EF-hand domain-containing protein

Overview
NameEF-hand domain-containing protein
Smed IDSMED30008169
Length (bp)1122
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of EF-hand domain-containing protein (SMED30008169) t-SNE clustered cells

Violin plots show distribution of expression levels for EF-hand domain-containing protein (SMED30008169) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of EF-hand domain-containing protein (SMED30008169) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for EF-hand domain-containing protein (SMED30008169) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008169

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30008169SMESG000026622.1 dd_Smed_v4_1881_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30008169SMESG000026622.1 dd_Smed_v4_1881_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008169SMESG000026622.1 dd_Smed_v6_1881_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Category 3 cellSMED30008169SMESG000026622.1 dd_Smed_v6_1881_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30008169SMESG000026622.1 dd_Smed_v4_1881_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008169SMESG000026622.1 dd_Smed_v4_1881_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008169SMESG000026622.1 dd_Smed_v4_1881_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal region of the epidermisSMED30008169SMESG000026622.1 dd_Smed_v4_1881_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
whole organismSMED30008169SMESG000026622.1 dd_Smed_v4_1881_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of EF-hand domain-containing protein vs. UniProt/SwissProt
Match: sp|P32070|SM21_SCHMA (Antigen Sm21.7 OS=Schistosoma mansoni OX=6183 GN=SM21.7 PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.418e-23
Identity = 53/178 (29.78%), Postives = 89/178 (50.00%), Query Frame = 2
Query:  494 MDNFLTAFFNIDADQSEEITIAELEKYMRLNNLKDAFVKKWINIFDSNDDGVITLDEYCSVLGLVTNEARIMREQFNIEHSAIPKTLPDDVKIIQSSVTSEMEIEMVDIEINGWSKCQNAPQVSKFI---KEELEKAYGPSWHCVTVLGQFWSYFSSAPATSFQYKRGKYIYLIWKTA 1018
            M+ F+  +  +  D  E +  ++L +  R   L    V +WI +FD + D  IT +E+C  LGL  NE RI R       S   ++LP+ V II S++    ++E+  +  + +++ +  P ++K +   K ELE+ YG  W    V   +W+ FS  P  S Q++    I L W+T 
Sbjct:    5 MEKFIQTYLTLLRDGDETVETSKLSESCRKEKLDMKQVNEWIALFDVDKDQKITFEEFCRGLGLKQNEMRIERNHIKTVQSGREQSLPEGVSIIASTMPKPKQVEVTQLFKDIYNEVKKDPDMNKVVKTFKSELERRYGRVWQVNAVTHSYWASFSHEPFQSIQFQYDNKIILAWRTP 182          
BLAST of EF-hand domain-containing protein vs. UniProt/SwissProt
Match: sp|P14202|TEGU_SCHMA (Tegument antigen OS=Schistosoma mansoni OX=6183 GN=A12 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.691e-21
