SMED30008147

Overview
NameSMED30008147
Smed IDSMED30008147
Length (bp)3774
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30008147 (SMED30008147) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30008147 (SMED30008147) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008147

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30008147SMESG000053405.1 Contig1766newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30008147SMESG000053405.1 Contig1766uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30008147SMESG000053405.1 Contig1766newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30008147SMESG000053405.1 Contig1766uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30008147SMESG000053405.1 Contig1766newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008147SMESG000053405.1 Contig1766uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30008147SMESG000046314.1 SMESG000028362.1 Contig1766newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30008147SMESG000046314.1 SMESG000028362.1 Contig1766uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30008147SMESG000046314.1 SMESG000028362.1 Contig1766newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30008147SMESG000046314.1 SMESG000028362.1 Contig1766uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30008147SMESG000046314.1 SMESG000028362.1 Contig1766newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008147SMESG000046314.1 SMESG000028362.1 Contig1766uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pigment cellSMED30008147 SmedASXL_070953SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30008147SMESG000053405.1 dd_Smed_v4_3318_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008147SMESG000053405.1 dd_Smed_v6_3318_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30008147 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.008514:1122..8119 -17762
v31.008330:22441..29629 +17700
Homology
BLAST of SMED30008147 vs. TrEMBL
Match: A0A5N4AX15 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_04065 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 4.368e-42
Identity = 53/141 (37.59%), Postives = 85/141 (60.28%), Query Frame = -1
Query:   25 IYQKIQEHGFQQRYQEDDDFLIKMRIVTALAFILPLDVIAAFEGFSDEH--SAEAQPGVDFFNDIFIGKPQ-RRG*HLLLFGNDCWIIHQRSQDELCKTNNSVEGRHRSFQFKVGFNHPDFSSFLDCIRDEQGLQKINLTQ 438
            I++ IQ +G +Q+Y+ D DF +K++++ ALAF+ P  VI +FE   D      EAQ  +D+F D +IG+P  RR      F  + W  ++ +     KTNN+VEG H +F+ +V  NHP+   F+DC++ EQ L ++ + Q
Sbjct:  683 IFRSIQNNGLKQQYETDADFALKLKMIPALAFVPPGCVIESFEELCDGQIVPPEAQCILDYFEDTWIGRPSTRRQRKPPQFAINIWNCYEAALQGASKTNNAVEGWHYAFEHQVSANHPNIWKFIDCLKREQSLHELQIEQ 823          

HSP 2 Score: 72.4034 bits (176), Expect = 4.368e-42
Identity = 38/93 (40.86%), Postives = 60/93 (64.52%), Query Frame = -2
Query:  744 AEETKETPLKIITQSVLTIGRHATAKLPTVPHLKRDLRRTRQR-ENNPITVQFSAKDLVLPDQYKTTTDGQDFLLINSGQSVNRILIFGTQKN 1019
            A  +++TP  I++       R     LPTV  +KR +R+ RQR ++ P TV  + +DLV+PD Y+ T+ G+DFLL +SG + +R+LIF T++N
Sbjct:  488 ATSSRDTPQYIVSSVSQECPRSVAPHLPTVDAMKRTIRKIRQRNDDGPATVH-NRQDLVIPDDYQKTSTGEDFLLYDSGPNEDRMLIFTTRRN 579          

HSP 3 Score: 49.2914 bits (116), Expect = 4.368e-42
Identity = 23/79 (29.11%), Postives = 44/79 (55.70%), Query Frame = -3
Query:  446 IFFQLYMIHVPIIERTITCVYVRLSNKSGVTYTELFQQLMTIIGNLNPVSIIVDFEQAMISNVHQVLCNTVIKRCFSQF 682
            +F+QL  +H    + +I  +Y  L +KS   Y++  QQ++ +  ++ P  + +DFE+A+I+   +   N  I+ CF  F
Sbjct:  601 LFYQLLTVHGLKEKASIPLIYALLPSKSTECYSKFMQQIVELQPDVRPHRVTIDFEKALINGFQRQFPNPTIQGCFFHF 679          
BLAST of SMED30008147 vs. TrEMBL
Match: A0A5N3ZZ62 (Uncharacterized protein (Fragment) OS=Photinus pyralis OX=7054 GN=PPYR_15285 PE=4 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.863e-39
Identity = 52/140 (37.14%), Postives = 86/140 (61.43%), Query Frame = -1
Query:   25 IYQKIQEHGFQQRYQEDDDFLIKMRIVTALAFILPLDVIAAFEGFSDEH--SAEAQPGVDFFNDIFIGKPQRRG*HLLLFGNDCWIIHQRSQDELCKTNNSVEGRHRSFQFKVGFNHPDFSSFLDCIRDEQGLQKINLTQ 438
            I++ IQE+G ++ Y+ + +  + ++++ ALAF+ P DVI AFE   +++  S E Q  VD+F D +IG+PQRRG     F  + W      Q  L KTNN+VEG HR+FQ ++  +HP+   F+  ++ EQ + ++ + Q
Sbjct:  281 IFRHIQENGLKREYERNPEVALTLKLLPALAFVPPQDVIPAFEDICEQNIFSPELQVIVDYFEDTWIGRPQRRGRRPPHFAINMWNCFDAVQHGLPKTNNAVEGWHRAFQMQLCADHPNIWKFISALKREQSINELRIEQ 420          

