guanylate cyclase soluble subunit beta-2-like

Overview
Nameguanylate cyclase soluble subunit beta-2-like
Smed IDSMED30008141
Length (bp)743
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of guanylate cyclase soluble subunit beta-2-like (SMED30008141) t-SNE clustered cells

Violin plots show distribution of expression levels for guanylate cyclase soluble subunit beta-2-like (SMED30008141) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of guanylate cyclase soluble subunit beta-2-like (SMED30008141) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for guanylate cyclase soluble subunit beta-2-like (SMED30008141) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Human
Match: NPR1 (natriuretic peptide receptor 1 [Source:HGNC Symbol;Acc:HGNC:7943])

HSP 1 Score: 63.1586 bits (152), Expect = 8.749e-11
Identity = 33/93 (35.48%), Postives = 54/93 (58.06%), Query Frame = 3
Query:  465 ITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            + EL++E   R Q    EK+K+E LLYQ++P   A QL++   V+ + F+S +I F++I  F   +A   P ++V  LN ++  FD  I+  D
Sbjct:  827 LEELVEE---RTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFD 916          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Human
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:4687])

HSP 1 Score: 62.3882 bits (150), Expect = 1.586e-10
Identity = 37/98 (37.76%), Postives = 59/98 (60.20%), Query Frame = 3
Query:  441 KLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTE----IVRFLNLVFNVFD 722
            KL ++L ++T+ +  T+   +  E EKKK++TLLY ++P   AN+LR KRPV  K +++ +ILF+ I  F+ F +     E    IV  LN ++  FD
Sbjct:  386 KLTQELEILTDRLQLTL---RALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFD 480          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Human
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:4687])

HSP 1 Score: 62.003 bits (149), Expect = 1.674e-10
Identity = 37/98 (37.76%), Postives = 59/98 (60.20%), Query Frame = 3
Query:  441 KLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTE----IVRFLNLVFNVFD 722
            KL ++L ++T+ +  T+   +  E EKKK++TLLY ++P   AN+LR KRPV  K +++ +ILF+ I  F+ F +     E    IV  LN ++  FD
Sbjct:  364 KLTQELEILTDRLQLTL---RALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFD 458          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Human
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:4687])

HSP 1 Score: 62.003 bits (149), Expect = 1.686e-10
Identity = 37/98 (37.76%), Postives = 59/98 (60.20%), Query Frame = 3
Query:  441 KLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTE----IVRFLNLVFNVFD 722
            KL ++L ++T+ +  T+   +  E EKKK++TLLY ++P   AN+LR KRPV  K +++ +ILF+ I  F+ F +     E    IV  LN ++  FD
Sbjct:  396 KLTQELEILTDRLQLTL---RALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFD 490          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Human
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:4687])

HSP 1 Score: 62.003 bits (149), Expect = 1.793e-10
Identity = 37/98 (37.76%), Postives = 59/98 (60.20%), Query Frame = 3
Query:  441 KLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTE----IVRFLNLVFNVFD 722
            KL ++L ++T+ +  T+   +  E EKKK++TLLY ++P   AN+LR KRPV  K +++ +ILF+ I  F+ F +     E    IV  LN ++  FD
Sbjct:  296 KLTQELEILTDRLQLTL---RALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFD 390          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Celegans
Match: gcy-6 (Receptor-type guanylate cyclase gcy-6 [Source:UniProtKB/Swiss-Prot;Acc:N1NVB7])

HSP 1 Score: 66.6254 bits (161), Expect = 2.444e-12
Identity = 31/90 (34.44%), Postives = 54/90 (60.00%), Query Frame = 3
Query:  474 LIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            L DE   R +    EKKKS+ LLY+M+P + A++L+  + V+P+ F+  ++ F+++ +F        P ++V  LN ++ +FD  IE HD
Sbjct:  845 LEDEVAERMKELVEEKKKSDVLLYRMLPRQVADKLKLGQTVEPETFDIVTLFFSDVVSFTTLAGKCTPLQVVNLLNGLYTIFDGIIEQHD 934          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Celegans
Match: gcy-6 (Receptor-type guanylate cyclase gcy-6 [Source:UniProtKB/Swiss-Prot;Acc:N1NVB7])

HSP 1 Score: 66.6254 bits (161), Expect = 2.465e-12
Identity = 31/90 (34.44%), Postives = 54/90 (60.00%), Query Frame = 3
Query:  474 LIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            L DE   R +    EKKKS+ LLY+M+P + A++L+  + V+P+ F+  ++ F+++ +F        P ++V  LN ++ +FD  IE HD
Sbjct:  841 LEDEVAERMKELVEEKKKSDVLLYRMLPRQVADKLKLGQTVEPETFDIVTLFFSDVVSFTTLAGKCTPLQVVNLLNGLYTIFDGIIEQHD 930          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Celegans
Match: gcy-7 (Receptor-type guanylate cyclase gcy-7 [Source:UniProtKB/Swiss-Prot;Acc:H2L002])

HSP 1 Score: 65.4698 bits (158), Expect = 5.271e-12
Identity = 32/92 (34.78%), Postives = 54/92 (58.70%), Query Frame = 3
Query:  468 TELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            + L +E   R +    EKKKS+ LLY+M+P   A++L+  + V+P+ FE  +I F+++  F    +   P ++V  LN ++ +FD  IE HD
Sbjct:  845 SSLEEEVSERTKELVEEKKKSDVLLYRMLPKTVADKLKLGQTVEPETFEQVTIFFSDVVQFTTLASKCTPLQVVNLLNDLYTIFDGIIEKHD 936          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Celegans
Match: gcy-7 (Receptor-type guanylate cyclase gcy-7 [Source:UniProtKB/Swiss-Prot;Acc:H2L002])

HSP 1 Score: 65.4698 bits (158), Expect = 5.942e-12
Identity = 32/92 (34.78%), Postives = 54/92 (58.70%), Query Frame = 3
Query:  468 TELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            + L +E   R +    EKKKS+ LLY+M+P   A++L+  + V+P+ FE  +I F+++  F    +   P ++V  LN ++ +FD  IE HD
Sbjct:  845 SSLEEEVSERTKELVEEKKKSDVLLYRMLPKTVADKLKLGQTVEPETFEQVTIFFSDVVQFTTLASKCTPLQVVNLLNDLYTIFDGIIEKHD 936          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Celegans
Match: gcy-22 (Receptor-type guanylate cyclase gcy-22 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTY1])

HSP 1 Score: 65.0846 bits (157), Expect = 8.329e-12
Identity = 31/92 (33.70%), Postives = 54/92 (58.70%), Query Frame = 3
Query:  468 TELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            + L DE   R +    EKK+S+ LLY+M+P + A +L+  + V+P+ F+  +I F+++ +F    +   P ++V  LN ++  FD  IE HD
Sbjct:  816 SNLEDEVQARMKELTEEKKRSDVLLYRMLPKQVAEKLKLGQSVEPETFDCVTIFFSDVVSFTTLASRCTPLQVVNLLNDLYTTFDAIIEQHD 907          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Fly
Match: CG33958 (gene:FBgn0053958 transcript:FBtr0099994)

