGTATAACTCTGAAATCGAAAAT
GTAAGTTTTTTTGGATTTCGATGTAATAATATAATTGTGATTATTGGGAA
TAGGTTTAAATGGTTTTATTATTTTAATTAGATCTTATCATAGTTCTCTC
AGAATACAAAGCCAGATTATTCTTAAAATTATTAATTTATTATTGGTTTT
TCACAGCACAAGAATTTTAATATTTCAAATCCATTCTTTAATTCAATAGT
TTTCATTATTTTCAGCCATATTTTAGTAATTTTTAAAATTTGAACCAAAT
TAGAATCAATCAACAATTTATGAATCTCTAATAGGTAATGGATTTTAAAA
TGTTAAGACAATGTAAAATAAGAATTCGAAAATTGTGCTTCATAAAATTT
TTTTTTTTAAATATCGGAGCTCATGGAAATTTTTTATGAAATATAACATT
GTTACTTTAAAAAGCTTATATCGATTTCAGTTAGTTGTTGCCTTACACAG
TTAGATAATTCGCCAAGTTCAATTAATAAAGTTCCAAAATTTAATTTTTT
GAAGTGCATCAATTATTGGAAAGAATCGTCTTATTCATTAAATACAAAAA
TTCTCACTAGGTTGTATATCTATTAGTAATATTGTACCACTGGCCAATAT
GAAGTATCCTGCTCAACTGGAACCCTAATAAAGCCTTATTGTAGATTTTT
ATGGTATCGTATGTGCGCGTAATTTATGTATTTTTTATCAAAACCAATTA
TTTACATGCCAAAATAATTTTTAAAGAAATCAGAACAAACTGGATTTGCT
TTGAAATTGTCTAGATATTTTAGCTGAAATTACAATTCAATCAATAATTT
TTCTTAAAAAATTTTATTGGTTTTAGCAGATTTTCTTTTTATTAATTTAT
GAAAAGTTTGAATATTTTTTATTTTTATTAATTTTGAAAGCAAATGTTTT
TCAATAAAATTATTTTTTTAATTTGTGTTTATTTATATAGTTTCGATCTA
TATAAACTTCCGATTTTTCAAATAATATTTTATATAATAATGAACTATGA
TATGAGACTATTTGAATTTACCAATGCACCAGATCGATGTAAGTGCAAAT
TATGCTTTAAAGTCTTGAGAAATGCCAAACAAACAGAATGCGGATGTAGA
GTTTGTGGACAATGCATACAGGAATATCTAGCTGCAGGTTCTAGAAAATG
TCCCAGTTGCGATAATTACGTATTATTGAATGAAAATAAATTGTTCGATG
ACAAAGCAACGGTACGTGAGATTAACCAGTTAGAAGTGGTTTGTCCGCTA
GATTTGTGTCAATTCAGGAGTAAATTGCAATCGATCGGTGTGCATATGAA
TTCGTGTGAATATCGGGTGATAGATTGCAGGAAATGTAAACAAAAAATCA
CAGCAATACATGAGCAGGATCATAATATAAATCTATGTGAAATGCGGATT
GTAACATGTGAATATTGTCAACGAAGCATAAAATTGAATGAAATGATTCC
TATTCACTTGAATCCAGACAATGAAGAAATGTGTGATGACTATGTCTCAA
TATGTCCTAATAATTGCAATCAAAAGCAACAAATAAACATAAAAAGGCAT
TTATTGGAATGCATTAATAAAAAGAAAAAATGTCCTTTCAATCAAATTAA
TTGCAATACTATTGATAAGCTGTCGAAGGAGAATTTAGTAAGTCATTTTA
ACAAAAATGAAATCTACCACAATACATTATTAGTTAGCAAAATCCCCTAT
ATACAATCCTCGATTCACGATTTGAAGGAAGATCTTGAGAATAATAAAAA
TATAATTACCGAATTATTTTCGATCTCAAAGAGTATACAGGAGTTGATTA
TGAAAAAATTTAGTATTAATGCGGAGAAATGCTTACAAAATGAGTTTCGT
AGCGGGAATTTCATATGGAAAATCGAAAATTTTGATAAATTAATCATTAA
AGGGAAAATGTGTGAGAGATTCTCAATTTTTAGTAAAAGCTTCTATTCGG
ATGAATTTGGTTACAATTGCAAATGCAAATTTATCCATTTGGGTATTTGG
ATTGTCGAGGCAGTCATTTGTCTGTTTCCTTTGAAATTATTAACGGGGAT
TATGACCAAATATTGTCATGGCCATTTAAACATAATATACAGATTGGAAT
TTTTCACAGAGAAACGCGTGAATTGTCCCGCTGTCAAACAATTGCACCCG
AAATCGATTCCCCGCACGAGAATCAATTTGTGGGAATCCAAAATTTTTTA
TCTTTCACTGAACTGCATTCGTTTATTTTTAAAGATAAAAGTATTTATCT
GAAACTAATTGTCAATAAATAATATTTTTTAAATGATATTGATTATAATT
TATTGTTATTTTAATAATATATTATTTTGGTTTTATTTTATGTTGGCAAT
AAATAATTTTTGAATACAGAGAAACAGATTTAATTCGAATGAGTTGGAAT
TATTGTTTATAAGAATTTGGAAATGGCCAGCTGATTTATATTTTATAAAT
TTTGATTATCGATTTTGTGTTTACTAAATTACACTTGAGAAAATTTATTT
TTTAAAATTTCAATATGATGTATAAAGTTATGAGCAATGAATTCACTGTA
TATTTTGCATTTGAAACCGATTAACTCCTGTAAGGTCTGTACCAAGTGAC
AGTATCTACAATAATAAATAACTAAGACAATTTCGCAATGTTTATTCATA
AAATGAAATATTTCGACCTAAAATAGGTCATGATGACTCATAAGCAAGAT
TCATCAAT
back to top