HSP 2 Score: 82.8037 bits (203), Expect = 1.863e-39
Identity = 43/112 (38.39%), Postives = 67/112 (59.82%), Query Frame = -2
Query:  744 HGPDPTRREVLTTMQSMKIRAEETKETPLKIITQSVLTIGRHATAKLPTVPHLKRDLRRTRQRENNPITVQFSAKDLVLPDQYKTTTDGQDFLLINSGQSVNRILIFGTQKN 1079
            H  D  + E    MQ +K  AE T++TP  I++Q+   +G    AKLPTV ++KR +R  R REN    +    ++++ P+++  TT+G+ FLL +SG   +RILIF T +N
Sbjct:   64 HNADAAQLEANKVMQKIKEDAENTRDTPQFIVSQASAGLGNAVAAKLPTVNNIKRTIRNVRVRENVAPAIPRHREEIIFPEEFTITTNGELFLLHDSGPVNDRILIFSTARN 175          

HSP 3 Score: 44.669 bits (104), Expect = 1.863e-39
Identity = 25/83 (30.12%), Postives = 42/83 (50.60%), Query Frame = -3
Query:  455 EIASSIFFQLYMIHVPIIERTITCVYVRLSNKSGVTYTELFQQLMTII--GNLNPVSIIVDFEQAMISNVHQVLCNTVIKRCF 697
            ++   +F QLY IH       I  +Y  L NK+  TY  L +++  ++   +  P +I+ DFE AMI+ +      T+ + CF
Sbjct:  192 KVVPPLFLQLYTIHGIKDHVAIPLIYALLPNKTEQTYLNLLREIKNLLPADDAQPQTIMTDFEVAMINAIRIEFPQTIHRGCF 274          
BLAST of SMED30008147 vs. TrEMBL
Match: A0A1Y1KML9 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_00537 PE=4 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.120e-39
Identity = 52/140 (37.14%), Postives = 86/140 (61.43%), Query Frame = -1
Query:   25 IYQKIQEHGFQQRYQEDDDFLIKMRIVTALAFILPLDVIAAFEGFSDEH--SAEAQPGVDFFNDIFIGKPQRRG*HLLLFGNDCWIIHQRSQDELCKTNNSVEGRHRSFQFKVGFNHPDFSSFLDCIRDEQGLQKINLTQ 438
            I++ IQE+G ++ Y+ + +  + ++++ ALAF+ P DVI AFE   +++  S E Q  VD+F D +IG+PQRRG     F  + W      Q  L KTNN+VEG HR+FQ ++  +HP+   F+  ++ EQ + ++ + Q
Sbjct:  281 IFRHIQENGLKREYERNPEVALTLKLLPALAFVPPQDVIPAFEDICEQNIFSPELQVIVDYFEDTWIGRPQRRGRRPPHFAINMWNCFDAVQHGLPKTNNAVEGWHRAFQMQLCADHPNIWKFISALKREQSINELRIEQ 420          

HSP 2 Score: 82.8037 bits (203), Expect = 2.120e-39
Identity = 43/112 (38.39%), Postives = 67/112 (59.82%), Query Frame = -2
Query:  744 HGPDPTRREVLTTMQSMKIRAEETKETPLKIITQSVLTIGRHATAKLPTVPHLKRDLRRTRQRENNPITVQFSAKDLVLPDQYKTTTDGQDFLLINSGQSVNRILIFGTQKN 1079
            H  D  + E    MQ +K  AE T++TP  I++Q+   +G    AKLPTV ++KR +R  R REN    +    ++++ P+++  TT+G+ FLL +SG   +RILIF T +N
Sbjct:   64 HNADAAQLEANKVMQKIKEDAENTRDTPQFIVSQASAGLGNAVAAKLPTVNNIKRTIRNVRVRENVAPAIPRHREEIIFPEEFTITTNGELFLLHDSGPVNDRILIFSTARN 175          