Identity = 58/181 (32.04%), Postives = 90/181 (49.72%), Query Frame = 2
Query:  494 MDNFLTAFFNIDADQSEEITIAELEKYMRLNNLKDAFVKKWINIFDSNDDGVITLDEYCSVLGLVTNEARIMREQFNIEHSAIPKTLPDDVKIIQSSV--TSEMEI-----EMVDIEINGWSKCQNAPQVSKFIKEELEKAYGPSWHCVTVLGQFWSYFSSAPATSFQYKRGKYIYLIWKT 1015
            M+ F+ AF  IDAD +E I   EL KY +   L    +  WI  FD++ D  I+++E+C   GL  +E R  +++   E       LP +++II +++  T + EI     E VD   N      +  +V+  +K  L+  YG  W  V + G +W  FS  P  S Q+K   Y+ L W+T
Sbjct:   10 MEEFIRAFLEIDADSNEMIDKQELIKYCQKYRLDMKLIDPWIARFDTDKDNKISIEEFCRGFGLKVSEIRREKDELKKERDGKFPKLPPNIEIIAATMSKTKQYEICCQFKEYVD---NTSRTGNDMREVANKMKSLLDNTYGRVWQVVLLTGSYWMNFSHEPFLSIQFKYNNYVCLAWRT 187          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A267F2V4 (Dynein light chain (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034129g2 PE=3 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 2.326e-36
Identity = 67/175 (38.29%), Postives = 109/175 (62.29%), Query Frame = 2
Query:  491 IMDNFLTAFFNIDADQSEEITIAELEKYMRLNNLKDAFVKKWINIFDSNDDGVITLDEYCSVLGLVTNEARIMREQFNIEHSAIPKTLPDDVKIIQSSVTSEMEIEMVDIEINGWSKCQNAPQVSKFIKEELEKAYGPSWHCVTVLGQFWSYFSSAPATSFQYKRGKYIYLIWKT 1015
            + D F+ A+F ID +   EIT A+L +YMR NN  +AFV+KW+ +FDS++ G ITLDEYC  LGL   EA+ ++  +  +  +   +LP D+ +I S +T E+++ +++I  +G         ++K+IK++ +      WH V + GQFW ++S  P  SF ++ GKYI+ IW+T
Sbjct:    5 MTDAFIDAYFAIDTEGKGEITSAQLTRYMRQNNYDEAFVRKWLKLFDSDNSGTITLDEYCQTLGL---EAKKVKADYIAKMRS--GSLPSDITVISSDMTLELQLRIIEIVRDGQRLNSMEKDMAKYIKQQCDAKMERLWHVVIINGQFWCWYSHEPGYSFIFRLGKYIFCIWRT 174          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A1I8H6V5 (Dynein light chain OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034129g1 PE=3 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 2.398e-36
Identity = 67/175 (38.29%), Postives = 109/175 (62.29%), Query Frame = 2
Query:  491 IMDNFLTAFFNIDADQSEEITIAELEKYMRLNNLKDAFVKKWINIFDSNDDGVITLDEYCSVLGLVTNEARIMREQFNIEHSAIPKTLPDDVKIIQSSVTSEMEIEMVDIEINGWSKCQNAPQVSKFIKEELEKAYGPSWHCVTVLGQFWSYFSSAPATSFQYKRGKYIYLIWKT 1015
            + D F+ A+F ID +   EIT A+L +YMR NN  +AFV+KW+ +FDS++ G ITLDEYC  LGL   EA+ ++  +  +  +   +LP D+ +I S +T E+++ +++I  +G         ++K+IK++ +      WH V + GQFW ++S  P  SF ++ GKYI+ IW+T
Sbjct:    1 MTDAFIDAYFAIDTEGKGEITSAQLTRYMRQNNYDEAFVRKWLKLFDSDNSGTITLDEYCQTLGL---EAKKVKADYIAKMRS--GSLPSDITVISSDMTLELQLRIIEIVRDGQRLNSMEKDMAKYIKQQCDAKMERLWHVVIINGQFWCWYSHEPGYSFIFRLGKYIFCIWRT 170          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A1I8HXX8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028751g1 PE=4 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 3.161e-36
