Rhodanese-like protein

Overview
NameRhodanese-like protein
Smed IDSMED30008157
Length (bp)539
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rhodanese-like protein (SMED30008157) t-SNE clustered cells

Violin plots show distribution of expression levels for Rhodanese-like protein (SMED30008157) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rhodanese-like protein (SMED30008157) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rhodanese-like protein (SMED30008157) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008157

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30008157SMESG000030828.1 dd_Smed_v4_880_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30008157SMESG000030828.1 dd_Smed_v4_880_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008157SMESG000030828.1 dd_Smed_v4_880_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008157SMESG000030828.1 dd_Smed_v4_880_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30008157SMESG000030828.1 dd_Smed_v4_880_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30008157SMESG000030828.1 dd_Smed_v4_880_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30008157SMESG000030828.1 dd_Smed_v4_880_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008157SMESG000030828.1 Contig34216newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008157SMESG000030828.1 Contig34216uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
photoreceptor neuronSMED30008157SMESG000030828.1 SMED30008157smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30008157SMESG000030828.1 SMED30008157smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rhodanese-like protein vs. Ensembl Human
Match: TSTD1 (thiosulfate sulfurtransferase like domain containing 1 [Source:HGNC Symbol;Acc:HGNC:35410])

HSP 1 Score: 64.3142 bits (155), Expect = 2.666e-13
Identity = 34/110 (30.91%), Postives = 60/110 (54.55%), Query Frame = 2
Query:  113 VATTHAISVADLKAAIKTSELQVIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAW 442
            +A    +S+ +L++ + +   ++ DVRS EE   G I GA+NIP+ E++ A ++    F+  +   KP+    +++  C  G R  +A +L   +GYT  R+ AG Y  W
Sbjct:    1 MAGAPTVSLPELRSLLASGRARLFDVRSREEAAAGTIPGALNIPVSELESALQMEPAAFQALYSAEKPKLEDEHLVFFCQMGKRGLQATQLARSLGYTGARNYAGAYREW 110          
BLAST of Rhodanese-like protein vs. Ensembl Human
Match: TSTD1 (thiosulfate sulfurtransferase like domain containing 1 [Source:HGNC Symbol;Acc:HGNC:35410])

HSP 1 Score: 64.3142 bits (155), Expect = 3.381e-13
Identity = 33/109 (30.28%), Postives = 60/109 (55.05%), Query Frame = 2
Query:  116 ATTHAISVADLKAAIKTSELQVIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAW 442
            ++   +S+ +L++ + +   ++ DVRS EE   G I GA+NIP+ E++ A ++    F+  +   KP+    +++  C  G R  +A +L   +GYT  R+ AG Y  W
Sbjct:    9 SSAPTVSLPELRSLLASGRARLFDVRSREEAAAGTIPGALNIPVSELESALQMEPAAFQALYSAEKPKLEDEHLVFFCQMGKRGLQATQLARSLGYTGARNYAGAYREW 117          
BLAST of Rhodanese-like protein vs. Ensembl Human
Match: TSTD1 (thiosulfate sulfurtransferase like domain containing 1 [Source:HGNC Symbol;Acc:HGNC:35410])

HSP 1 Score: 55.0694 bits (131), Expect = 9.984e-10
Identity = 29/100 (29.00%), Postives = 55/100 (55.00%), Query Frame = 2
Query:  113 VATTHAISVADLKAAIKTSELQVIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNF 412
            +A    +S+ +L++ + +   ++ DVRS EE   G I GA+NIP+ E++ A ++    F+  +   KP+    +++  C  G R  +A +L   +GYT +
Sbjct:    1 MAGAPTVSLPELRSLLASGRARLFDVRSREEAAAGTIPGALNIPVSELESALQMEPAAFQALYSAEKPKLEDEHLVFFCQMGKRGLQATQLARSLGYTGY 100          
BLAST of Rhodanese-like protein vs. Ensembl Fly
Match: CG6000 (gene:FBgn0039145 transcript:FBtr0334920)

HSP 1 Score: 48.1358 bits (113), Expect = 3.979e-7
Identity = 33/91 (36.26%), Postives = 53/91 (58.24%), Query Frame = 2
Query:  179 VIDVRSPEEVKE-GKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSK 448
            +IDVR PEE+KE G+I  +INIP+G + +    S + F+ K+   KP+  +  II +C  G RS KA      +G+ N ++  G +  W++
Sbjct:   59 LIDVREPEELKETGQIPASINIPLGVVSQELAASEQLFKSKYGREKPKPET-EIIFHCKIGKRSLKAAEAAAALGFKNVKNYQGSWLDWAE 148          
BLAST of Rhodanese-like protein vs. Ensembl Fly
Match: CG6000 (gene:FBgn0039145 transcript:FBtr0343101)

HSP 1 Score: 48.1358 bits (113), Expect = 3.979e-7
Identity = 33/91 (36.26%), Postives = 53/91 (58.24%), Query Frame = 2
Query:  179 VIDVRSPEEVKE-GKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSK 448
            +IDVR PEE+KE G+I  +INIP+G + +    S + F+ K+   KP+  +  II +C  G RS KA      +G+ N ++  G +  W++
Sbjct:   59 LIDVREPEELKETGQIPASINIPLGVVSQELAASEQLFKSKYGREKPKPET-EIIFHCKIGKRSLKAAEAAAALGFKNVKNYQGSWLDWAE 148          
BLAST of Rhodanese-like protein vs. Ensembl Fly
Match: CG4456 (gene:FBgn0001228 transcript:FBtr0100655)

HSP 1 Score: 44.2838 bits (103), Expect = 4.044e-6
Identity = 33/94 (35.11%), Postives = 52/94 (55.32%), Query Frame = 2
Query:  170 ELQVIDVRSPEEVKE-GKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSK 448
            ++ +IDVR  EE+++ G I  +INIP+ E+ +A  L    F+ K+   KPEK S  II  C  G R  +A ++    GY+N     G +  W++
Sbjct:   15 DVYLIDVRRKEELQQTGFIPASINIPLDELDKALNLDGSAFKNKYGRSKPEKQSP-IIFTCRSGNRVLEAEKIAKSQGYSNVVIYKGSWNEWAQ 107          
BLAST of Rhodanese-like protein vs. Ensembl Fly
Match: CG4456 (gene:FBgn0001228 transcript:FBtr0303474)