HSP 1 Score: 71.2478 bits (173), Expect = 6.544e-14
Identity = 33/76 (43.42%), Postives = 51/76 (67.11%), Query Frame = 3
Query:  516 EKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            EK+KS++LL+QM+P   A QL+Q + V  +L+E+ +I F++I  F    A   P E+V FLN ++ VFD+ IE +D
Sbjct:  459 EKRKSDSLLFQMLPPSVAMQLKQTQQVPAELYEAVTIYFSDIVGFTEIAADCTPLEVVTFLNSIYRVFDERIECYD 534          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Fly
Match: Gycbeta100B (gene:FBgn0013973 transcript:FBtr0085753)

HSP 1 Score: 64.6994 bits (156), Expect = 1.241e-11
Identity = 34/100 (34.00%), Postives = 61/100 (61.00%), Query Frame = 3
Query:  435 QRKLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLP----PTEIVRFLNLVFNVFD 722
            + KL + L ++T+ + +T    +  E+EK+K++ LLY ++P   AN+LR +RPV PK ++S +++F+ I  F  + A         +IV+ LN ++ VFD
Sbjct:  472 EYKLTKNLEMLTDKLQQTF---RDLESEKQKTDRLLYSVLPKSVANELRHQRPVPPKRYDSVTLMFSGIVGFGQYCAANTDPDGAMKIVKMLNELYTVFD 568          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Fly
Match: CG31183 (gene:FBgn0051183 transcript:FBtr0346151)

HSP 1 Score: 63.5438 bits (153), Expect = 3.500e-11
Identity = 35/93 (37.63%), Postives = 53/93 (56.99%), Query Frame = 3
Query:  465 ITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            + EL++E   R Q    EKKK E LLYQ++P   A QL   +PV  + F+  +I F++I  F   +A   P ++V+FLN ++  FD  +E  D
Sbjct:  904 LEELVEE---RTQDYHEEKKKCEKLLYQLLPQSVAAQLISGQPVVAETFDQVTIYFSDIVGFTAISAESTPMQVVQFLNDLYTCFDSIVENFD 993          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Fly
Match: CG31183 (gene:FBgn0051183 transcript:FBtr0083187)

HSP 1 Score: 63.5438 bits (153), Expect = 3.500e-11
Identity = 35/93 (37.63%), Postives = 53/93 (56.99%), Query Frame = 3
Query:  465 ITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            + EL++E   R Q    EKKK E LLYQ++P   A QL   +PV  + F+  +I F++I  F   +A   P ++V+FLN ++  FD  +E  D
Sbjct:  904 LEELVEE---RTQDYHEEKKKCEKLLYQLLPQSVAAQLISGQPVVAETFDQVTIYFSDIVGFTAISAESTPMQVVQFLNDLYTCFDSIVENFD 993          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Fly
Match: CG10738 (gene:FBgn0036368 transcript:FBtr0304792)

HSP 1 Score: 62.3882 bits (150), Expect = 8.304e-11
Identity = 32/90 (35.56%), Postives = 53/90 (58.89%), Query Frame = 3
Query:  474 LIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            L+D+   R    + EKKK++ LL++M+P   A+QL++   V P+ +E  SI F++I  F   +A   P ++V FLN ++  FD  I  +D
Sbjct:  861 LVDD---RTDQLQEEKKKTDALLHEMLPRCVADQLKKGHKVDPEHYEQVSIYFSDIVGFTAMSAECTPLQVVDFLNDLYTCFDSIIGHYD 947          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Zebrafish
Match: gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;Acc:ZDB-GENE-130530-664])

HSP 1 Score: 66.6254 bits (161), Expect = 3.160e-12
Identity = 33/88 (37.50%), Postives = 53/88 (60.23%), Query Frame = 3
Query:  480 DETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            +E  I  ++ E EK+KSE LLY M+P   ANQL++ + V+   F+ C+ILF+++  F    A   P +IV  LN +++ FD    +H+
Sbjct:  421 EELRILSRNLEIEKQKSEKLLYAMLPTHVANQLKEGKRVEAGEFKVCTILFSDVVTFTNICAACEPIQIVNMLNAMYSRFDRLTSIHN 508          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Zebrafish
Match: gucy2d (guanylate cyclase 2D, retinal [Source:ZFIN;Acc:ZDB-GENE-011128-9])

HSP 1 Score: 66.2402 bits (160), Expect = 4.556e-12
Identity = 35/102 (34.31%), Postives = 58/102 (56.86%), Query Frame = 3
Query:  438 RKLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            R L +  + + +LI E   R +  E E++K++ LL QM+P   A  L+  +PVKP+ F   ++ F++I  F   +A+  P E+V  LN ++  FD  I +HD
Sbjct:  856 RMLEQYSSNLEDLIRE---RTEELEVERQKTDALLAQMLPKSVALALKTGKPVKPEHFAEVTLYFSDIVGFTTISALSEPIEVVDLLNDLYTHFDGIIAIHD 954          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Zebrafish
Match: gucy2d (guanylate cyclase 2D, retinal [Source:ZFIN;Acc:ZDB-GENE-011128-9])

HSP 1 Score: 66.2402 bits (160), Expect = 4.581e-12
Identity = 35/102 (34.31%), Postives = 58/102 (56.86%), Query Frame = 3
Query:  438 RKLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            R L +  + + +LI E   R +  E E++K++ LL QM+P   A  L+  +PVKP+ F   ++ F++I  F   +A+  P E+V  LN ++  FD  I +HD
Sbjct:  895 RMLEQYSSNLEDLIRE---RTEELEVERQKTDALLAQMLPKSVALALKTGKPVKPEHFAEVTLYFSDIVGFTTISALSEPIEVVDLLNDLYTHFDGIIAIHD 993          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Zebrafish
Match: gucy2d (guanylate cyclase 2D, retinal [Source:ZFIN;Acc:ZDB-GENE-011128-9])

HSP 1 Score: 66.2402 bits (160), Expect = 4.641e-12
Identity = 35/102 (34.31%), Postives = 58/102 (56.86%), Query Frame = 3
Query:  438 RKLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            R L +  + + +LI E   R +  E E++K++ LL QM+P   A  L+  +PVKP+ F   ++ F++I  F   +A+  P E+V  LN ++  FD  I +HD
Sbjct:  854 RMLEQYSSNLEDLIRE---RTEELEVERQKTDALLAQMLPKSVALALKTGKPVKPEHFAEVTLYFSDIVGFTTISALSEPIEVVDLLNDLYTHFDGIIAIHD 952          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Zebrafish
Match: gucy2d (guanylate cyclase 2D, retinal [Source:ZFIN;Acc:ZDB-GENE-011128-9])