HSP 3 Score: 44.669 bits (104), Expect = 2.120e-39
Identity = 25/83 (30.12%), Postives = 42/83 (50.60%), Query Frame = -3
Query:  455 EIASSIFFQLYMIHVPIIERTITCVYVRLSNKSGVTYTELFQQLMTII--GNLNPVSIIVDFEQAMISNVHQVLCNTVIKRCF 697
            ++   +F QLY IH       I  +Y  L NK+  TY  L +++  ++   +  P +I+ DFE AMI+ +      T+ + CF
Sbjct:  192 KVVPPLFLQLYTIHGIKDHVAIPLIYALLPNKTEQTYLNLLREIKNLLPADDAQPQTIMTDFEVAMINAIRIEFPQTIHRGCF 274          
BLAST of SMED30008147 vs. TrEMBL
Match: A0A5N4B4U0 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_01533 PE=4 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.155e-39
Identity = 52/140 (37.14%), Postives = 86/140 (61.43%), Query Frame = -1
Query:   25 IYQKIQEHGFQQRYQEDDDFLIKMRIVTALAFILPLDVIAAFEGFSDEH--SAEAQPGVDFFNDIFIGKPQRRG*HLLLFGNDCWIIHQRSQDELCKTNNSVEGRHRSFQFKVGFNHPDFSSFLDCIRDEQGLQKINLTQ 438
            I++ IQE+G ++ Y+ + +  + ++++ ALAF+ P DVI AFE   +++  S E Q  VD+F D +IG+PQRRG     F  + W      Q  L KTNN+VEG HR+FQ ++  +HP+   F+  ++ EQ + ++ + Q
Sbjct:  281 IFRHIQENGLKREYERNPEVALTLKLLPALAFVPPQDVIPAFEDICEQNIFSPELQVIVDYFEDTWIGRPQRRGRRPPHFAINMWNCFDAVQHGLPKTNNAVEGWHRAFQMQLCADHPNIWKFISALKREQSINELRIEQ 420          

HSP 2 Score: 82.8037 bits (203), Expect = 2.155e-39
Identity = 43/112 (38.39%), Postives = 67/112 (59.82%), Query Frame = -2
Query:  744 HGPDPTRREVLTTMQSMKIRAEETKETPLKIITQSVLTIGRHATAKLPTVPHLKRDLRRTRQRENNPITVQFSAKDLVLPDQYKTTTDGQDFLLINSGQSVNRILIFGTQKN 1079
            H  D  + E    MQ +K  AE T++TP  I++Q+   +G    AKLPTV ++KR +R  R REN    +    ++++ P+++  TT+G+ FLL +SG   +RILIF T +N
Sbjct:   64 HNADAAQLEANKVMQKIKEDAENTRDTPQFIVSQASAGLGNAVAAKLPTVNNIKRTIRNVRVRENVAPAIPRHREEIIFPEEFTITTNGELFLLHDSGPVNDRILIFSTARN 175          

HSP 3 Score: 44.669 bits (104), Expect = 2.155e-39
Identity = 25/83 (30.12%), Postives = 42/83 (50.60%), Query Frame = -3
Query:  455 EIASSIFFQLYMIHVPIIERTITCVYVRLSNKSGVTYTELFQQLMTII--GNLNPVSIIVDFEQAMISNVHQVLCNTVIKRCF 697
            ++   +F QLY IH       I  +Y  L NK+  TY  L +++  ++   +  P +I+ DFE AMI+ +      T+ + CF
Sbjct:  192 KVVPPLFLQLYTIHGIKDHVAIPLIYALLPNKTEQTYLNLLREIKNLLPADDAQPQTIMTDFEVAMINAIRIEFPQTIHRGCF 274          
BLAST of SMED30008147 vs. TrEMBL
Match: A0A5N4B5D8 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_01792 PE=4 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 3.412e-39
Identity = 52/140 (37.14%), Postives = 86/140 (61.43%), Query Frame = -1
Query:   25 IYQKIQEHGFQQRYQEDDDFLIKMRIVTALAFILPLDVIAAFEGFSDEH--SAEAQPGVDFFNDIFIGKPQRRG*HLLLFGNDCWIIHQRSQDELCKTNNSVEGRHRSFQFKVGFNHPDFSSFLDCIRDEQGLQKINLTQ 438
            I++ IQE+G ++ Y+ + +  + ++++ ALAF+ P DVI AFE   +++  S E Q  VD+F D +IG+PQRRG     F  + W      Q  L KTNN+VEG HR+FQ ++  +HP+   F+  ++ EQ + ++ + Q
Sbjct:  281 IFRHIQENGLKREYERNPEVALTLKLLPALAFVPPQDVIPAFEDICEQNIFSPELQVIVDYFEDTWIGRPQRRGRRPPHFAINMWNCFDAVQHGLPKTNNAVEGWHRAFQMQLCADHPNIWKFISALKREQSINELRIEQ 420          