HSP 1 Score: 44.2838 bits (103), Expect = 4.044e-6
Identity = 33/94 (35.11%), Postives = 52/94 (55.32%), Query Frame = 2
Query:  170 ELQVIDVRSPEEVKE-GKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSK 448
            ++ +IDVR  EE+++ G I  +INIP+ E+ +A  L    F+ K+   KPEK S  II  C  G R  +A ++    GY+N     G +  W++
Sbjct:   15 DVYLIDVRRKEELQQTGFIPASINIPLDELDKALNLDGSAFKNKYGRSKPEKQSP-IIFTCRSGNRVLEAEKIAKSQGYSNVVIYKGSWNEWAQ 107          
BLAST of Rhodanese-like protein vs. Ensembl Fly
Match: CG4456 (gene:FBgn0001228 transcript:FBtr0100653)

HSP 1 Score: 44.2838 bits (103), Expect = 4.044e-6
Identity = 33/94 (35.11%), Postives = 52/94 (55.32%), Query Frame = 2
Query:  170 ELQVIDVRSPEEVKE-GKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSK 448
            ++ +IDVR  EE+++ G I  +INIP+ E+ +A  L    F+ K+   KPEK S  II  C  G R  +A ++    GY+N     G +  W++
Sbjct:   15 DVYLIDVRRKEELQQTGFIPASINIPLDELDKALNLDGSAFKNKYGRSKPEKQSP-IIFTCRSGNRVLEAEKIAKSQGYSNVVIYKGSWNEWAQ 107          
BLAST of Rhodanese-like protein vs. Ensembl Zebrafish
Match: CABZ01058650.1 (thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 1 [Source:NCBI gene;Acc:561325])

HSP 1 Score: 75.0998 bits (183), Expect = 4.068e-17
Identity = 41/107 (38.32%), Postives = 64/107 (59.81%), Query Frame = 2
Query:  128 AISVADLKAAIKTSELQVIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSK 448
            A++   LK  + T  +Q+IDVR P+E+  G I GA NIP+GE++EA  L  ++F +++ + KP     +I+L C  G RS  AL +   + Y+  RH  GGY  W++
Sbjct:   48 AVTYEQLKHMMSTGRVQLIDVREPDELTAGFIPGATNIPLGELEEALTLDPDQFRQRYGVSKPHPDDSDIVLYCQRGVRSLNALEIAIRLEYSRARHYVGGYSEWAE 154          
BLAST of Rhodanese-like protein vs. Ensembl Zebrafish
Match: si:ch211-161h7.8 (si:ch211-161h7.8 [Source:ZFIN;Acc:ZDB-GENE-091204-302])

HSP 1 Score: 75.485 bits (184), Expect = 4.320e-17
Identity = 49/157 (31.21%), Postives = 89/157 (56.69%), Query Frame = 2
Query:   17 LQLI*TLIYNLIKINIIFFMAATVECHGKL--------DDVATTH----AISVA---DLKAAIKTSELQVIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAW 442
            LQ +  + + +++   +F +   V CHG++         ++  +H    A+SV     LK  +    +Q+ DVR+P+E + G+I  ++N+P+GE++ + +L  E+FE++F++  P+K   NI+ +C  G RS  AL   H +G++  RH AGGY  W
Sbjct:   19 LQPLEMVSFQILRRLGVFALTKPV-CHGRILSACGIKTSNINHSHGQPGAVSVVTYEQLKGMLANHSVQLFDVRNPDEFQAGRIPDSVNVPLGELEVSLKLPAEKFEEQFKVKAPQKADDNIVFHCRSGKRSLTALETAHRLGFSKARHYAGGYIDW 174          
BLAST of Rhodanese-like protein vs. Ensembl Zebrafish
Match: si:dkey-165n16.1 (si:dkey-165n16.1 [Source:ZFIN;Acc:ZDB-GENE-100922-224])

HSP 1 Score: 69.3218 bits (168), Expect = 1.058e-14
Identity = 38/107 (35.51%), Postives = 61/107 (57.01%), Query Frame = 2
Query:  131 ISVADLKAAIKTSELQVIDVRSPEEVKE-GKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSK 448
            +S   LK  + +    VIDVR P E++E G I+G+IN+P+G++  A +L+  +  K+         S+NI+ +CL G RS  AL     +GYT  +H  GG+  W++
Sbjct:   66 VSYEQLKKLLVSGSSVVIDVREPWELREYGNIQGSINVPLGQVNGALQLT-PDEFKEKYGGDMPSKSQNIVFSCLAGVRSKHALEAAVSLGYTKVQHFPGGWQEWAE 171          
BLAST of Rhodanese-like protein vs. Ensembl Zebrafish
Match: BX537102.2 (si:dkey-34l15.1 [Source:NCBI gene;Acc:563265])

HSP 1 Score: 58.9214 bits (141), Expect = 2.053e-11
Identity = 39/111 (35.14%), Postives = 58/111 (52.25%), Query Frame = 2
Query:  116 ATTHAISVADLKAAIKTSELQVIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSK 448
            A  + IS +DLK+ +      ++DVR+ EEV  G I G+I+IP+G I +   L   EF+ KF + KP      ++  C  G R   A      +G+ N R+ AG Y  WS+
Sbjct:    3 AVDNDISYSDLKSILAKGSAVLVDVRTNEEVARGTIPGSIHIPVGNIGQDLSLDAAEFQSKFGVGKPPLDCTELVFFCQLGRRGAAATEKAKSLGFKNARNYAGAYKEWSE 113          
BLAST of Rhodanese-like protein vs. Ensembl Zebrafish
Match: TSTD1 (si:dkey-34l15.1 [Source:ZFIN;Acc:ZDB-GENE-081107-63])

HSP 1 Score: 58.9214 bits (141), Expect = 2.428e-11
Identity = 37/111 (33.33%), Postives = 60/111 (54.05%), Query Frame = 2
Query:  116 ATTHAISVADLKAAIKTSELQVIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSK 448
            ++ + IS +DLK+ +    + ++DVR+ EEV  G I G+I+IP+G + +   L   EF+ KF + KP      ++  C  G R   A      +G+ N R+ AG Y  WS+
Sbjct:    3 SSDNDISYSDLKSLLAKGSVVLVDVRTNEEVARGTIPGSIHIPVGNVGQDLSLDAAEFQSKFGVGKPPLDCTELVFFCQLGRRGAAATEKAKSLGFKNARNYAGAYKEWSE 113          
BLAST of Rhodanese-like protein vs. Ensembl Xenopus
Match: ENSXETT00000042802.1 (thiosulfate sulfurtransferase (rhodanese)-like domain containing 3 [Source:NCBI gene;Acc:100486879])