HSP 1 Score: 66.2402 bits (160), Expect = 4.807e-12
Identity = 35/102 (34.31%), Postives = 58/102 (56.86%), Query Frame = 3
Query:  438 RKLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            R L +  + + +LI E   R +  E E++K++ LL QM+P   A  L+  +PVKP+ F   ++ F++I  F   +A+  P E+V  LN ++  FD  I +HD
Sbjct:  841 RMLEQYSSNLEDLIRE---RTEELEVERQKTDALLAQMLPKSVALALKTGKPVKPEHFAEVTLYFSDIVGFTTISALSEPIEVVDLLNDLYTHFDGIIAIHD 939          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Xenopus
Match: ank1 (ankyrin 1 [Source:Xenbase;Acc:XB-GENE-5838516])

HSP 1 Score: 66.6254 bits (161), Expect = 4.223e-12
Identity = 35/88 (39.77%), Postives = 52/88 (59.09%), Query Frame = 3
Query:  480 DETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            +E  I  +H E EKKK+E LLY M+P   ANQL++ + V+   F+ C+ILF+++  F    A   P +IV  LN ++  FD    +HD
Sbjct:  341 EELRILSKHLEEEKKKTELLLYAMLPKHVANQLKEGKRVEAGEFKECTILFSDVVTFTNICAQCEPIQIVFMLNSMYLRFDRLTTVHD 428          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Xenopus
Match: slc8a3 (solute carrier family 8 (sodium/calcium exchanger), member 3 [Source:Xenbase;Acc:XB-GENE-954537])

HSP 1 Score: 66.6254 bits (161), Expect = 4.899e-12
Identity = 35/102 (34.31%), Postives = 58/102 (56.86%), Query Frame = 3
Query:  438 RKLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            R L +  + + +LI E   R +  E EK+K++ LL QM+P   A  L+   PV+P+ F+  +I F++I  F   +++  P E+V  LN ++ +FD  I  HD
Sbjct:  780 RMLEQYSSNLEDLIRE---RTEELEVEKQKTDKLLTQMLPPSVAEALKTGTPVEPEYFDEVTIYFSDIVGFTTISSLSDPIEVVDLLNDLYTLFDAIIGSHD 878          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Xenopus
Match: slc8a3 (solute carrier family 8 (sodium/calcium exchanger), member 3 [Source:Xenbase;Acc:XB-GENE-954537])

HSP 1 Score: 66.6254 bits (161), Expect = 4.899e-12
Identity = 35/102 (34.31%), Postives = 58/102 (56.86%), Query Frame = 3
Query:  438 RKLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            R L +  + + +LI E   R +  E EK+K++ LL QM+P   A  L+   PV+P+ F+  +I F++I  F   +++  P E+V  LN ++ +FD  I  HD
Sbjct:  763 RMLEQYSSNLEDLIRE---RTEELEVEKQKTDKLLTQMLPPSVAEALKTGTPVEPEYFDEVTIYFSDIVGFTTISSLSDPIEVVDLLNDLYTLFDAIIGSHD 861          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Xenopus
Match: slc8a3 (solute carrier family 8 (sodium/calcium exchanger), member 3 [Source:Xenbase;Acc:XB-GENE-954537])

HSP 1 Score: 66.6254 bits (161), Expect = 5.340e-12
Identity = 35/102 (34.31%), Postives = 58/102 (56.86%), Query Frame = 3
Query:  438 RKLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            R L +  + + +LI E   R +  E EK+K++ LL QM+P   A  L+   PV+P+ F+  +I F++I  F   +++  P E+V  LN ++ +FD  I  HD
Sbjct:  794 RMLEQYSSNLEDLIRE---RTEELEVEKQKTDKLLTQMLPPSVAEALKTGTPVEPEYFDEVTIYFSDIVGFTTISSLSDPIEVVDLLNDLYTLFDAIIGSHD 892          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Xenopus
Match: slc8a3 (solute carrier family 8 (sodium/calcium exchanger), member 3 [Source:Xenbase;Acc:XB-GENE-954537])

HSP 1 Score: 66.6254 bits (161), Expect = 5.508e-12
Identity = 35/102 (34.31%), Postives = 58/102 (56.86%), Query Frame = 3
Query:  438 RKLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            R L +  + + +LI E   R +  E EK+K++ LL QM+P   A  L+   PV+P+ F+  +I F++I  F   +++  P E+V  LN ++ +FD  I  HD
Sbjct:  788 RMLEQYSSNLEDLIRE---RTEELEVEKQKTDKLLTQMLPPSVAEALKTGTPVEPEYFDEVTIYFSDIVGFTTISSLSDPIEVVDLLNDLYTLFDAIIGSHD 886          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Mouse
Match: Gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:MGI Symbol;Acc:MGI:2660873])

HSP 1 Score: 74.3294 bits (181), Expect = 1.132e-14
Identity = 35/88 (39.77%), Postives = 52/88 (59.09%), Query Frame = 3
Query:  480 DETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            +E  +   H   EKKK+ETLLY M+P   ANQL++ + V    FE+C+ILF+++  F    A   P +IV  LN +++ FD    +HD
Sbjct:  487 EELRVLSNHLAIEKKKTETLLYAMLPEHVANQLKEGKKVAAGEFETCTILFSDVVTFTNICAACEPIQIVNMLNSMYSKFDRLTNIHD 574          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Mouse
Match: Gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:MGI Symbol;Acc:MGI:2660873])

HSP 1 Score: 73.9442 bits (180), Expect = 1.373e-14
Identity = 35/88 (39.77%), Postives = 52/88 (59.09%), Query Frame = 3
Query:  480 DETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            +E  +   H   EKKK+ETLLY M+P   ANQL++ + V    FE+C+ILF+++  F    A   P +IV  LN +++ FD    +HD
Sbjct:  502 EELRVLSNHLAIEKKKTETLLYAMLPEHVANQLKEGKKVAAGEFETCTILFSDVVTFTNICAACEPIQIVNMLNSMYSKFDRLTNIHD 589          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Mouse
Match: Gucy2e (guanylate cyclase 2e [Source:MGI Symbol;Acc:MGI:105123])

HSP 1 Score: 65.0846 bits (157), Expect = 1.291e-11
Identity = 35/102 (34.31%), Postives = 57/102 (55.88%), Query Frame = 3
Query:  438 RKLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            R L +  + + +LI E   R +  E EK+K++ LL QM+P   A  L+    V+P+ FE  ++ F++I  F   +A+  P E+V  LN ++ +FD  I  HD
Sbjct:  825 RMLEQYSSNLEDLIRE---RTEELEQEKQKTDRLLTQMLPPSVAEALKMGTSVEPEYFEEVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGAHD 923          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Mouse
Match: Gucy2e (guanylate cyclase 2e [Source:MGI Symbol;Acc:MGI:105123])

HSP 1 Score: 65.0846 bits (157), Expect = 1.291e-11
Identity = 35/102 (34.31%), Postives = 57/102 (55.88%), Query Frame = 3
Query:  438 RKLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            R L +  + + +LI E   R +  E EK+K++ LL QM+P   A  L+    V+P+ FE  ++ F++I  F   +A+  P E+V  LN ++ +FD  I  HD
Sbjct:  825 RMLEQYSSNLEDLIRE---RTEELEQEKQKTDRLLTQMLPPSVAEALKMGTSVEPEYFEEVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGAHD 923          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Mouse
Match: Gucy2e (guanylate cyclase 2e [Source:MGI Symbol;Acc:MGI:105123])