Identity = 72/185 (38.92%), Postives = 109/185 (58.92%), Query Frame = 2
Query:  464 NRLLVFNCKIMDNFLTAFFNIDADQSEEITIAELEKYMRLNNLKDA-FVKKWINIFDSNDDGVITLDEYCSVLGLVTNEARIMREQFNIEHSAIPKTLPDDVKIIQSSVTSEMEIEMVDIEINGWSKCQNAPQVSKFIKEELEKAYGPSWHCVTVLGQFWSYFSSAPATSFQYKRGKYIYLIWKT 1015
             R+        + FL AFF +D D+SE IT  EL  YM  ++  +A F +KW+ +FD NDDG ITLDEYC+VLGL   +ARI R             LP+DV +I SS+  EM++++ +I  +   + ++   V+  +K++L+  +G  WH V V GQ+W+ +S  P  SF +K G++I + WKT
Sbjct:   31 GRVAAEEAAAQNPFLDAFFAVDKDRSESITPDELAAYMTSSSQFEANFGEKWMKLFDENDDGAITLDEYCNVLGLNPKQARIYRLNQLKAECLRSNRLPEDVTVIASSMGLEMQVDLTEIFRDAQRRGKDEKDVAGRLKQKLDGQFGKLWHVVMVTGQYWASYSHEPGLSFFFKIGRHIVMCWKT 215          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A1I8H730 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008204g1 PE=4 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 3.333e-36
Identity = 72/185 (38.92%), Postives = 109/185 (58.92%), Query Frame = 2
Query:  464 NRLLVFNCKIMDNFLTAFFNIDADQSEEITIAELEKYMRLNNLKDA-FVKKWINIFDSNDDGVITLDEYCSVLGLVTNEARIMREQFNIEHSAIPKTLPDDVKIIQSSVTSEMEIEMVDIEINGWSKCQNAPQVSKFIKEELEKAYGPSWHCVTVLGQFWSYFSSAPATSFQYKRGKYIYLIWKT 1015
             R+        + FL AFF +D D+SE IT  EL  YM  ++  +A F +KW+ +FD NDDG ITLDEYC+VLGL   +ARI R             LP+DV +I SS+  EM++++ +I  +   + ++   V+  +K++L+  +G  WH V V GQ+W+ +S  P  SF +K G++I + WKT
Sbjct:   31 GRVAAEEAAAQNPFLDAFFAVDKDRSESITPDELAAYMTSSSQFEANFGEKWMKLFDENDDGAITLDEYCNVLGLNPKQARIYRLNQLKAECLRNNRLPEDVTVIASSMGLEMQVDLTEIFRDAQRRGKDEKDVAGRLKQQLDGQFGKLWHVVMVTGQYWASYSHEPGLSFFFKIGRHIVMCWKT 215          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A1I8JCG4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008204g2 PE=4 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 3.823e-36
Identity = 72/185 (38.92%), Postives = 109/185 (58.92%), Query Frame = 2
Query:  464 NRLLVFNCKIMDNFLTAFFNIDADQSEEITIAELEKYMRLNNLKDA-FVKKWINIFDSNDDGVITLDEYCSVLGLVTNEARIMREQFNIEHSAIPKTLPDDVKIIQSSVTSEMEIEMVDIEINGWSKCQNAPQVSKFIKEELEKAYGPSWHCVTVLGQFWSYFSSAPATSFQYKRGKYIYLIWKT 1015
             R+        + FL AFF +D D+SE IT  EL  YM  ++  +A F +KW+ +FD NDDG ITLDEYC+VLGL   +ARI R             LP+DV +I SS+  EM++++ +I  +   + ++   V+  +K++L+  +G  WH V V GQ+W+ +S  P  SF +K G++I + WKT
Sbjct:   31 GRVAAEEAAAQNPFLDAFFAVDKDRSESITPDELAAYMTSSSQFEANFGEKWMKLFDENDDGAITLDEYCNVLGLNPKQARIYRLNQLKAECLRNNRLPEDVTVIASSMGLEMQVDLTEIFRDAQRRGKDEKDVAGRLKQQLDGQFGKLWHVVMVTGQYWASYSHEPGLSFFFKIGRHIVMCWKT 215          
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000026622.1 (SMESG000026622.1)