HSP 1 Score: 67.0106 bits (162), Expect = 8.464e-14
Identity = 44/110 (40.00%), Postives = 69/110 (62.73%), Query Frame = 2
Query:  122 THAISVADLKAAIKTSELQVIDVRSPEEVKE-GKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSK 448
            +  I   +LK  +K   + +IDVR P EVKE G I+G+++IP+G++  A +L    FEKK+++  PEKTS  +I +CL G RS KA+ +   +G+    H AGG+  W++
Sbjct:   50 SQTIKYEELKDLLKEEGVVIIDVREPWEVKEYGVIKGSLSIPMGDLASALQLDPLTFEKKYQVKMPEKTS-TLIFSCLAGIRSKKAVDVAGSLGFKRVHHYAGGFEDWAR 158          
BLAST of Rhodanese-like protein vs. Ensembl Mouse
Match: Tstd1 (thiosulfate sulfurtransferase (rhodanese)-like domain containing 1 [Source:MGI Symbol;Acc:MGI:3648482])

HSP 1 Score: 69.3218 bits (168), Expect = 4.137e-15
Identity = 37/110 (33.64%), Postives = 61/110 (55.45%), Query Frame = 2
Query:  113 VATTHAISVADLKAAIKTSELQVIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAW 442
            +A    +S ++L++ + +   ++ DVRSPEE   G I GA+NIP+ E++ A  +    F+  +   KP+   +N+I  C  G R  +A +L   +GYT  R+ AG Y  W
Sbjct:   19 MAGVPTVSFSELRSLVASGRARLFDVRSPEEAAAGTIPGALNIPVSELEIALNMDPAAFQTLYCAEKPKLEDKNLIFFCQMGRRGLQATQLAQGLGYTGARNYAGAYKEW 128          
BLAST of Rhodanese-like protein vs. Ensembl Mouse
Match: Tstd3 (thiosulfate sulfurtransferase (rhodanese)-like domain containing 3 [Source:MGI Symbol;Acc:MGI:1924282])

HSP 1 Score: 67.0106 bits (162), Expect = 4.478e-14
Identity = 35/110 (31.82%), Postives = 64/110 (58.18%), Query Frame = 2
Query:  116 ATTHAISVADLKAAIKTSELQVIDVRSPEEV-KEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAW 442
            +T   ++  +LK+ + + ++ +IDVR+  E+ ++GKI G+INIP+ E+ EA ++ N    K+         S  ++ +CL G RS KA+     +G+ + +H AGG+  W
Sbjct:   37 STPKGVTYRELKSLLNSKDIMLIDVRNTLEILEQGKIPGSINIPLDEVGEALQM-NPVDFKEKYCQVKPSKSDRLVFSCLAGVRSKKAMDTAISLGFNSAQHYAGGWKEW 145          
BLAST of Rhodanese-like protein vs. UniProt/SwissProt
Match: sp|Q9D0B5|TSTD3_MOUSE (Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 OS=Mus musculus OX=10090 GN=Tstd3 PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.132e-13
Identity = 35/110 (31.82%), Postives = 64/110 (58.18%), Query Frame = 2
Query:  116 ATTHAISVADLKAAIKTSELQVIDVRSPEEV-KEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAW 442
            +T   ++  +LK+ + + ++ +IDVR+  E+ ++GKI G+INIP+ E+ EA ++ N    K+         S  ++ +CL G RS KA+     +G+ + +H AGG+  W
Sbjct:   37 STPKGVTYRELKSLLNSKDIMLIDVRNTLEILEQGKIPGSINIPLDEVGEALQM-NPVDFKEKYCQVKPSKSDRLVFSCLAGVRSKKAMDTAISLGFNSAQHYAGGWKEW 145          
BLAST of Rhodanese-like protein vs. UniProt/SwissProt
Match: sp|Q8NFU3|TSTD1_HUMAN (Thiosulfate:glutathione sulfurtransferase OS=Homo sapiens OX=9606 GN=TSTD1 PE=1 SV=3)

HSP 1 Score: 64.3142 bits (155), Expect = 1.280e-12
Identity = 34/110 (30.91%), Postives = 60/110 (54.55%), Query Frame = 2
Query:  113 VATTHAISVADLKAAIKTSELQVIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAW 442
            +A    +S+ +L++ + +   ++ DVRS EE   G I GA+NIP+ E++ A ++    F+  +   KP+    +++  C  G R  +A +L   +GYT  R+ AG Y  W
Sbjct:    1 MAGAPTVSLPELRSLLASGRARLFDVRSREEAAAGTIPGALNIPVSELESALQMEPAAFQALYSAEKPKLEDEHLVFFCQMGKRGLQATQLARSLGYTGARNYAGAYREW 110          
BLAST of Rhodanese-like protein vs. UniProt/SwissProt
Match: sp|Q10215|RDL_SCHPO (Putative thiosulfate sulfurtransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4H3.07c PE=3 SV=2)

HSP 1 Score: 62.7734 bits (151), Expect = 1.158e-11
Identity = 37/89 (41.57%), Postives = 56/89 (62.92%), Query Frame = 2
Query:  179 VIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWS 445
            +IDVR P+E K+G IE + N+P+G+I+EA +LS+EEF K +   KP     N+++ C  G RS  A  +L ++GY N  +  G +  WS
Sbjct:   49 LIDVREPDEFKQGAIETSYNLPVGKIEEAMKLSDEEFSKTYGFSKPVFED-NVVVYCRSGRRSTTASDILTKLGYKNIGNYTGSWLEWS 136          
BLAST of Rhodanese-like protein vs. UniProt/SwissProt
Match: sp|Q39129|STR16_ARATH (Thiosulfate sulfurtransferase 16, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=STR16 PE=1 SV=2)

HSP 1 Score: 56.225 bits (134), Expect = 2.283e-9
Identity = 32/91 (35.16%), Postives = 48/91 (52.75%), Query Frame = 2
Query:  176 QVIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSK 448
            + +DVR+PEE  +G   GAIN+P   +       ++  +   ++      S NII+ C  GGRS KA   L   G+T  + + GGY AW+K
Sbjct:   25 RYLDVRTPEEFSQGHACGAINVPY--MNRGASGMSKNPDFLEQVSSHFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVGGYSAWAK 113          
BLAST of Rhodanese-like protein vs. UniProt/SwissProt
Match: sp|P23857|PSPE_ECOLI (Thiosulfate sulfurtransferase PspE OS=Escherichia coli (strain K12) OX=83333 GN=pspE PE=1 SV=1)