HSP 2 Score: 82.0333 bits (201), Expect = 3.412e-39
Identity = 43/112 (38.39%), Postives = 66/112 (58.93%), Query Frame = -2
Query:  744 HGPDPTRREVLTTMQSMKIRAEETKETPLKIITQSVLTIGRHATAKLPTVPHLKRDLRRTRQRENNPITVQFSAKDLVLPDQYKTTTDGQDFLLINSGQSVNRILIFGTQKN 1079
            H  D  + E    MQ +K  AE T+ TP  I++Q+   +G    AKLPTV ++KR +R  R REN    +    ++++ P+++  TT+G+ FLL +SG   +RILIF T +N
Sbjct:   64 HNADAAQLEANKVMQKIKEDAENTRATPQFIVSQASAGLGNAVAAKLPTVNNIKRTIRNVRVRENVAPAIPRHREEIIFPEEFTITTNGELFLLHDSGPVNDRILIFSTARN 175          

HSP 3 Score: 44.669 bits (104), Expect = 3.412e-39
Identity = 25/83 (30.12%), Postives = 42/83 (50.60%), Query Frame = -3
Query:  455 EIASSIFFQLYMIHVPIIERTITCVYVRLSNKSGVTYTELFQQLMTII--GNLNPVSIIVDFEQAMISNVHQVLCNTVIKRCF 697
            ++   +F QLY IH       I  +Y  L NK+  TY  L +++  ++   +  P +I+ DFE AMI+ +      T+ + CF
Sbjct:  192 KVVPPLFLQLYTIHGIKDHVAIPLIYALLPNKTEQTYLNLLREIKNLLPADDAQPQTIMTDFEVAMINAIRIEFPQTIHRGCF 274          
BLAST of SMED30008147 vs. Planmine SMEST
Match: SMESG000014782.1 (SMESG000014782.1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.003e-35
Identity = 41/115 (35.65%), Postives = 71/115 (61.74%), Query Frame = -2
Query:  747 THGPDPTRREVLTTMQSMKIRAEETKETPLKIITQSVLTIGRHATAKLPTVPHLKRDLRRTRQREN--NPITVQFSAKDLVLPDQYKTTTDGQDFLLINSG-QSVNRILIFGTQK 1082
            TH  D    E+L    S+K +AEET+ETP +I+ Q +  + + A  ++  + H++ ++RR +Q++N  +P+ V    +   + ++YK  TDG+ FL+ +SG    NRILIFGT++
Sbjct:   75 THTADSVHCEILKVRASIKRKAEETEETPKQILGQELQQLSQQAAVQMVPIRHIRGNIRRVKQKKNAVHPVPVD---RTFEILEEYKCLTDGEKFLIFDSGCDDPNRILIFGTER 186          

HSP 2 Score: 58.151 bits (139), Expect = 1.003e-35
Identity = 28/88 (31.82%), Postives = 49/88 (55.68%), Query Frame = -3
Query:  434 EIASSIFFQLYMIHVPIIERTITCVYVRLSNKSGVTYTELFQQLMTIIGNLNPVSIIVDFEQAMISNVHQVLCNTVIKRCFSQFSPNI 697
            ++   +FFQLY +H  + E  +  ++V L NK+ +TY  LF+++      ++P +I  DFE+A I++  +   N  I  CF   + NI
Sbjct:  204 KVVPELFFQLYTVHTLVTESIVPYLFVLLPNKTQITYCLLFEEIKVRQPQVHPTTITTDFERAAINSATECFANVEIHGCFFHLAQNI 291          