HSP 1 Score: 65.0846 bits (157), Expect = 1.291e-11
Identity = 35/102 (34.31%), Postives = 57/102 (55.88%), Query Frame = 3
Query:  438 RKLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            R L +  + + +LI E   R +  E EK+K++ LL QM+P   A  L+    V+P+ FE  ++ F++I  F   +A+  P E+V  LN ++ +FD  I  HD
Sbjct:  825 RMLEQYSSNLEDLIRE---RTEELEQEKQKTDRLLTQMLPPSVAEALKMGTSVEPEYFEEVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGAHD 923          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. UniProt/SwissProt
Match: sp|P22717|GCYB2_RAT (Guanylate cyclase soluble subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Gucy1b2 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.028e-13
Identity = 36/88 (40.91%), Postives = 52/88 (59.09%), Query Frame = 3
Query:  480 DETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            +E  +   H   EKKK+ETLLY M+P   ANQL++ R V    FE+C+ILF+++  F    A   P +IV  LN +++ FD    +HD
Sbjct:  361 EELRVLSNHLAIEKKKTETLLYAMLPEHVANQLKEGRKVAAGEFETCTILFSDVVTFTNICAACEPIQIVNMLNSMYSKFDRLTSVHD 448          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. UniProt/SwissProt
Match: sp|O75343|GCYB2_HUMAN (Guanylate cyclase soluble subunit beta-2 OS=Homo sapiens OX=9606 GN=GUCY1B2 PE=5 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 2.372e-12
Identity = 34/87 (39.08%), Postives = 51/87 (58.62%), Query Frame = 3
Query:  480 DETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELH 740
            +E  +  +H   EKKK+ETLLY M+P   ANQLR+ + V    F+SC+ILF+++  F        P +IV  LN +++ FD    +H
Sbjct:  344 EELQVLSKHLAIEKKKTETLLYAMLPKHVANQLREGKKVAAGEFKSCTILFSDVVTFTNICTACEPIQIVNVLNSMYSKFDRLTSVH 430          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. UniProt/SwissProt
Match: sp|N1NVB7|GCY6_CAEEL (Receptor-type guanylate cyclase gcy-6 OS=Caenorhabditis elegans OX=6239 GN=gcy-6 PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 3.109e-11
Identity = 31/90 (34.44%), Postives = 54/90 (60.00%), Query Frame = 3
Query:  474 LIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            L DE   R +    EKKKS+ LLY+M+P + A++L+  + V+P+ F+  ++ F+++ +F        P ++V  LN ++ +FD  IE HD
Sbjct:  845 LEDEVAERMKELVEEKKKSDVLLYRMLPRQVADKLKLGQTVEPETFDIVTLFFSDVVSFTTLAGKCTPLQVVNLLNGLYTIFDGIIEQHD 934          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. UniProt/SwissProt
Match: sp|H2L002|GCY7_CAEEL (Receptor-type guanylate cyclase gcy-7 OS=Caenorhabditis elegans OX=6239 GN=gcy-7 PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 6.705e-11
Identity = 32/92 (34.78%), Postives = 54/92 (58.70%), Query Frame = 3
Query:  468 TELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            + L +E   R +    EKKKS+ LLY+M+P   A++L+  + V+P+ FE  +I F+++  F    +   P ++V  LN ++ +FD  IE HD
Sbjct:  845 SSLEEEVSERTKELVEEKKKSDVLLYRMLPKTVADKLKLGQTVEPETFEQVTIFFSDVVQFTTLASKCTPLQVVNLLNDLYTIFDGIIEKHD 936          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. UniProt/SwissProt
Match: sp|P52785|GUC2E_MOUSE (Retinal guanylyl cyclase 1 OS=Mus musculus OX=10090 GN=Gucy2e PE=1 SV=2)

HSP 1 Score: 65.0846 bits (157), Expect = 9.030e-11
Identity = 35/102 (34.31%), Postives = 57/102 (55.88%), Query Frame = 3
Query:  438 RKLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            R L +  + + +LI E   R +  E EK+K++ LL QM+P   A  L+    V+P+ FE  ++ F++I  F   +A+  P E+V  LN ++ +FD  I  HD
Sbjct:  825 RMLEQYSSNLEDLIRE---RTEELEQEKQKTDRLLTQMLPPSVAEALKMGTSVEPEYFEEVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGAHD 923          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. TrEMBL
Match: G3PRL3 (Guanylate cyclase 1, soluble, beta 2 OS=Gasterosteus aculeatus OX=69293 PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.783e-13
Identity = 40/88 (45.45%), Postives = 53/88 (60.23%), Query Frame = 3
Query:  480 DETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            +E  I  QH ETEK+K+ETLLY M+P   ANQL+  R VK   FE C+ILF+++  F    A   P  IV  LN +++ FD    +HD
Sbjct:  418 EELRILSQHLETEKEKTETLLYAMLPRHIANQLKDGRSVKAGEFEVCTILFSDVVTFTSICAACEPIHIVHMLNSMYSKFDRLTSIHD 505          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. TrEMBL
Match: R7UFR9 (Guanylate cyclase domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_166290 PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 2.346e-12
Identity = 33/76 (43.42%), Postives = 55/76 (72.37%), Query Frame = 3
Query:  516 EKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            EKK++++LLYQM+P + A+QL++++ V  + F+  +I F++I  F  FTA L P ++VR LN +F +FD+ IE +D
Sbjct:  342 EKKRTDSLLYQMMPRQVADQLKRRKGVTAEYFKEVTIFFSDIVGFTRFTAELTPMQVVRVLNEIFTLFDERIEQYD 417          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. TrEMBL
Match: A0A0F8ARX1 (Guanylate cyclase soluble subunit beta-2 OS=Larimichthys crocea OX=215358 GN=EH28_04318 PE=3 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 3.158e-12
Identity = 38/88 (43.18%), Postives = 52/88 (59.09%), Query Frame = 3
Query:  480 DETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            +E  I  QH E EK+K+ETLLY M+P   ANQL+  + VK   FE C+ILF+++  F    A   P  IV  LN +++ FD    +HD
Sbjct:  318 EELRILSQHLEAEKEKTETLLYAMLPRHIANQLKDGKSVKAGDFEVCTILFSDVVTFTNICAACEPIHIVHMLNSMYSKFDRLTNIHD 405          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. TrEMBL
Match: A0A3Q1IDN3 (Guanylate cyclase 1, soluble, beta 2 OS=Anabas testudineus OX=64144 PE=3 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 3.394e-12
Identity = 37/88 (42.05%), Postives = 54/88 (61.36%), Query Frame = 3
Query:  480 DETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            +E  I  +H E EK+K+ETLLY M+P   ANQL+  + V+   FE C+ILF+++  F    A   P +IV  LNL+++ FD    +HD
Sbjct:  392 EELRILSRHLEAEKEKTETLLYAMLPRHIANQLKDGKSVQAGEFEVCTILFSDVVTFTNICAACEPIDIVHMLNLMYSKFDRLTNVHD 479          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. TrEMBL
Match: A0A0F8AVG5 (Guanylate cyclase soluble subunit beta-2 OS=Larimichthys crocea OX=215358 GN=EH28_08350 PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 3.957e-12
Identity = 38/88 (43.18%), Postives = 52/88 (59.09%), Query Frame = 3
Query:  480 DETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            +E  I  QH E EK+K+ETLLY M+P   ANQL+  + VK   FE C+ILF+++  F    A   P  IV  LN +++ FD    +HD
Sbjct:  289 EELRILSQHLEAEKEKTETLLYAMLPRHIANQLKDGKSVKAGDFEVCTILFSDVVTFTNICAACEPIHIVHMLNSMYSKFDRLTNIHD 376          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Cavefish
Match: gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;Acc:ZDB-GENE-130530-664])