HSP 1 Score: 49.6766 bits (117), Expect = 3.597e-7
Identity = 27/82 (32.93%), Postives = 43/82 (52.44%), Query Frame = 2
Query:  182 IDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAG 427
            IDVR PE+ ++  ++GAINIP+ E+KE    +                +  + + C  G +SG+A  +L EMGYT+  +  G
Sbjct:   24 IDVRVPEQYQQEHVQGAINIPLKEVKERIATA------------VPDKNDTVKVYCNAGRQSGQAKEILSEMGYTHVENAGG 93          
BLAST of Rhodanese-like protein vs. TrEMBL
Match: A0A094ZZN0 (Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 (Fragment) OS=Schistosoma haematobium OX=6185 GN=MS3_08904 PE=4 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.763e-20
Identity = 47/107 (43.93%), Postives = 78/107 (72.90%), Query Frame = 2
Query:  131 ISVADLKAAIKTSELQVIDVRSPEEVKE-GKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSK 448
            I V  LK  +K+++L++IDVR P+E++E GKI  A+NIP+GE+++AF+L  + F +K+++ KP    +N++ +C  G RS +AL+++ ++GY N  +L GGY AWSK
Sbjct:   42 IDVKRLKEMMKSNDLKLIDVREPDELEEAGKIPFAVNIPLGEVEDAFKLDEKSFIEKYKIHKPNVADKNVVFSCRSGVRSMRALKIVQDLGYENPLNLVGGYNAWSK 148          
BLAST of Rhodanese-like protein vs. TrEMBL
Match: G4VPN9 (Rhodanese domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_007450.2 PE=4 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 7.299e-20
Identity = 45/107 (42.06%), Postives = 76/107 (71.03%), Query Frame = 2
Query:  131 ISVADLKAAIKTSELQVIDVRSPEEVKE-GKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSK 448
            I V  LK  +K+ +L++IDVR P+E+++ GKI  A+NIP+GE+++AF+L  + F +K++  KP    +N++ +C  G RS +AL+++ ++GY N  +L GGY AW+K
Sbjct:   49 IDVKRLKEMMKSKDLKLIDVREPDELEQTGKIPYAVNIPLGEVEDAFKLDEKSFLEKYKFQKPNVADKNVVFSCRSGVRSMRALKIVQDLGYENPLNLVGGYNAWAK 155          
BLAST of Rhodanese-like protein vs. TrEMBL
Match: G4VPP0 (Rhodanese domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_007450.1 PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 9.290e-20
Identity = 45/107 (42.06%), Postives = 76/107 (71.03%), Query Frame = 2
Query:  131 ISVADLKAAIKTSELQVIDVRSPEEVKE-GKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSK 448
            I V  LK  +K+ +L++IDVR P+E+++ GKI  A+NIP+GE+++AF+L  + F +K++  KP    +N++ +C  G RS +AL+++ ++GY N  +L GGY AW+K
Sbjct:   42 IDVKRLKEMMKSKDLKLIDVREPDELEQTGKIPYAVNIPLGEVEDAFKLDEKSFLEKYKFQKPNVADKNVVFSCRSGVRSMRALKIVQDLGYENPLNLVGGYNAWAK 148          
BLAST of Rhodanese-like protein vs. TrEMBL
Match: A0A183R9S2 (Rhodanese domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.388e-19
Identity = 45/107 (42.06%), Postives = 76/107 (71.03%), Query Frame = 2
Query:  131 ISVADLKAAIKTSELQVIDVRSPEEVKE-GKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSK 448
            I V  LK  +K+ +L++IDVR P+E+++ GKI  A+NIP+GE+++AF+L  + F +K+ + KP    +N++ +C  G RS +AL+++ ++GY N  +L GGY AW+K
Sbjct:   49 IDVERLKEMMKSKDLKLIDVREPDELEQTGKIPYAVNIPLGEVEDAFKLDEKSFLEKYNIKKPNVADKNVVFSCRSGVRSMRALKIVQDLGYENPLNLVGGYNAWAK 155          
BLAST of Rhodanese-like protein vs. TrEMBL
Match: E6ZIT9 (Thiosulfate sulfurtransferase KAT OS=Dicentrarchus labrax OX=13489 GN=KAT PE=4 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 5.148e-19
Identity = 47/126 (37.30%), Postives = 81/126 (64.29%), Query Frame = 2
Query:   71 FMAATVECHGKLDDVATTHAISVADLKAAIKTSELQVIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSK 448
            F  ++ +C G+  D A+   ++ + LK+ +    +Q+ DVR+P+E + G+I  A+NIP+G ++E+ +LS E+F+ KFE+  P K   NI+ +C  G RS KAL + H++G++  RH  GGY  W++
Sbjct:   32 FTTSSPKC-GETSDSASV--VTYSQLKSMLSNRNIQLFDVRNPDEYQAGRIADAVNIPLGSLEESLKLSPEQFQLKFEVRAPGKDDENIVFHCKSGNRSSKALDIAHQLGFSRARHYKGGYSEWAE 154          
BLAST of Rhodanese-like protein vs. Ensembl Cavefish
Match: si:ch211-161h7.8 (thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 1 [Source:NCBI gene;Acc:103025070])

HSP 1 Score: 74.7146 bits (182), Expect = 5.384e-17
Identity = 47/154 (30.52%), Postives = 83/154 (53.90%), Query Frame = 2
Query:   32 TLIYNLIKINIIFFMAATVECHGKL---------------DDVATTHAISVADLKAAIKTSELQVIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSK 448
            T+   L +I+       +V CHG L               D     + ++   LKA + +  +Q+ D+R+ +E + G I G++NIP+ +++E+ +LS++ FEK F++  P+K   NI+ +C  G RS  AL +   +G++  RH AGGY  W++
Sbjct:    2 TVFPALRRISAAIKPVFSVYCHGGLASVRGLRTSAVSFNPDPSNPDYVVTREQLKAMLASHSVQLFDIRNRDEFQAGHIAGSVNIPLDQLEESLKLSSKTFEKCFKVKAPKKEDDNIVFHCQRGRRSLTALDIAWRLGFSRARHYAGGYSEWAE 155          
BLAST of Rhodanese-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000037356.1 (thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 [Source:NCBI gene;Acc:103030362])

HSP 1 Score: 69.3218 bits (168), Expect = 7.636e-15
Identity = 40/107 (37.38%), Postives = 60/107 (56.07%), Query Frame = 2
Query:  131 ISVADLKAAIKTSELQVIDVRSPEEVKE-GKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSK 448
            I+  +LK  +      VIDVR P E++E G I  AIN+P+G++  A +L   E  K+        T+ N++  CL G RS KAL+    +GY+N +H  GG+  W+K
Sbjct:   62 ITYEELKKLLVAKSGVVIDVREPWELREYGNIPSAINVPLGQVTSALQL-EPEEFKEKYGGDMPSTTENVVFTCLAGMRSIKALQAATSLGYSNAQHYLGGWQDWAK 167          
BLAST of Rhodanese-like protein vs. Ensembl Cavefish
Match: si:dkey-34l15.1 (thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 1 [Source:NCBI gene;Acc:103030441])