HSP 1 Score: 361.303 bits (926), Expect = 1.576e-126
Identity = 173/176 (98.30%), Postives = 175/176 (99.43%), Query Frame = 2
Query:  494 MDNFLTAFFNIDADQSEEITIAELEKYMRLNNLKDAFVKKWINIFDSNDDGVITLDEYCSVLGLVTNEARIMREQFNIEHSAIPKTLPDDVKIIQSSVTSEMEIEMVDIEINGWSKCQNAPQVSKFIKEELEKAYGPSWHCVTVLGQFWSYFSSAPATSFQYKRGKYIYLIWKTAI 1021
            MDNFLTAFFNID+DQSEEITIAELEKYMRLNNLKDAFVKKWINIFDSNDDGVITLDEYCSVLGLVTNEARIMREQFNIEHSAIPKTLPDDVKIIQSSVTSEMEIEMVDIEINGWSKCQNAPQVSKFIKEEL+KAYGPSWHCVTVLGQFWSYFSSAPATSFQYKRGKYIYLIWKT I
Sbjct:    1 MDNFLTAFFNIDSDQSEEITIAELEKYMRLNNLKDAFVKKWINIFDSNDDGVITLDEYCSVLGLVTNEARIMREQFNIEHSAIPKTLPDDVKIIQSSVTSEMEIEMVDIEINGWSKCQNAPQVSKFIKEELDKAYGPSWHCVTVLGQFWSYFSSAPATSFQYKRGKYIYLIWKTEI 176          
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000045029.1 (SMESG000045029.1)

HSP 1 Score: 122.865 bits (307), Expect = 1.833e-33
Identity = 64/176 (36.36%), Postives = 95/176 (53.98%), Query Frame = 2
Query:  494 MDNFLTAFFNIDADQSEEITIAELEKYMRLNNLKDAFVKKWINIFDSNDDGVITLDEYCSVLGLVTNEARIMREQFNIEHSAIPKTLPDDVKIIQSSVTSEMEIEMVDIEINGWSKCQNAPQVSKFIKEELEKAYGPSWHCVTVLGQFWSYFSSAPATSFQYKRGKYIYLIWKTAI 1021
            MD+F+ AFF ID D S EI+  EL  YM  N+ +  F+KKW+ IFD ++ G ITL+EYC VLG+    A + R            ++P++VKI+QS++        + I +N  S   +   + K + E L   YG  W C  + GQ W+YFS     S       +I++I++TAI
Sbjct:    1 MDSFIEAFFAIDTDSSGEISTDELSDYMNKNHYRSEFIKKWLKIFDIDNSGTITLEEYCKVLGIEYKRASLQRRM-------SMYSIPENVKILQSTMDEGQRNNCIKIYLNAISSGDSPKGILKDVHENLILYYGTGWQCFLIKGQHWTYFSHLEGCSLIIHIDGFIFIIFRTAI 169          
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000006950.1 (SMESG000006950.1)

HSP 1 Score: 100.523 bits (249), Expect = 4.720e-25
Identity = 57/174 (32.76%), Postives = 95/174 (54.60%), Query Frame = 2
Query:  497 DNFLTAFFNIDADQSEEITIAELEKYMRLNNLKDAFVKKWINIFDSNDDGVITLDEYCSVLGLVTNEARIMREQFNIEHSAIPKTLPDDVKIIQSSVTSEMEIEMVDIEINGWSKCQNA-PQVSKFIKEELEKAYGPSWHCVTVLGQFWSYFSSAPATSFQYKRGKYIYLIWKT 1015
            D F+ A+  ID D S  IT  EL  YM  NN ++ FV KW+ +FD ++ G ITL+E+C  LGL  ++   + ++  ++ SA   +L + V I+ S++    E  ++ +         N+  + S +IK+ L+     +WHC+   GQ+W+Y+S  P  S   K    +YL+W+T
Sbjct:    3 DAFIKAYCQIDKDGSGTITADELRAYMTENNYQEDFVTKWLRLFDRDNTGRITLEEFCETLGLEVSD--FIDKRTALKESA-DFSLYNGVNILSSNMVQPNEGIVIQVIRKARELYPNSFKEQSTYIKQNLDLVLETTWHCIITKGQYWAYYSCEPECSLAVKIENIVYLLWRT 173          
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000042102.1 (SMESG000042102.1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.914e-24
Identity = 62/183 (33.88%), Postives = 97/183 (53.01%), Query Frame = 2