HSP 1 Score: 70.0922 bits (170), Expect = 2.137e-13
Identity = 35/88 (39.77%), Postives = 53/88 (60.23%), Query Frame = 3
Query:  480 DETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            +E  I  ++ E EKKK+ETLLY M+P   ANQL++ + V    F+ C+ILF+++  F    A   P +IV  LN +++ FD    +HD
Sbjct:  390 EELRILSRNLEVEKKKTETLLYAMLPRHVANQLKEGKKVDAGEFKVCTILFSDVVTFTNICAACEPIQIVHMLNSMYSRFDRLTNVHD 477          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Cavefish
Match: gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;Acc:ZDB-GENE-130530-664])

HSP 1 Score: 70.0922 bits (170), Expect = 2.234e-13
Identity = 35/88 (39.77%), Postives = 53/88 (60.23%), Query Frame = 3
Query:  480 DETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            +E  I  ++ E EKKK+ETLLY M+P   ANQL++ + V    F+ C+ILF+++  F    A   P +IV  LN +++ FD    +HD
Sbjct:  384 EELRILSRNLEVEKKKTETLLYAMLPRHVANQLKEGKKVDAGEFKVCTILFSDVVTFTNICAACEPIQIVHMLNSMYSRFDRLTNVHD 471          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Cavefish
Match: ENSAMXT00000016107.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001112.1:50819:73979:1 gene:ENSAMXG00000015515.2 transcript:ENSAMXT00000016107.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 1.047e-12
Identity = 30/83 (36.14%), Postives = 51/83 (61.45%), Query Frame = 3
Query:  495 RKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            R Q    EK+K++ LLY M+P + A+ LRQ +P + + + S ++ F++I  F   ++   P ++V FLN ++  FDD I+ HD
Sbjct:  600 RTQDLMHEKQKTDRLLYSMLPKQVADDLRQGKPSQAQSYVSATVFFSDIVGFTQLSSTSTPYQVVDFLNKLYTTFDDIIDNHD 682          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Cavefish
Match: gc2 (retinal guanylyl cyclase 2 [Source:NCBI gene;Acc:103025043])

HSP 1 Score: 65.4698 bits (158), Expect = 7.757e-12
Identity = 37/102 (36.27%), Postives = 57/102 (55.88%), Query Frame = 3
Query:  438 RKLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            R L +  + + ELI E   R +  E EK+K+E LL QM+P   A  L+    V+P+ +E  +I F++I  F   +A   P E+V  LN +++ FD+ I  HD
Sbjct:  833 RMLEQYSSNLEELIRE---RTEELEVEKQKTEKLLTQMLPPSVAEALKLGTTVEPEYYECVTIYFSDIVGFTTISANSEPIEVVDLLNDLYSTFDEIIANHD 931          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Cavefish
Match: ENSAMXT00000020840.2 (retinal guanylyl cyclase 2 [Source:NCBI gene;Acc:103026799])

HSP 1 Score: 65.0846 bits (157), Expect = 1.241e-11
Identity = 38/102 (37.25%), Postives = 57/102 (55.88%), Query Frame = 3
Query:  438 RKLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            R L +  + + ELI E   R +  E EK+K+E LL QM+P   A  L+    V+P+ F+S S+ F++I  F   +A   P E+V  LN ++ +FD  I  HD
Sbjct:  809 RMLEQYSSNLEELIRE---RTEELEIEKQKTEKLLTQMLPPSVAEALKVGGTVEPEYFDSVSLYFSDIVGFTTISANSEPIEVVDLLNDLYTLFDAIIGNHD 907          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Sea Lamprey
Match: gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;Acc:ZDB-GENE-130530-664])

HSP 1 Score: 65.855 bits (159), Expect = 6.873e-13
Identity = 31/78 (39.74%), Postives = 48/78 (61.54%), Query Frame = 3
Query:  510 ETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            + EKKK+E LLY M+P   ANQL++ + V+   F+ C+ILF+++  F    AV  P +IV  LN ++  FD    +H+
Sbjct:  149 QVEKKKTEALLYAMLPHHVANQLKEGKKVEAGEFKVCTILFSDVVTFTNICAVCEPIQIVHMLNAMYMRFDRLTTVHN 226          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006352.1 (pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 gene:ENSPMAG00000005587.1 transcript:ENSPMAT00000006352.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.6178 bits (148), Expect = 2.800e-11
Identity = 34/93 (36.56%), Postives = 55/93 (59.14%), Query Frame = 3
Query:  465 ITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            + EL++E   R Q    EK+K+ETLLYQ++P   A QL++   V+ + F+S +I F++I  F   +A   P ++V  LN ++  FD  I+  D
Sbjct:  593 LEELVEE---RTQAYLEEKRKAETLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQVVTLLNDLYTCFDAIIDNFD 682          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002650.1 (pep scaffold:Pmarinus_7.0:GL478983:4063:28109:1 gene:ENSPMAG00000002416.1 transcript:ENSPMAT00000002650.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 9.417e-11
Identity = 30/89 (33.71%), Postives = 55/89 (61.80%), Query Frame = 3
Query:  483 ETIIRKQHQET--EKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            E+++ ++ Q+   EK+K++ LLY M+P + A+ LRQ R  K + + S ++ F++I  F   ++   P E+V FLN ++  FD  I+ +D
Sbjct:  271 ESVVTERTQDLVLEKQKTDRLLYSMLPKQIADDLRQGRVTKAQSYASATVFFSDIVGFTQLSSSSTPYEVVDFLNKLYTSFDGIIDNYD 359          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Sea Lamprey
Match: NPR1 (natriuretic peptide receptor 1 [Source:HGNC Symbol;Acc:HGNC:7943])