protein sequence of SMED30008172-orf-1

>SMED30008172-orf-1 ID=SMED30008172-orf-1|Name=SMED30008172-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=100bp
MQIYPFGYLDCRGSHLSVSFEIINGDYDQILSWPFKHNIQIGIFHRETRE
LSRCQTIAPEIDSPHENQFVGIQNFLSFTELHSFIFKDKSIYLKLIVNK*
back to top

protein sequence of SMED30008172-orf-2

>SMED30008172-orf-2 ID=SMED30008172-orf-2|Name=SMED30008172-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=453bp
MFFNKIIFLICVYLYSFDLYKLPIFQIIFYIIMNYDMRLFEFTNAPDRCK
CKLCFKVLRNAKQTECGCRVCGQCIQEYLAAGSRKCPSCDNYVLLNENKL
FDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNSCEYRVIDCRKCKQ
KITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDY
VSICPNNCNQKQQINIKRHLLECINKKKKCPFNQINCNTIDKLSKENLVS
HFNKNEIYHNTLLVSKIPYIQSSIHDLKEDLENNKNIITELFSISKSIQE
LIMKKFSINAEKCLQNEFRSGNFIWKIENFDKLIIKGKMCERFSIFSKSF
YSDEFGYNCKCKFIHLGIWIVEAVICLFPLKLLTGIMTKYCHGHLNIIYR
LEFFTEKRVNCPAVKQLHPKSIPRTRINLWESKIFYLSLNCIRLFLKIKV
FI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR012227TNF_rcpt-assoc_TRAF_met
IPR043211TNF_rcpt-assoc_TRAF
IPR002083MATH/TRAF_dom
IPR008974TRAF-like
IPR013083Znf_RING/FYVE/PHD
IPR001293Znf_TRAF
IPR001841Znf_RING
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0042981regulation of apoptotic process
GO:0016567protein ubiquitination
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 245..420
e-value: 3.0E-31
score: 110.3
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 288..412
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 2..114
e-value: 3.6E-18
score: 67.7
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 115..163
e-value: 1.4E-6
score: 30.2
IPR012227TNF receptor-associated factor TRAF, metazoaPIRSFPIRSF015614TRAFcoord: 5..284
e-value: 6.2E-36
score: 121.8
coord: 257..421
e-value: 2.9E-26
score: 89.9
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 14..382
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 14..382
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 10..87
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 288..421
score: 13.538
IPR001293Zinc finger, TRAF-typePROSITEPS50145ZF_TRAFcoord: 101..143
score: 8.669
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 19..58
score: 10.262