Query:  503 FLTAFFNIDADQSEEITIAELEKYMRLNNLKDAFVKKWINIFDSNDDGVITLDEYCSVLGLVTN---EARIMREQFNIEHSAIPKTLPD--DVKIIQSSVTSEMEIEMVDIEINGWSKCQNAPQ-------VSKFIKEELEKAYGPSWHCVTVLGQFWSYFSSAPATSFQYKRGKYIYLIWKT 1015
            F+ AF  ID+D S EIT  EL +YMRL N K AFV+KW+NIFD+++ G ITL+E+C+ LGL+ N   + RI + +   E       L    D+ +I     ++ + +   ++I     CQ A         ++K++K  L+  +G SW+ V  +  + S+ S  P      K  K+  L+WK 
Sbjct:    3 FIKAFEEIDSDNSGEITRGELIRYMRLKNYKPAFVEKWLNIFDADNSGTITLEEFCNTLGLIPNKNYQKRIEKRKSEKELLKRKSLLIPLYDLYVIDEDPLNDPKFKDFCMKI-----CQEATNNENDFISIAKYLKSVLDVKFGRSWNVVVDIDAYGSFLSHEPGAFIHIKVRKFAILLWKV 180          
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000026288.1 (SMESG000026288.1)

HSP 1 Score: 90.1225 bits (222), Expect = 3.043e-21
Identity = 60/177 (33.90%), Postives = 97/177 (54.80%), Query Frame = 2
Query:  497 DNFLTAFFNIDADQSEEITIAELEKYMRLNNLKDAFVKKWINIFDSNDDGVITLDEYCSVLGLVTNEARIMRE--QFNIEHSAIPKT--LPDDVKIIQSSVTSEMEIEMVDIEINGWSKCQNAPQVSKFIKEELEKAYGPSWHCVTVLGQFWSYFSSAPATSFQYKRGKYIYLIWKT 1015
            D F+ AFF+ID   +++IT  +L ++   NN  + FV KW+N+FD    GVITL+E+C VLGL   E    RE  Q   E +  PK+  + DD  II+   T E+  E  D         QN    S+ +K+ +E+ Y  +W  + + GQ+W+++S  P  +F +K     ++I+++
Sbjct:    6 DAFVHAFFSIDRQNTKKITAKQLLEFQNKNNYDEKFVDKWLNLFDRERTGVITLEEFCDVLGLELKEMEEKREKWQEEKEKNREPKSDQMLDD--IIEK--TKELRKEHPD---------QNKIVASE-LKKYIEERYQRAWVILIIRGQYWAHYSYLPEDNFVFKLNNDTHVIFRS 168          
The following BLAST results are available for this feature:
BLAST of EF-hand domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|P32070|SM21_SCHMA4.418e-2329.78Antigen Sm21.7 OS=Schistosoma mansoni OX=6183 GN=S... [more]
sp|P14202|TEGU_SCHMA1.691e-2132.04Tegument antigen OS=Schistosoma mansoni OX=6183 GN... [more]
back to top
BLAST of EF-hand domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267F2V42.326e-3638.29Dynein light chain (Fragment) OS=Macrostomum ligna... [more]
A0A1I8H6V52.398e-3638.29Dynein light chain OS=Macrostomum lignano OX=28230... [more]
A0A1I8HXX83.161e-3638.92Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8H7303.333e-3638.92Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8JCG43.823e-3638.92Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026622.11.576e-12698.30SMESG000026622.1[more]
SMESG000045029.11.833e-3336.36SMESG000045029.1[more]
SMESG000006950.14.720e-2532.76SMESG000006950.1[more]
SMESG000042102.11.914e-2433.88SMESG000042102.1[more]
SMESG000026288.13.043e-2133.90SMESG000026288.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008169 ID=SMED30008169|Name=EF-hand domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1122bp
ATGTCTTTTCATTTTAAGCCAAATATTTGAATCGCTGCTTAAAATCTAAT