HSP 3 Score: 56.6102 bits (135), Expect = 1.003e-35
Identity = 27/75 (36.00%), Postives = 44/75 (58.67%), Query Frame = -1
Query:  229 HNSVQIYQKIQEHGFQQRYQEDDDFLIKMRIVTALAFILPLDVIAAFEGFSDEHSAEAQPGVDFFNDIFIGKPQR 453
            H +  I++K+Q  G Q RYQ D+DF + ++ +  LAF+L  +VI +FE   +  S E    +D+F D +I +  R
Sbjct:  286 HLAQNIFRKVQSVGLQGRYQNDEDFALSIQKIAVLAFVLSENVIESFEKLQESLSEEFATVMDYFEDNYIARLHR 360          
BLAST of SMED30008147 vs. Planmine SMEST
Match: SMESG000014782.1 (SMESG000014782.1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.045e-35
Identity = 41/115 (35.65%), Postives = 71/115 (61.74%), Query Frame = -2
Query:  747 THGPDPTRREVLTTMQSMKIRAEETKETPLKIITQSVLTIGRHATAKLPTVPHLKRDLRRTRQREN--NPITVQFSAKDLVLPDQYKTTTDGQDFLLINSG-QSVNRILIFGTQK 1082
            TH  D    E+L    S+K +AEET+ETP +I+ Q +  + + A  ++  + H++ ++RR +Q++N  +P+ V    +   + ++YK  TDG+ FL+ +SG    NRILIFGT++
Sbjct:   73 THTADSVHCEILKVRASIKRKAEETEETPKQILGQELQQLSQQAAVQMVPIRHIRGNIRRVKQKKNAVHPVPVD---RTFEILEEYKCLTDGEKFLIFDSGCDDPNRILIFGTER 184          

HSP 2 Score: 58.151 bits (139), Expect = 1.045e-35
Identity = 28/88 (31.82%), Postives = 49/88 (55.68%), Query Frame = -3
Query:  434 EIASSIFFQLYMIHVPIIERTITCVYVRLSNKSGVTYTELFQQLMTIIGNLNPVSIIVDFEQAMISNVHQVLCNTVIKRCFSQFSPNI 697
            ++   +FFQLY +H  + E  +  ++V L NK+ +TY  LF+++      ++P +I  DFE+A I++  +   N  I  CF   + NI
Sbjct:  202 KVVPELFFQLYTVHTLVTESIVPYLFVLLPNKTQITYCLLFEEIKVRQPQVHPTTITTDFERAAINSATECFANVEIHGCFFHLAQNI 289          

HSP 3 Score: 56.6102 bits (135), Expect = 1.045e-35
Identity = 27/75 (36.00%), Postives = 44/75 (58.67%), Query Frame = -1
Query:  229 HNSVQIYQKIQEHGFQQRYQEDDDFLIKMRIVTALAFILPLDVIAAFEGFSDEHSAEAQPGVDFFNDIFIGKPQR 453
            H +  I++K+Q  G Q RYQ D+DF + ++ +  LAF+L  +VI +FE   +  S E    +D+F D +I +  R
Sbjct:  284 HLAQNIFRKVQSVGLQGRYQNDEDFALSIQKIAVLAFVLSENVIESFEKLQESLSEEFATVMDYFEDNYIARLHR 358          
BLAST of SMED30008147 vs. Planmine SMEST
Match: SMESG000053405.1 (SMESG000053405.1)

HSP 1 Score: 119.013 bits (297), Expect = 9.200e-28
Identity = 73/74 (98.65%), Postives = 74/74 (100.00%), Query Frame = 3
Query: 3552 FVIGSVLITKHVXXXXXXXXXXXXXXNIYEEINQAPEDSMYSNMVENQRNVIRSLANYQFHLRSNPNRETAVYS 3773
            FVIGSVLITKHVTKTKGKISTSISKINIYEEINQAPEDSMYSNMVENQRNVIRSLANYQFHLRSNPNR+TAVYS
Sbjct:  396 FVIGSVLITKHVTKTKGKISTSISKINIYEEINQAPEDSMYSNMVENQRNVIRSLANYQFHLRSNPNRDTAVYS 469          
BLAST of SMED30008147 vs. Planmine SMEST
Match: SMESG000053405.1 (SMESG000053405.1)