HSP 1 Score: 59.3066 bits (142), Expect = 2.035e-11
Identity = 36/113 (31.86%), Postives = 65/113 (57.52%), Query Frame = 2
Query:  113 VATTHAISVADLKAAI-KTSELQVIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSK 448
            +A +  IS +DLK+ + +   L ++DVR+ +EV +G+I G+I+IP+ +++    L  + F+ KF + KP   + N++ +C  G R   A      +G+ N R+  G Y  WS+
Sbjct:   19 MANSGVISYSDLKSLVGRDKGLVLVDVRNKDEVDKGRIPGSIHIPLSDVERDLSLDPDAFQTKFGVAKPPLDTPNLVFHCQLGRRGQAATDKAKSLGFENARNYVGAYKEWSE 131          
BLAST of Rhodanese-like protein vs. Ensembl Cavefish
Match: si:dkey-34l15.1 (thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 1 [Source:NCBI gene;Acc:103030441])

HSP 1 Score: 46.2098 bits (108), Expect = 1.167e-6
Identity = 30/101 (29.70%), Postives = 58/101 (57.43%), Query Frame = 2
Query:  113 VATTHAISVADLKAAI-KTSELQVIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNF 412
            +A +  IS +DLK+ + +   L ++DVR+ +EV +G+I G+I+IP+ +++    L  + F+ KF + KP   + N++ +C  G R   A      +G+  +
Sbjct:   19 MANSGVISYSDLKSLVGRDKGLVLVDVRNKDEVDKGRIPGSIHIPLSDVERDLSLDPDAFQTKFGVAKPPLDTPNLVFHCQLGRRGQAATDKAKSLGFEKY 119          
BLAST of Rhodanese-like protein vs. Ensembl Sea Lamprey
Match: si:ch211-161h7.8 (si:ch211-161h7.8 [Source:ZFIN;Acc:ZDB-GENE-091204-302])

HSP 1 Score: 72.7886 bits (177), Expect = 1.651e-17
Identity = 39/108 (36.11%), Postives = 64/108 (59.26%), Query Frame = 2
Query:  128 AISVADLKAAIKTSELQVIDVRSPEEVKE-GKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSK 448
            ++   +LKA +  + + ++DVR P E+KE G IEG +N+P+GE+ EA +LS  EF  ++       ++ N +  C  G RS +AL +  ++GYT  RH  GG+  W +
Sbjct:    1 SVPYEELKALLAAAAVWLVDVREPSELKENGAIEGCVNVPLGELGEALQLSPREFRARYGSDLVGPSAPNTVFLCRAGRRSKEALLIAQKLGYTRARHYGGGWLDWER 108          
BLAST of Rhodanese-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006076.1 (pep scaffold:Pmarinus_7.0:GL476493:725894:734457:1 gene:ENSPMAG00000005492.1 transcript:ENSPMAT00000006076.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.1738 bits (178), Expect = 2.072e-17
Identity = 40/109 (36.70%), Postives = 57/109 (52.29%), Query Frame = 2
Query:  116 ATTHAISVADLKAAIKTSELQVIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAW 442
            + T+ +S  +LK  ++  ++ V DVR P E +EG I  AINIP+G+I EAF + +    K            NI++ C  G R   AL  L  +GYT  R+  GGY  W
Sbjct:   23 SQTNKVSYEELKRLLQNRDVSVFDVREPCETEEGMIPSAINIPVGKINEAF-IRDSGTFKGLYGVDMPHKEDNIVVYCRSGMRGQTALYSLRRLGYTKSRNYTGGYTEW 130          
BLAST of Rhodanese-like protein vs. Ensembl Yeast
Match: RDL1 (Thiosulfate sulfurtransferase; contains a rhodanese-like domain; localized to the mitochondrial outer membrane; protein abundance increases in response to DNA replication stress; similar to the human TSTD gene [Source:SGD;Acc:S000005811])

HSP 1 Score: 44.2838 bits (103), Expect = 9.612e-7
Identity = 29/113 (25.66%), Postives = 49/113 (43.36%), Query Frame = 2
Query:  110 DVATTHAISVADLKAAIKTSELQVI--DVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAW 442
            +V+   + S  D+K  +   +  V+  DVR P E     I  +IN+P     +AF L +    +K        +++ +I  C  G R G+A ++    GY+N     G    W
Sbjct:   18 NVSNIQSYSFEDMKRIVGKHDPNVVLVDVREPSEYSIVHIPASINVPYRSHPDAFAL-DPLEFEKQIGIPKPDSAKELIFYCASGKRGGEAQKVASSHGYSNTSLYPGSMNDW 129          
BLAST of Rhodanese-like protein vs. Ensembl Nematostella
Match: EDO26397 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TC43])

HSP 1 Score: 70.4774 bits (171), Expect = 2.898e-16
Identity = 39/105 (37.14%), Postives = 64/105 (60.95%), Query Frame = 2
Query:  131 ISVADLKAAIKTSELQVIDVRSPEEVKE-GKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAW 442
            +S+ +L+  IK   +Q+ DVR P E++E GKI  +INIP  ++ EAF +  +EF+ K+   KP++   +I+ +C  G RS  AL+ +  MG+   +H  GG+  W
Sbjct:    1 MSIEELQLLIKQQAIQLFDVREPYELEESGKIPFSINIPCEQVPEAFTMKPKEFKLKYGAKKPKRKDTDIVFHCKAGIRSKTALKAVRSMGFRKAKHYPGGFDEW 105          
BLAST of Rhodanese-like protein vs. Ensembl Nematostella
Match: EDO34076 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQG5])

HSP 1 Score: 72.0182 bits (175), Expect = 6.441e-16
Identity = 39/105 (37.14%), Postives = 65/105 (61.90%), Query Frame = 2
Query:  131 ISVADLKAAIKTSELQVIDVRSPEEVKE-GKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAW 442
            +S+ +L+  IK   +Q+ DVR P E++E GKI  +INIP+ ++ EAF +  +EF+ K+   KP++   +I+ +C  G RS  AL+ +  MG+   +H  GG+  W
Sbjct:  105 VSIEELQLLIKQQAIQLFDVREPYELEESGKIPFSINIPLRQVPEAFTMKPKEFKLKYGAKKPKRKDTDIVFHCKAGIRSKTALKAVRSMGFRKAKHYPGGFDEW 209          
BLAST of Rhodanese-like protein vs. Ensembl Nematostella
Match: EDO29885 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2D3])