ATCAGACTTTGTGAAGGTCTGGATCTGTTTCACAGAAGCTGCTGTCAAAA
TCGTTTGAGAAAAGCATTGAATTAAATACAAGTTTCACCTCGTTCCTGGA
TATTGTTTGAAATGTTGATAGATTTGTCGACTTATTCTAAAAATCTCGCA
CCTATTCTATTGGAATTCTGAGATTGTGAGTCTGTGTGCGCGGAGGTGGG
ACTGTGTGTAGGCGGGTATTTGTGCGGTCATTGAAATTGTGTGCGTCGCA
TTGGCGATGAATTAATGTAGCATTTTCTTGTTCATCATTCCGTAAAGAAC
ATTGATCTGCACATCAAAAGCTATTTTCGGCATATAGTTGAGAATGGCTA
ATAAAACAATGCACAGACAGATTTCTATATAGTATATACATGCATTTTTT
ATAATAAAAACAGAATCGCTTGCTAGTGTTTAATTGTAAAATCATGGATA
ATTTTCTAACAGCTTTTTTCAACATTGACGCAGATCAGAGTGAAGAGATT
ACTATTGCGGAGTTGGAGAAGTATATGCGTTTGAACAACTTGAAAGACGC
TTTTGTGAAGAAATGGATCAACATTTTTGATTCAAACGATGATGGAGTGA
TTACTTTGGATGAATACTGTTCAGTTTTGGGCCTTGTAACAAATGAAGCG
CGAATTATGAGAGAACAATTTAACATTGAACATTCTGCAATTCCAAAGAC
TTTACCTGATGATGTGAAAATTATTCAAAGCTCAGTGACGAGCGAAATGG
AAATAGAAATGGTTGACATAGAAATTAATGGTTGGAGCAAATGTCAGAAT
GCTCCACAAGTTTCTAAATTCATCAAAGAAGAGTTAGAAAAAGCTTATGG
GCCCTCTTGGCATTGTGTAACAGTTCTCGGTCAATTTTGGAGCTATTTTT
CTTCAGCTCCAGCTACTTCGTTCCAATATAAACGAGGAAAATATATTTAT
CTTATTTGGAAAACTGCAATTTAAATAGTTATTTTTTTAATGAAATATGT
TGACCTTTAATTTAAATTAGATTGTTTTATTTCAATTTTCTAGTGTCTTA
AGAATTTATTAATATTGATTTT
back to top

protein sequence of SMED30008169-orf-1

>SMED30008169-orf-1 ID=SMED30008169-orf-1|Name=SMED30008169-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=177bp
MDNFLTAFFNIDADQSEEITIAELEKYMRLNNLKDAFVKKWINIFDSNDD
GVITLDEYCSVLGLVTNEARIMREQFNIEHSAIPKTLPDDVKIIQSSVTS
EMEIEMVDIEINGWSKCQNAPQVSKFIKEELEKAYGPSWHCVTVLGQFWS
YFSSAPATSFQYKRGKYIYLIWKTAI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000054dorsal region of the epidermis
PLANA:0000136whole organism
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR037177DLC_sf
IPR002048EF_hand_dom
IPR001372Dynein_light_chain_typ-1/2
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
Vocabulary: cellular component
TermDefinition
GO:0030286dynein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001372Dynein light chain, type 1/2SMARTSM01375Dynein_light_2coord: 86..174
e-value: 2.7E-9
score: 46.9
IPR001372Dynein light chain, type 1/2PFAMPF01221Dynein_lightcoord: 91..174
e-value: 4.5E-16
score: 58.9
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 1..69
e-value: 3.6E-11
score: 44.7
IPR002048EF-hand domainPFAMPF13499EF-hand_7coord: 6..60
e-value: 1.1E-9
score: 38.6
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 33..68
score: 11.78
IPR037177Dynein light chain superfamilyGENE3DG3DSA:3.30.740.10coord: 80..175
e-value: 4.6E-13
score: 50.9
IPR037177Dynein light chain superfamilySUPERFAMILYSSF54648DLCcoord: 86..174
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 46..58
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 4..66