HSP 1 Score: 119.013 bits (297), Expect = 9.725e-28
Identity = 73/74 (98.65%), Postives = 74/74 (100.00%), Query Frame = 3
Query: 3552 FVIGSVLITKHVXXXXXXXXXXXXXXNIYEEINQAPEDSMYSNMVENQRNVIRSLANYQFHLRSNPNRETAVYS 3773
            FVIGSVLITKHVTKTKGKISTSISKINIYEEINQAPEDSMYSNMVENQRNVIRSLANYQFHLRSNPNR+TAVYS
Sbjct:  403 FVIGSVLITKHVTKTKGKISTSISKINIYEEINQAPEDSMYSNMVENQRNVIRSLANYQFHLRSNPNRDTAVYS 476          
BLAST of SMED30008147 vs. Planmine SMEST
Match: SMESG000070712.1 (SMESG000070712.1)

HSP 1 Score: 51.6026 bits (122), Expect = 4.482e-21
Identity = 26/72 (36.11%), Postives = 41/72 (56.94%), Query Frame = -1
Query:  238 HNSVQIYQKIQEHGFQQRYQEDDDFLIKMRIVTALAFILPLDVIAAFEGFSDEHSAEAQPGVDFFNDIFIGK 453
            HN+ +I++K Q  G Q RYQ D+DF + +R++ A AF     VI +FE      S E    +D+F + +I +
Sbjct:  165 HNAQKIFKKFQSVGLQDRYQNDEDFALSIRMIAASAFFPIEKVIESFETLQKSLSDEFATVMDYFEENYIKR 236          

HSP 2 Score: 47.3654 bits (111), Expect = 4.482e-21
Identity = 29/86 (33.72%), Postives = 48/86 (55.81%), Query Frame = -2
Query:  702 VPHLKRDLRRTRQRENN----PITVQFSAKDLVLPDQYKTTTDGQDFLLINSG-QSVNRILIFGTQKN----KTSCNVFKTGSLIV 932
            + H+ R++R  + ++N     P+   F      +P++YK+  DG++FLL  SG   ++RILIFGT++     K S N F  G+  V
Sbjct:    4 IRHIGRNIRIVKHQKNAVHTLPVDYTFR-----IPEEYKSLADGENFLLFGSGCDDLSRILIFGTERTLNLIKDSQNWFMDGTFKV 84          