HSP 1 Score: 58.5362 bits (140), Expect = 2.594e-10
Identity = 32/90 (35.56%), Postives = 51/90 (56.67%), Query Frame = 3
Query:  465 ITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIE 734
            + EL++E   R Q    EK K+E LLYQ++P   A QL++   V  + F+S +I  ++I  F   +A   P ++V FLN ++  FD  I+
Sbjct:  276 LEELVEE---RTQAYLEEKGKAEALLYQILPHSVAEQLKRGETVPAEAFDSVTIYLSDIVGFTAMSAQSTPMQVVAFLNDLYTCFDAIID 362          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000043.1 (pep scaffold:Pmarinus_7.0:GL480785:4349:14716:1 gene:ENSPMAG00000000040.1 transcript:ENSPMAT00000000043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 7.392e-8
Identity = 29/102 (28.43%), Postives = 53/102 (51.96%), Query Frame = 3
Query:  438 RKLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            R+L +    +  L++E   R +  + E+ +++ L YQ++P      L+    V+P+LFE  +I F++I  F        P E+V  LN ++  FD  ++ HD
Sbjct:  214 RRLEQYSKNLERLVEE---RTELYKRERDRADHLNYQLLPKTVVQALKSVGSVQPELFEEVTIYFSDIVGFTTICKHCEPMEVVCLLNDLYKEFDSIVDSHD 312          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Nematostella
Match: EDO44983 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7RUA8])

HSP 1 Score: 62.003 bits (149), Expect = 2.795e-11
Identity = 28/83 (33.73%), Postives = 52/83 (62.65%), Query Frame = 3
Query:  495 RKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            R +  ETEK K++ LLY+M+P   A+QL+   P+K + F   ++ + +I +F   TA+  P ++++ LN V+++FD  +  +D
Sbjct:  235 RTRQLETEKSKTDELLYRMLPRLIADQLKAGLPLKAESFSEVTVFYCDIVDFTVITALSEPMQVIKLLNDVYSLFDTIMGRYD 317          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Nematostella
Match: EDO36204 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SJA3])

HSP 1 Score: 60.8474 bits (146), Expect = 8.424e-11
Identity = 28/83 (33.73%), Postives = 51/83 (61.45%), Query Frame = 3
Query:  495 RKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            R +  E EK K++ LLY+M+P   A+QL+  + V+ +LF+  ++ F++I  F   ++   P ++V FLN ++  FD+ I  +D
Sbjct:  247 RTRQLEAEKAKTDQLLYEMLPRPVADQLKSGKSVEAELFDQVTVFFSDIVGFTKLSSSSTPIQVVTFLNDLYTYFDNIIPNYD 329          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Nematostella
Match: EDO27923 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7T7X3])

HSP 1 Score: 59.6918 bits (143), Expect = 2.034e-10
Identity = 28/83 (33.73%), Postives = 48/83 (57.83%), Query Frame = 3
Query:  495 RKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            R +    EK K++ LLY+M+P   A++L++  PV  + F+S +I F++I  F    A   P ++V  LN ++  FD  ++ HD
Sbjct:  222 RTKQLAEEKAKTDELLYKMLPRPIADELKKGNPVSAESFQSVTIFFSDIVGFTSVAAQSTPLQVVDLLNQLYTRFDKVVDEHD 304          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Nematostella
Match: EDO36203 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SJA1])

HSP 1 Score: 57.7658 bits (138), Expect = 9.031e-10
Identity = 31/89 (34.83%), Postives = 49/89 (55.06%), Query Frame = 3
Query:  483 ETII--RKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            ETI+  R +    EK K++ LLY+M+P   A  L++  PV  + + S +I F++I  F    A   P ++V  LN ++  FD  I+ HD
Sbjct:  337 ETIVDERTRQLADEKAKTDELLYKMLPRYIAESLKRGEPVIAESYSSVTIFFSDIVGFTELAAASTPLQVVDLLNDLYTCFDTIIDKHD 425          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Nematostella
Match: EDO47084 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN70])

HSP 1 Score: 56.9954 bits (136), Expect = 1.550e-9
Identity = 31/95 (32.63%), Postives = 56/95 (58.95%), Query Frame = 3
Query:  441 KLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNF-DFFTAVLPPTEIVRFLNLVFNVFD 722
            KL ++L ++T+ + +T    +  E E++ ++ LLY ++P   AN LR ++PV    +E  +I+F+ I +F ++   +  P EIV  LN V+  FD
Sbjct:  375 KLSQRLEILTDKLQQT---SRELENEQQLNDRLLYSILPASVANDLRLRKPVNANKYEIVTIMFSGIVDFTNYCNKIKEPMEIVEMLNEVYTEFD 466          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Medaka
Match: olgc3 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100192404])

HSP 1 Score: 67.0106 bits (162), Expect = 2.478e-12
Identity = 33/102 (32.35%), Postives = 58/102 (56.86%), Query Frame = 3
Query:  438 RKLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            R L +  + + +LI E   R    E E+ K+E L+ Q++P   A  L++ +PV+P+ +  C++ F++I  F   +A+  P E+V  LN ++ +FD  I  HD
Sbjct:  778 RMLEQYSSNLEDLIRE---RTDELEVERNKTEKLVGQLLPKSVAQALKKGKPVQPEHYSDCTLYFSDIVGFTTISALSEPIEVVDLLNDLYTMFDAIIASHD 876          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Medaka
Match: olgc3 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100192404])

HSP 1 Score: 67.0106 bits (162), Expect = 2.490e-12
Identity = 33/102 (32.35%), Postives = 58/102 (56.86%), Query Frame = 3
Query:  438 RKLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            R L +  + + +LI E   R    E E+ K+E L+ Q++P   A  L++ +PV+P+ +  C++ F++I  F   +A+  P E+V  LN ++ +FD  I  HD
Sbjct:  778 RMLEQYSSNLEDLIRE---RTDELEVERNKTEKLVGQLLPKSVAQALKKGKPVQPEHYSDCTLYFSDIVGFTTISALSEPIEVVDLLNDLYTMFDAIIASHD 876          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Medaka
Match: olgc-r2 (guanylate cyclase OlGC-R2 [Source:NCBI gene;Acc:100216004])

HSP 1 Score: 65.855 bits (159), Expect = 5.885e-12
Identity = 39/102 (38.24%), Postives = 56/102 (54.90%), Query Frame = 3
Query:  438 RKLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            R L +  + + ELI E   R +  E EK+K+E LL QM+P   A  L     VKP+ F+S S+ F++I  F   +A   P E+V  LN ++ +FD  I  HD
Sbjct:  833 RMLEQYSSNLEELIRE---RTEELEIEKQKTEKLLTQMLPPSVAEALMVGGTVKPEYFDSVSLYFSDIVGFTTISANSEPIEVVDLLNDLYTLFDAIIGNHD 931          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Medaka
Match: olgc5 (guanylate cyclase OlGC5 [Source:NCBI gene;Acc:100125800])

HSP 1 Score: 65.855 bits (159), Expect = 6.919e-12
Identity = 33/102 (32.35%), Postives = 59/102 (57.84%), Query Frame = 3
Query:  438 RKLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            R L +  + + +LI E   R +  E E++K++ L+ QM+P   A  L+  +PV+P+ F   ++ F++I  F   + +  P E+V  LN ++++FD  I LHD
Sbjct:  873 RMLEQYSSNLEDLIRE---RTEELEVERQKTDNLVAQMLPKSVAQSLKLGKPVEPEHFSEVTLYFSDIVGFSTISTLSEPIEVVDLLNDLYSLFDAIIPLHD 971          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Medaka
Match: olgc2 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125799])