HSP 1 Score: 67.3958 bits (163), Expect = 3.981e-15
Identity = 38/108 (35.19%), Postives = 65/108 (60.19%), Query Frame = 2
Query:  131 ISVADLKAAIKTSELQVIDVRSPEEVKE-GKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSKG 451
            +++  LK  +  +++Q+ DVR+PEE+ E G+I GA+NIP+ +I  AF L    FE+ +++P P KT  NI+ +C  G R+  A+  L  +G+    +  GG+  W + 
Sbjct:    1 MTLTCLKELLSKADIQLFDVRNPEELLETGQIPGAVNIPLSDITAAFSLPPAIFEQIYDVPMPSKTDNNIVFHCRTGVRAQNAIDTLKNLGFKGTHNYTGGWVEWQEA 108          
BLAST of Rhodanese-like protein vs. Ensembl Nematostella
Match: EDO34075 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQG4])

HSP 1 Score: 66.6254 bits (161), Expect = 2.622e-14
Identity = 38/108 (35.19%), Postives = 65/108 (60.19%), Query Frame = 2
Query:  131 ISVADLKAAIKTSELQVIDVRSPEEVKE-GKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSKG 451
            +++  LK  +  +++Q+ DVR+PEE+ E G+I GA+NIP+ +I  AF L    FE+ +++P P KT  NI+ +C  G R+  A+  L  +G+    +  GG+  W + 
Sbjct:   61 VTLTCLKELLSKADIQLFDVRNPEELLETGQIPGAVNIPLSDITAAFMLPPAIFEQIYDVPMPSKTDNNIVFHCKTGVRAQNAIDTLKNLGFKGTHNYTGGWVEWQEA 168          
BLAST of Rhodanese-like protein vs. Ensembl Nematostella
Match: EDO34074 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQG3])

HSP 1 Score: 64.3142 bits (155), Expect = 2.865e-14
Identity = 37/88 (42.05%), Postives = 56/88 (63.64%), Query Frame = 2
Query:  146 LKAAIKTSELQVIDVRSPEEVKE-GKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYT 406
            +K  +   ++Q+ DVR PEE+ E G+I GA+NIP+ +I  AF L    FE+ +++P P KT  NI+ +C  G RS +A+  L  +GYT
Sbjct:    1 MKELLSKEDIQLFDVRDPEELLETGQIPGAVNIPLSDITSAFSLPPNIFEQIYDVPMPSKTDNNIVFHCRTGRRSQQAIDTLQNIGYT 88          
BLAST of Rhodanese-like protein vs. Ensembl Medaka
Match: si:ch211-161h7.8 (thiosulfate:glutathione sulfurtransferase [Source:NCBI gene;Acc:101163444])

HSP 1 Score: 81.6481 bits (200), Expect = 1.651e-19
Identity = 46/127 (36.22%), Postives = 78/127 (61.42%), Query Frame = 2
Query:   71 FMAATVE-CHGKLDDVATTHAISVADLKAAIKTSELQVIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSK 448
            F AAT   C G+  +      ++ + LK  +   ++Q+ DVR P+E +EG+I  A+N+P+G ++E+ +L ++ FE++F++  PEK   NI+ +C  G RS +AL + H++G+   RH  GGY  W K
Sbjct:   45 FTAATPSSCGGEKKENDQAFVVTHSQLKTMLTNRDIQLFDVRDPDEHQEGRIPQAVNLPLGVLEESLKLPSDHFEQRFKVKAPEKEDANIVFHCRTGKRSFQALGIAHQLGFHKARHYKGGYVEWVK 171          
BLAST of Rhodanese-like protein vs. Ensembl Medaka
Match: ENSORLT00000003636.2 (thiosulfate:glutathione sulfurtransferase [Source:NCBI gene;Acc:101160420])

HSP 1 Score: 70.4774 bits (171), Expect = 8.613e-16
Identity = 44/107 (41.12%), Postives = 68/107 (63.55%), Query Frame = 2
Query:  131 ISVADLKAAIKTSE-LQVIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSK 448
            IS  DL+  +K ++ L ++DVRS  EV  G I G+INIP+  ++ AF+L  E+F+ K+   KPEK S++++ +C  G R   A +   ++GY+  R+ AGGY  WSK
Sbjct:    9 ISYEDLQVLLKENQNLVLVDVRSKGEVDNGHIPGSINIPLDTVESAFKLPPEDFKSKYGKTKPEKDSQDLVFHCQMGRRGETATKQARQLGYSKARNYAGGYMEWSK 115          
BLAST of Rhodanese-like protein vs. Ensembl Medaka
Match: ENSORLT00000037448.1 (thiosulfate:glutathione sulfurtransferase [Source:NCBI gene;Acc:101160420])

HSP 1 Score: 70.0922 bits (170), Expect = 9.028e-16
Identity = 44/107 (41.12%), Postives = 68/107 (63.55%), Query Frame = 2
Query:  131 ISVADLKAAIKTSE-LQVIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSK 448
            IS  DL+  +K ++ L ++DVRS  EV  G I G+INIP+  ++ AF+L  E+F+ K+   KPEK S++++ +C  G R   A +   ++GY+  R+ AGGY  WSK
Sbjct:    4 ISYEDLQVLLKENQNLVLVDVRSKGEVDNGHIPGSINIPLDTVESAFKLPPEDFKSKYGKTKPEKDSQDLVFHCQMGRRGETATKQARQLGYSKARNYAGGYMEWSK 110          
BLAST of Rhodanese-like protein vs. Ensembl Medaka
Match: ENSORLT00000029861.1 (thiosulfate:glutathione sulfurtransferase [Source:NCBI gene;Acc:101160420])

HSP 1 Score: 70.0922 bits (170), Expect = 9.028e-16
Identity = 44/107 (41.12%), Postives = 68/107 (63.55%), Query Frame = 2
Query:  131 ISVADLKAAIKTSE-LQVIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSK 448
            IS  DL+  +K ++ L ++DVRS  EV  G I G+INIP+  ++ AF+L  E+F+ K+   KPEK S++++ +C  G R   A +   ++GY+  R+ AGGY  WSK
Sbjct:    4 ISYEDLQVLLKENQNLVLVDVRSKGEVDNGHIPGSINIPLDTVESAFKLPPEDFKSKYGKTKPEKDSQDLVFHCQMGRRGETATKQARQLGYSKARNYAGGYMEWSK 110          
BLAST of Rhodanese-like protein vs. Ensembl Medaka
Match: si:ch211-161h7.8 (thiosulfate:glutathione sulfurtransferase [Source:NCBI gene;Acc:101163444])