HSP 3 Score: 43.1282 bits (100), Expect = 4.482e-21
Identity = 20/81 (24.69%), Postives = 40/81 (49.38%), Query Frame = -3
Query:  455 EIASSIFFQLYMIHVPIIERTITCVYVRLSNKSGVTYTELFQQLMTIIGNLNPVSIIVDFEQAMISNVHQVLCNTVIKRCF 697
            ++   +FFQLY +   +     + +    + K+ + Y  LF+++  +   ++P +I  DFE+A I+   +   N  I  CF
Sbjct:   83 KVVPELFFQLYTVKALVTGSNCSVLVFPPTKKTQIVYCRLFEEIKVLQPQVHPATITTDFERAAINAATECFANIKIHGCF 163          
The following BLAST results are available for this feature:
BLAST of SMED30008147 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008147 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008147 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008147 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008147 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008147 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008147 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008147 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5N4AX154.368e-4237.59Uncharacterized protein OS=Photinus pyralis OX=705... [more]
A0A5N3ZZ621.863e-3937.14Uncharacterized protein (Fragment) OS=Photinus pyr... [more]
A0A1Y1KML92.120e-3937.14Uncharacterized protein OS=Photinus pyralis OX=705... [more]
A0A5N4B4U02.155e-3937.14Uncharacterized protein OS=Photinus pyralis OX=705... [more]
A0A5N4B5D83.412e-3937.14Uncharacterized protein OS=Photinus pyralis OX=705... [more]
back to top
BLAST of SMED30008147 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008147 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008147 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008147 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008147 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008147 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014782.11.003e-3535.65SMESG000014782.1[more]
SMESG000014782.11.045e-3535.65SMESG000014782.1[more]
SMESG000053405.19.200e-2898.65SMESG000053405.1[more]
SMESG000053405.19.725e-2898.65SMESG000053405.1[more]
SMESG000070712.14.482e-2136.11SMESG000070712.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008147 ID=SMED30008147|Name=SMED30008147|organism=Schmidtea mediterranea sexual|type=transcript|length=3774bp
AAAACACTTTGAAAATATCCAATCTTGTGTTAAGTTGATCTTCTGCAAAC
CTTGTTCGTCTCTGATACAGTCAAGGAAACTGCTGAAATCTGGATGATTG
AAACCAACTTTGAATTGGAAACTTCTGTGCCTTCCTTCGACTGAATTATT
GGTTTTGCATAGTTCATCTTGTGATCTTTGATGTATGATCCAACAATCAT
TTCCAAAGAGAAGTAGATGTCACCCTCGTCGTTGTGGTTTACCTATAAAG
ATGTCATTGAAAAAGTCAACACCAGGTTGGGCTTCTGCTGAATGTTCATC
AGAAAACCCTTCAAAGGCAGCAATCACATCTAGTGGAAGGATGAAGGCAA
GAGCTGTAACTATTCTCATTTTTATTAAAAAATCATCATCTTCTTGATAT
CGCTGCTGAAAACCATGTTCCTGGATCTTTTGATATATTTGGACTGAATT
GTGAGAAGCACCTTTTGATTACTGTGTTGCATAAGACTTGATGTACATTC
GAGATCATTGCTTGCTCGAAATCAACTATTATCGAAACTGGATTCAAGTT
GCCAATAATTGTCATTAACTGTTGAAATAACTCCGTGTATGTTACTCCAG
ATTTGTTTGAAAGGCGAACGTAAACACACGTAATTGTGCGCTCAATTATG
GGTACATGGATCATATACAGTTGAAAGAAAATTGATGACGCTATTTCAAT
CTACAATCAAAGAACCAGTCTTGAAAACGTTGCAAGAAGTCTTGTTTTTT
TGTGTTCCAAAGATTAAAATTCTGTTTACTGATTGACCGGAATTAATCAA
AAGGAAATCCTGACCATCGGTGGTTGTTTTATATTGATCTGGTAAAACGA
GATCTTTGGCAGAAAATTGAACTGTAATCGGATTATTTTCTCGTTGTCTG
GTGCGTCGCAGATCACGTTTCAGATGGGGAACAGTTGGCAACTTTGCTGT
AGCATGTCTACCTATCGTTAAAACGGATTGCGTTATGATTTTTAGCGGTG
TTTCTTTTGTTTCTTCAGCTCGTATTTTCATTGATTGCATTGTCGTGAGA
ACCTCTCTTCTGGTTGGATCAGGTCCATGTGTGCTCATGAAGTCTGCATT
TTAAAAGCAATGCAATGTATAATAATATAATACAAAGAATTTATAATCAT