HSP 1 Score: 63.929 bits (154), Expect = 2.864e-11
Identity = 35/93 (37.63%), Postives = 54/93 (58.06%), Query Frame = 3
Query:  465 ITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            + EL++E   R Q    EK+K+E LLYQ++P   A QL++   V+ + F+S SI F++I  F   +A   P E+V  LN ++  FD  I+  D
Sbjct:  832 LEELVEE---RTQAYHEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVSIYFSDIVGFTALSAESTPMEVVTLLNDLYTCFDAVIDNFD 921          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Planmine SMEST
Match: SMESG000060260.1 (SMESG000060260.1)

HSP 1 Score: 377.867 bits (969), Expect = 5.607e-128
Identity = 216/218 (99.08%), Postives = 216/218 (99.08%), Query Frame = 3
Query:    3 TDYYTIQLYTLMNNCRSDGISAGSWIAAGKLNSVNNSLNRLKYQINPNNITKYLTSEYMKTTFSPLINENFSIYCLQNQSAFVFLFIEYYEEFQSFHRXXXXXXXXXXRDLLSSDRTSQINWSISMAXXXXXXXXXXXXXXXXXQRKLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDF 656
            TDYYTIQLYTLMNNCRSDGISAGSWIAAGKLNSVNNSLNRLKYQINPNNITKYLTSEYMKTTFSPLINENFSIYCLQNQSAFVFLFIEYYEEFQSFHRSVVVQAVSSVRDLLSSDRTSQINWSISMALIFGFLLSFFSLCTFWFQRKLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISN  F
Sbjct:  176 TDYYTIQLYTLMNNCRSDGISAGSWIAAGKLNSVNNSLNRLKYQINPNNITKYLTSEYMKTTFSPLINENFSIYCLQNQSAFVFLFIEYYEEFQSFHRSVVVQAVSSVRDLLSSDRTSQINWSISMALIFGFLLSFFSLCTFWFQRKLHRKLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNLIF 393          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Planmine SMEST
Match: SMESG000041839.1 (SMESG000041839.1)

HSP 1 Score: 65.4698 bits (158), Expect = 5.451e-12
Identity = 32/84 (38.10%), Postives = 49/84 (58.33%), Query Frame = 3
Query:  483 ETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIE 734
            E + R +    EKK++E LLYQM+P+  A QLRQ + V+ + F+S SI F++I  F        P E++  LN ++  FD  I+
Sbjct:  924 EVMKRTEELREEKKQNEELLYQMLPIPVAEQLRQHKQVEAEAFDSVSIYFSDIVGFTELAGFCSPFEVINLLNQLYTSFDKIID 1007          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Planmine SMEST
Match: SMESG000056474.1 (SMESG000056474.1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.207e-11
Identity = 30/92 (32.61%), Postives = 55/92 (59.78%), Query Frame = 3
Query:  468 TELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
             +L ++  +R    ETE+KK+E L+ +M+P   A  L   +PV+P+ F+  +I F++I  F   +A+  P ++V  LN ++ +FD  I+ +D
Sbjct:  777 ADLEEQVRVRTDELETEQKKTELLIARMLPRMVAQSLLAGKPVEPESFDEVTIYFSDIVGFTTISALSNPMQVVDLLNDLYTMFDATIDFYD 868          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Planmine SMEST
Match: SMESG000005445.1 (SMESG000005445.1)

HSP 1 Score: 62.003 bits (149), Expect = 8.879e-11
Identity = 30/83 (36.14%), Postives = 46/83 (55.42%), Query Frame = 3
Query:  495 RKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            R Q    EK+++E LLY M+P   A QL +  PV  + FE  +I F++I  F   +A   P +++  LN ++ +FD   E HD
Sbjct:  914 RTQQYYEEKRRAEDLLYSMLPKSVAGQLIRGEPVTAESFEKVTIYFSDICGFTALSAESTPMQVITLLNNLYTLFDSITEDHD 996          
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Planmine SMEST
Match: SMESG000010241.1 (SMESG000010241.1)