HSP 1 Score: 68.1662 bits (165), Expect = 3.525e-14
Identity = 42/119 (35.29%), Postives = 74/119 (62.18%), Query Frame = 2
Query:   71 FMAATVE-CHGKLDDVATTHAISVADLKAAIKTSELQVIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMG---YTNFR 415
            F AAT   C G+  +      ++ + LK  +   ++Q+ DVR P+E +EG+I  A+N+P+G ++E+ +L ++ FE++F++  PEK   NI+ +C  G RS +AL + H++G   Y NF+
Sbjct:   45 FTAATPSSCGGEKKENDQAFVVTHSQLKTMLTNRDIQLFDVRDPDEHQEGRIPQAVNLPLGVLEESLKLPSDHFEQRFKVKAPEKEDANIVFHCRTGKRSFQALGIAHQLGFHKYVNFK 163          
BLAST of Rhodanese-like protein vs. Planmine SMEST
Match: SMESG000030828.1 (SMESG000030828.1)

HSP 1 Score: 224.172 bits (570), Expect = 3.703e-76
Identity = 125/126 (99.21%), Postives = 125/126 (99.21%), Query Frame = 2
Query:   74 MAATVECHGKLDDVATTHAISVADLKAAIKTSELQVIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSKG 451
            MAATVECHGKLDDVATTHAISVADLKAAIKTSELQVIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNEEFEKKF MPKPEKTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSKG
Sbjct:    1 MAATVECHGKLDDVATTHAISVADLKAAIKTSELQVIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNEEFEKKFGMPKPEKTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWSKG 126          
BLAST of Rhodanese-like protein vs. Planmine SMEST
Match: SMESG000079774.1 (SMESG000079774.1)

HSP 1 Score: 84.7297 bits (208), Expect = 6.744e-21
Identity = 50/112 (44.64%), Postives = 73/112 (65.18%), Query Frame = 2
Query:  107 DDVATTHAISVADLKAAIKTSELQVIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAW 442
            D+V  T++++ A L   +   +  +IDVR   E +E KI G+INIP+ ++K AFEL  E+F K+F + KP+KT  N+IL+C  G RS   L++LHE+G+T  RHL GG   W
Sbjct:   44 DEVLKTYSVNSAQLHKIVLGEDPVIIDVREENEHRESKINGSINIPLSQLKAAFELPAEDFRKRFGVEKPDKTDDNLILHCRKGIRSFDGLKILHELGFTRSRHLDGGINDW 155          
BLAST of Rhodanese-like protein vs. Planmine SMEST
Match: SMESG000079781.1 (SMESG000079781.1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.316e-18
Identity = 54/134 (40.30%), Postives = 75/134 (55.97%), Query Frame = 2
Query:   53 KINIIFFMAATVECHGKLDDVAT----THAISVADLKAAIKTSELQVIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAW 442
            K+NI+F        H    +++T     + I+ + L   +      +IDVR   E  +G IEGA+NIP+  +K++F LS   F  KF + KP K S NIIL C  G RS  ALR+LH++GYT+ RHL GG   W
Sbjct:   29 KLNILF--------HKDYSNISTEILQMNTINSSTLHHILLNENPILIDVREISEFNQGNIEGALNIPLSRVKKSFNLSEINFLNKFSLTKPVKNS-NIILYCRSGRRSLDALRILHKLGYTDSRHLEGGILDW 153          
BLAST of Rhodanese-like protein vs. Planmine SMEST
Match: SMESG000079781.1 (SMESG000079781.1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.386e-18
Identity = 54/134 (40.30%), Postives = 75/134 (55.97%), Query Frame = 2
Query:   53 KINIIFFMAATVECHGKLDDVAT----THAISVADLKAAIKTSELQVIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAW 442
            K+NI+F        H    +++T     + I+ + L   +      +IDVR   E  +G IEGA+NIP+  +K++F LS   F  KF + KP K S NIIL C  G RS  ALR+LH++GYT+ RHL GG   W
Sbjct:   28 KLNILF--------HKDYSNISTEILQMNTINSSTLHHILLNENPILIDVREISEFNQGNIEGALNIPLSRVKKSFNLSEINFLNKFSLTKPVKNS-NIILYCRSGRRSLDALRILHKLGYTDSRHLEGGILDW 152          
BLAST of Rhodanese-like protein vs. Planmine SMEST
Match: SMESG000079774.1 (SMESG000079774.1)