ACAATATTATTTTATAAAAATTAATTCTCAATGGGATATTATCTAGATAT
GGTTGGTATTATTATGCATTACTGCGTAATGCTCAGACATTTTATGAACG
TTGAATATTGTAACATCATACTATTGATTATTTAGTGTAAAATTGAATTT
TAGTGTGCTAGTGTTTAATAATATAGACCAAATATATTTCAAAATAATTG
TATGTCATTCGACTGGTATTCAGAAAATCTAAAAGAAGAATTGATAATAT
TTCCAAAATTATTGATTTTAAATAATTTTAATGACACTCATTTGGCTTTG
TTTGTCGGTGAAATGTGAAATTAAGAATTATTGATCTGACTCTAAAGCAT
GTTTTAGTCGACAACAATAAAGAACTCTAGACAACTTTGTTGATCAGTAC
GATTGATTAAAATTTACGCAACAAAATAATTCAATATTGCAACAATACTT
TGAGTGCTTCTTACAACCCTTCAATATACAACTATCTGGTTACTACTTCT
ATTTTCCACAATCAGTATGTTGTTTTAATTGCTTTCTTTTTTCAAGTTGA
AAATAGTCAGAACTTGACACAAATAACTTTGATAACTGGTTTAAGTTACT
TTTTCAATCTGACGCAGTTTTCTCCAATAATTTCGTACTCAAATTTATCC
ACCTATTTTTCAATATCGTTTTCCTAACTTTTTTCAAACTTTTTAAAATT
ACCCCTTAAAATCTCTAATTTAATATATGAAACGTTGGCATCGTCTGCCA
TGACATACATAACTAATTCTATTCATAACTTGTGTATTTTTGAAGTTTTT
AATAAATTTGTGCGACCAACATTGACTTAGAAAATGTTTTAGATATTTTA
GCGTGACCTATATAAATTTTGAGTTAACTTACTTTTTCTAGGTGGATACT
GGTCTAGATGGGACACATCCATCTACTTGTAATATTAAAAATCCAATCTT
ATGAAAAACATTTAAAAAAATTATTTTAGTTACAAATTAATGTTGAGGTA
TATCAAAACTTGATACAAATAAATAAATCAATTTCATAGTTATTTGTTAA
GTAAAACCAAGTTAAATCCGCATTGATCTATGTTTTGTGTGTGAGCCAAA
GGGATTCTATTTTTAAAGGCGATTTGAAAAATCATGAAAAAATTAATAAA
TCTGAGTAGACCTACATGATCTTTGAGTTGATCTATATAATTTTTGAATT
GACCTACATAATATCTGAGATGACCATTACAATATTTGATTGTGTATATG
AGCCAGAAGGGAATTAGAAAATCAATAAATATTTTTTACTTAGCGGGAAG
AGTAAGCGGGTTTGCATTGGTGGGCTCCAATTCACTTACTTTAGTTATCT
TGAAGAGGCTTTTGAAATATGTAAATTTAATTTCTATTTTGTTTTTGTTT
TTCACTAATATTTTATGTAGGATAGGAAATTTTCATGTTTATCAGAGAAT
ATTTATGGAGCTGATCTCATAATAGCTCAAATTTAGAGTAGGTCATGTAT
ACTTAAAAATATATTCACCACTAGGACATAGCAAACAACAGACATATTAT
ATGGTTTGTTTAATAAGTAGGTTAATACTACAAGTTTTATTAATAAGCTG
GTAAGTATTTAATTATTGCAACAATATAGAATGTGTTTGTGTTTGTCTGC
GATCTTCCTTTTTATTAATTAAACATTACAGCGTGTCTATTACTAGCTTT
GTCCTATTGTTGACTATAGTTAAAAATTTGAGTTTTTTTAGGTGAACTTT
ATAAAACCTCCGTGGTCTACATAAAATCGCAATGAAATACATAAAATTTT
CCGTACAAACATGAAAATTCTGGGACCTACAGAAAAACTTTCGTGAATTT
TATAAAAATAATTATAAAAGTTTGACTTAATATTTTTTTCTCAGCAAGGA
AGTTCTTGCTTTGACCTGCCCGGTCGGTGCTTATTCGTCTAATGACAATG
TGCTATCTGTGCAATTTGTTCAGTCCCCTTCGCGTATATCGCTCTGATGC
GGTAATTCTTCACCTACGATGTGAAACCGGCAAAGTTAAAACTTCGTACC
ATTAAATTTTACACCAAATAATTTATAAAATGTTACATAATATAAAATGG
TCTTGACTGTAAAATATTAGGCACTGTATTTTAAAGAAAATACTGTAAAA
ACATTGTTGGGAAATTAGATTTACTTTCAGAGAAAAGATAGTTTGTTCTG
GTAATTTGAAACCATTTCAACACTTCCATCTTTTCCCAAAGAACGTCCTT
AATGGATGATCTTTTCAGGCAGTTTAGACTTTGTCGATACAAGAGTACCA
TGTTTTATCATAAGAATAATGTGAATCAAATATTGCACATTTCAAATAAT
AATTTTTGGTTTATCATTTCTATTTCGTTGCTATCAAACTTGCTTCTCAT
TTTTGTCATTGGGAGTGTCCTTATCACCAAACACGTAACAAAAACAAAGG
GAAAGATATCGACCTCAATTTCAAAAATAAATATATACGAGGAGATTAAT
CAGGCCCCAGAAGACTCGATGTATTCAAATATGGTGGAAAATCAGAGAAA
CGTTATTCGTTCATTGGCCAACTACCAATTCCATTTACGGAGCAACCCTA
ATCGAGAAACGGCAGTATATTCAG
back to top

protein sequence of SMED30008147-orf-1

>SMED30008147-orf-1 ID=SMED30008147-orf-1|Name=SMED30008147-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=124bp
MDDLFRQFRLCRYKSTMFYHKNNVNQILHISNNNFWFIISISLLSNLLLI
FVIGSVLITKHVTKTKGKISTSISKINIYEEINQAPEDSMYSNMVENQRN
VIRSLANYQFHLRSNPNRETAVYS
back to top

protein sequence of SMED30008147-orf-2

>SMED30008147-orf-2 ID=SMED30008147-orf-2|Name=SMED30008147-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=131bp
MSTHGPDPTRREVLTTMQSMKIRAEETKETPLKIITQSVLTIGRHATAKL
PTVPHLKRDLRRTRQRENNPITVQFSAKDLVLPDQYKTTTDGQDFLLINS
GQSVNRILIFGTQKNKTSCNVFKTGSLIVD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR018289MULE_transposase_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 20..42