HSP 1 Score: 59.3066 bits (142), Expect = 6.632e-10
Identity = 30/83 (36.14%), Postives = 48/83 (57.83%), Query Frame = 3
Query:  495 RKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKPKLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD 743
            R +    EKKK+E LLY M+P   A+QL + +PV  + ++  +I F++I  F   +A   P +I+  LN ++  FD  IE +D
Sbjct:  912 RTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYD 994          
The following BLAST results are available for this feature:
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPR18.749e-1135.48natriuretic peptide receptor 1 [Source:HGNC Symbol... [more]
GUCY1B11.586e-1037.76guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B11.674e-1037.76guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B11.686e-1037.76guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B11.793e-1037.76guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
back to top
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcy-62.444e-1234.44Receptor-type guanylate cyclase gcy-6 [Source:Uni... [more]
gcy-62.465e-1234.44Receptor-type guanylate cyclase gcy-6 [Source:Uni... [more]
gcy-75.271e-1234.78Receptor-type guanylate cyclase gcy-7 [Source:Uni... [more]
gcy-75.942e-1234.78Receptor-type guanylate cyclase gcy-7 [Source:Uni... [more]
gcy-228.329e-1233.70Receptor-type guanylate cyclase gcy-22 [Source:Un... [more]
back to top
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG339586.544e-1443.42gene:FBgn0053958 transcript:FBtr0099994[more]
Gycbeta100B1.241e-1134.00gene:FBgn0013973 transcript:FBtr0085753[more]
CG311833.500e-1137.63gene:FBgn0051183 transcript:FBtr0346151[more]
CG311833.500e-1137.63gene:FBgn0051183 transcript:FBtr0083187[more]
CG107388.304e-1135.56gene:FBgn0036368 transcript:FBtr0304792[more]
back to top
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gucy1b23.160e-1237.50guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;... [more]
gucy2d4.556e-1234.31guanylate cyclase 2D, retinal [Source:ZFIN;Acc:ZDB... [more]
gucy2d4.581e-1234.31guanylate cyclase 2D, retinal [Source:ZFIN;Acc:ZDB... [more]
gucy2d4.641e-1234.31guanylate cyclase 2D, retinal [Source:ZFIN;Acc:ZDB... [more]
gucy2d4.807e-1234.31guanylate cyclase 2D, retinal [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank14.223e-1239.77ankyrin 1 [Source:Xenbase;Acc:XB-GENE-5838516][more]
slc8a34.899e-1234.31solute carrier family 8 (sodium/calcium exchanger)... [more]
slc8a34.899e-1234.31solute carrier family 8 (sodium/calcium exchanger)... [more]
slc8a35.340e-1234.31solute carrier family 8 (sodium/calcium exchanger)... [more]
slc8a35.508e-1234.31solute carrier family 8 (sodium/calcium exchanger)... [more]
back to top
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gucy1b21.132e-1439.77guanylate cyclase 1, soluble, beta 2 [Source:MGI S... [more]
Gucy1b21.373e-1439.77guanylate cyclase 1, soluble, beta 2 [Source:MGI S... [more]
Gucy2e1.291e-1134.31guanylate cyclase 2e [Source:MGI Symbol;Acc:MGI:10... [more]
Gucy2e1.291e-1134.31guanylate cyclase 2e [Source:MGI Symbol;Acc:MGI:10... [more]
Gucy2e1.291e-1134.31guanylate cyclase 2e [Source:MGI Symbol;Acc:MGI:10... [more]
back to top
BLAST of guanylate cyclase soluble subunit beta-2-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P22717|GCYB2_RAT1.028e-1340.91Guanylate cyclase soluble subunit beta-2 OS=Rattus... [more]
sp|O75343|GCYB2_HUMAN2.372e-1239.08Guanylate cyclase soluble subunit beta-2 OS=Homo s... [more]
sp|N1NVB7|GCY6_CAEEL3.109e-1134.44Receptor-type guanylate cyclase gcy-6 OS=Caenorhab... [more]
sp|H2L002|GCY7_CAEEL6.705e-1134.78Receptor-type guanylate cyclase gcy-7 OS=Caenorhab... [more]
sp|P52785|GUC2E_MOUSE9.030e-1134.31Retinal guanylyl cyclase 1 OS=Mus musculus OX=1009... [more]
back to top
BLAST of guanylate cyclase soluble subunit beta-2-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G3PRL31.783e-1345.45Guanylate cyclase 1, soluble, beta 2 OS=Gasteroste... [more]
R7UFR92.346e-1243.42Guanylate cyclase domain-containing protein OS=Cap... [more]
A0A0F8ARX13.158e-1243.18Guanylate cyclase soluble subunit beta-2 OS=Larimi... [more]
A0A3Q1IDN33.394e-1242.05Guanylate cyclase 1, soluble, beta 2 OS=Anabas tes... [more]
A0A0F8AVG53.957e-1243.18Guanylate cyclase soluble subunit beta-2 OS=Larimi... [more]
back to top
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gucy1b22.137e-1339.77guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;... [more]
gucy1b22.234e-1339.77guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;... [more]
ENSAMXT00000016107.21.047e-1236.14pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
gc27.757e-1236.27retinal guanylyl cyclase 2 [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000020840.21.241e-1137.25retinal guanylyl cyclase 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gucy1b26.873e-1339.74guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;... [more]
ENSPMAT00000006352.12.800e-1136.56pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 ... [more]
ENSPMAT00000002650.19.417e-1133.71pep scaffold:Pmarinus_7.0:GL478983:4063:28109:1 ge... [more]
NPR12.594e-1035.56natriuretic peptide receptor 1 [Source:HGNC Symbol... [more]
ENSPMAT00000000043.17.392e-828.43pep scaffold:Pmarinus_7.0:GL480785:4349:14716:1 ge... [more]
back to top
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO449832.795e-1133.73Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362048.424e-1133.73Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279232.034e-1033.73Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362039.031e-1034.83Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470841.550e-932.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
olgc32.478e-1232.35membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
olgc32.490e-1232.35membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
olgc-r25.885e-1238.24guanylate cyclase OlGC-R2 [Source:NCBI gene;Acc:10... [more]
olgc56.919e-1232.35guanylate cyclase OlGC5 [Source:NCBI gene;Acc:1001... [more]
olgc22.864e-1137.63membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of guanylate cyclase soluble subunit beta-2-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060260.15.607e-12899.08SMESG000060260.1[more]
SMESG000041839.15.451e-1238.10SMESG000041839.1[more]
SMESG000056474.11.207e-1132.61SMESG000056474.1[more]
SMESG000005445.18.879e-1136.14SMESG000005445.1[more]
SMESG000010241.16.632e-1036.14SMESG000010241.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008141 ID=SMED30008141|Name=guanylate cyclase soluble subunit beta-2-like|organism=Schmidtea mediterranea sexual|type=transcript|length=743bp
TTACTGACTATTATACCATTCAGCTGTATACATTAATGAATAATTGTCGT
TCCGACGGGATAAGTGCCGGAAGTTGGATAGCCGCAGGGAAACTGAACTC
GGTGAATAATTCTCTGAATAGACTGAAATATCAAATAAATCCCAACAATA
TTACAAAATATCTCACATCCGAGTATATGAAAACAACATTTTCCCCTTTA
ATAAACGAAAACTTTTCGATATATTGTTTGCAGAACCAATCGGCATTTGT
GTTCTTGTTTATCGAGTATTATGAGGAATTTCAAAGTTTTCATCGGTCGG
TTGTTGTTCAAGCTGTCTCCAGTGTTCGAGATCTTCTTTCTTCGGACAGA
ACTTCACAGATCAACTGGTCTATATCAATGGCACTGATATTCGGATTTCT
CCTCAGTTTTTTTAGCCTGTGCACGTTTTGGTTTCAGCGAAAACTCCACC
GAAAACTGACCGTTATCACTGAGCTCATCGACGAGACAATTATCAGGAAA
CAACATCAGGAAACTGAGAAAAAGAAAAGCGAGACTTTATTATATCAAAT
GATTCCGGTTGAAGCGGCCAATCAGTTGCGACAAAAAAGACCTGTTAAAC
CGAAATTGTTCGAAAGTTGTTCAATATTGTTTACTGAAATTTCGAATTTT
GATTTTTTCACTGCCGTTCTTCCGCCAACTGAGATCGTGAGGTTCCTTAA
CCTTGTTTTCAATGTATTTGATGATGAAATAGAGTTACACGAC
back to top

protein sequence of SMED30008141-orf-1

>SMED30008141-orf-1 ID=SMED30008141-orf-1|Name=SMED30008141-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=247bp
TDYYTIQLYTLMNNCRSDGISAGSWIAAGKLNSVNNSLNRLKYQINPNNI
TKYLTSEYMKTTFSPLINENFSIYCLQNQSAFVFLFIEYYEEFQSFHRSV
VVQAVSSVRDLLSSDRTSQINWSISMALIFGFLLSFFSLCTFWFQRKLHR
KLTVITELIDETIIRKQHQETEKKKSETLLYQMIPVEAANQLRQKRPVKP
KLFESCSILFTEISNFDFFTAVLPPTEIVRFLNLVFNVFDDEIELHD
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR001054A/G_cyclase
IPR029787Nucleotide_cyclase
Vocabulary: biological process
TermDefinition
GO:0009190cyclic nucleotide biosynthetic process
GO:0035556intracellular signal transduction
GO:0006182cGMP biosynthetic process
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0016849phosphorus-oxygen lyase activity
GO:0000166nucleotide binding
GO:0004383guanylate cyclase activity
GO:0005525GTP binding
GO:0016829lyase activity
GO:0020037heme binding
GO:0043167ion binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005886plasma membrane
GO:0008074guanylate cyclase complex, soluble