HSP 1 Score: 65.855 bits (159), Expect = 5.985e-14
Identity = 39/112 (34.82%), Postives = 57/112 (50.89%), Query Frame = 2
Query:  107 DDVATTHAISVADLKAAIKTSELQVIDVRSPEEVKEGKIEGAINIPIGEIKEAFELSNXXXXXXXXXXXXXXTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAW 442
            D+V  T++++ A L   +   +  +IDVR   E +E KI G+INIP+ ++K AFEL  E+                       G RS   L++LHE+G+T  RHL GG   W
Sbjct:   44 DEVLKTYSVNSAQLHKIVLGEDPVIIDVREENEHRESKINGSINIPLSQLKAAFELPAED------------------FRKRKGIRSFDGLKILHELGFTRSRHLDGGINDW 137          
The following BLAST results are available for this feature:
BLAST of Rhodanese-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
TSTD12.666e-1330.91thiosulfate sulfurtransferase like domain containi... [more]
TSTD13.381e-1330.28thiosulfate sulfurtransferase like domain containi... [more]
TSTD19.984e-1029.00thiosulfate sulfurtransferase like domain containi... [more]
back to top
BLAST of Rhodanese-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rhodanese-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG60003.979e-736.26gene:FBgn0039145 transcript:FBtr0334920[more]
CG60003.979e-736.26gene:FBgn0039145 transcript:FBtr0343101[more]
CG44564.044e-635.11gene:FBgn0001228 transcript:FBtr0100655[more]
CG44564.044e-635.11gene:FBgn0001228 transcript:FBtr0303474[more]
CG44564.044e-635.11gene:FBgn0001228 transcript:FBtr0100653[more]
back to top
BLAST of Rhodanese-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CABZ01058650.14.068e-1738.32thiosulfate sulfurtransferase/rhodanese-like domai... [more]
si:ch211-161h7.84.320e-1731.21si:ch211-161h7.8 [Source:ZFIN;Acc:ZDB-GENE-091204-... [more]
si:dkey-165n16.11.058e-1435.51si:dkey-165n16.1 [Source:ZFIN;Acc:ZDB-GENE-100922-... [more]
BX537102.22.053e-1135.14si:dkey-34l15.1 [Source:NCBI gene;Acc:563265][more]
TSTD12.428e-1133.33si:dkey-34l15.1 [Source:ZFIN;Acc:ZDB-GENE-081107-6... [more]
back to top
BLAST of Rhodanese-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000042802.18.464e-1440.00thiosulfate sulfurtransferase (rhodanese)-like dom... [more]
back to top
BLAST of Rhodanese-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tstd14.137e-1533.64thiosulfate sulfurtransferase (rhodanese)-like dom... [more]
Tstd34.478e-1431.82thiosulfate sulfurtransferase (rhodanese)-like dom... [more]
back to top
BLAST of Rhodanese-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9D0B5|TSTD3_MOUSE3.132e-1331.82Thiosulfate sulfurtransferase/rhodanese-like domai... [more]
sp|Q8NFU3|TSTD1_HUMAN1.280e-1230.91Thiosulfate:glutathione sulfurtransferase OS=Homo ... [more]
sp|Q10215|RDL_SCHPO1.158e-1141.57Putative thiosulfate sulfurtransferase, mitochondr... [more]
sp|Q39129|STR16_ARATH2.283e-935.16Thiosulfate sulfurtransferase 16, chloroplastic OS... [more]
sp|P23857|PSPE_ECOLI3.597e-732.93Thiosulfate sulfurtransferase PspE OS=Escherichia ... [more]
back to top
BLAST of Rhodanese-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A094ZZN01.763e-2043.93Thiosulfate sulfurtransferase/rhodanese-like domai... [more]
G4VPN97.299e-2042.06Rhodanese domain-containing protein OS=Schistosoma... [more]
G4VPP09.290e-2042.06Rhodanese domain-containing protein OS=Schistosoma... [more]
A0A183R9S21.388e-1942.06Rhodanese domain-containing protein OS=Schistosoma... [more]
E6ZIT95.148e-1937.30Thiosulfate sulfurtransferase KAT OS=Dicentrarchus... [more]
back to top
BLAST of Rhodanese-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
si:ch211-161h7.85.384e-1730.52thiosulfate sulfurtransferase/rhodanese-like domai... [more]
ENSAMXT00000037356.17.636e-1537.38thiosulfate sulfurtransferase/rhodanese-like domai... [more]
si:dkey-34l15.12.035e-1131.86thiosulfate sulfurtransferase/rhodanese-like domai... [more]
si:dkey-34l15.11.167e-629.70thiosulfate sulfurtransferase/rhodanese-like domai... [more]
back to top
BLAST of Rhodanese-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch211-161h7.81.651e-1736.11si:ch211-161h7.8 [Source:ZFIN;Acc:ZDB-GENE-091204-... [more]
ENSPMAT00000006076.12.072e-1736.70pep scaffold:Pmarinus_7.0:GL476493:725894:734457:1... [more]
back to top
BLAST of Rhodanese-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RDL19.612e-725.66Thiosulfate sulfurtransferase; contains a rhodanes... [more]
back to top
BLAST of Rhodanese-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO263972.898e-1637.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340766.441e-1637.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO298853.981e-1535.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340752.622e-1435.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340742.865e-1442.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Rhodanese-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-161h7.81.651e-1936.22thiosulfate:glutathione sulfurtransferase [Source:... [more]
ENSORLT00000003636.28.613e-1641.12thiosulfate:glutathione sulfurtransferase [Source:... [more]
ENSORLT00000037448.19.028e-1641.12thiosulfate:glutathione sulfurtransferase [Source:... [more]
ENSORLT00000029861.19.028e-1641.12thiosulfate:glutathione sulfurtransferase [Source:... [more]
si:ch211-161h7.83.525e-1435.29thiosulfate:glutathione sulfurtransferase [Source:... [more]
back to top
BLAST of Rhodanese-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030828.13.703e-7699.21SMESG000030828.1[more]
SMESG000079774.16.744e-2144.64SMESG000079774.1[more]
SMESG000079781.11.316e-1840.30SMESG000079781.1[more]
SMESG000079781.11.386e-1840.30SMESG000079781.1[more]
SMESG000079774.15.985e-1434.82SMESG000079774.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008157 ID=SMED30008157|Name=Rhodanese-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=539bp
AATTATTTACTAAAAACTACAATTGATTTAGACTTTGATTTATAATTTGA
TCAAGATAAATATAATTTTTTTTATGGCTGCAACTGTTGAATGTCATGGT
AAACTTGATGATGTCGCCACAACACATGCGATTTCAGTGGCTGATTTGAA
AGCTGCTATTAAAACTTCGGAATTACAAGTCATCGACGTTCGGAGTCCTG
AGGAAGTAAAAGAGGGTAAAATTGAAGGAGCCATCAATATTCCAATTGGG
GAAATTAAAGAAGCTTTTGAACTGAGCAATGAGGAATTTGAGAAAAAGTT
TGAAATGCCGAAGCCTGAGAAAACCAGTCGAAACATCATATTAAATTGTT
TAGGAGGAGGACGAAGCGGCAAAGCTCTACGTTTGCTCCATGAAATGGGA
TATACAAATTTTCGTCATCTTGCCGGGGGTTATGGAGCCTGGAGCAAGGG
CTAACCACGATTTCATGTAGTTGCAACCTTTTCTAGTTTATATTATCACA
TCACTTAGTTTTTAATAAATATTACTAGTTGAAAAAAAA
back to top

protein sequence of SMED30008157-orf-1

>SMED30008157-orf-1 ID=SMED30008157-orf-1|Name=SMED30008157-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=127bp
MAATVECHGKLDDVATTHAISVADLKAAIKTSELQVIDVRSPEEVKEGKI
EGAINIPIGEIKEAFELSNEEFEKKFEMPKPEKTSRNIILNCLGGGRSGK
ALRLLHEMGYTNFRHLAGGYGAWSKG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000020protonephridia
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002032epidermal cell
PLANA:0002056medial muscle cell
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR036873Rhodanese-like_dom_sf
IPR001763Rhodanese-like_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001763Rhodanese-like domainSMARTSM00450rhod_4coord: 20..125
e-value: 4.9E-16
score: 69.3
IPR001763Rhodanese-like domainPFAMPF00581Rhodanesecoord: 22..124
e-value: 3.3E-15
score: 56.5
IPR001763Rhodanese-like domainPROSITEPS50206RHODANESE_3coord: 30..125
score: 19.062
IPR036873Rhodanese-like domain superfamilyGENE3DG3DSA:3.40.250.10coord: 16..126
e-value: 4.1E-29
score: 103.0
IPR036873Rhodanese-like domain superfamilySUPERFAMILYSSF52821Rhodanese/Cell cycle control phosphatasecoord: 16..125
NoneNo IPR availablePANTHERPTHR44086FAMILY NOT NAMEDcoord: 13..125