Selenoprotein M

Overview
NameSelenoprotein M
Smed IDSMED30008140
Length (bp)1043
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Selenoprotein M (SMED30008140) t-SNE clustered cells

Violin plots show distribution of expression levels for Selenoprotein M (SMED30008140) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008140

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30008140 dd_Smed_v4_1611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30008140 dd_Smed_v4_1611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30008140 dd_Smed_v4_1611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30008140 Contig41367newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30008140 Contig41367uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Selenoprotein M vs. Ensembl Human
Match: SELENOM (selenoprotein M [Source:HGNC Symbol;Acc:HGNC:30397])

HSP 1 Score: 76.6406 bits (187), Expect = 2.274e-16
Identity = 37/96 (38.54%), Postives = 56/96 (58.33%), Query Frame = 2
Query:  209 IFKASVVSCGG*RLNALPEVKSFIRFDVPLFHNVQFNESPGADPVLYLLNSNNRFVTKFNLIDMTREECKNLLIHRGFFMKSKKEDEVPVKFRDGP 496
            + +A V +CGG +LN L EVK+F+  D+P +HN+     PGADP L LL      + +  L +MTREE   L+   GF+ K+  + +VP ++   P
Sbjct:   37 LTRARVETCGGUQLNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAP 132          
BLAST of Selenoprotein M vs. Ensembl Human
Match: SELENOM (selenoprotein M [Source:HGNC Symbol;Acc:HGNC:30397])

HSP 1 Score: 76.6406 bits (187), Expect = 2.274e-16
Identity = 37/96 (38.54%), Postives = 56/96 (58.33%), Query Frame = 2
Query:  209 IFKASVVSCGG*RLNALPEVKSFIRFDVPLFHNVQFNESPGADPVLYLLNSNNRFVTKFNLIDMTREECKNLLIHRGFFMKSKKEDEVPVKFRDGP 496
            + +A V +CGG +LN L EVK+F+  D+P +HN+     PGADP L LL      + +  L +MTREE   L+   GF+ K+  + +VP ++   P
Sbjct:   37 LTRARVETCGGUQLNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAP 132          
BLAST of Selenoprotein M vs. Ensembl Human
Match: SELENOM (selenoprotein M [Source:HGNC Symbol;Acc:HGNC:30397])

HSP 1 Score: 73.9442 bits (180), Expect = 2.236e-15
Identity = 37/96 (38.54%), Postives = 56/96 (58.33%), Query Frame = 2
Query:  209 IFKASVVSCGG*RLNALPEVKSFIRFDVPLFHNVQFNESPGADPVLYLLNSNNRFVTKFNLIDMTREECKNLLIHRGFFMKSKKEDEVPVKFRDGP 496
            + +A V +CGG +LN L EVK+F+  D+P +HN+     PGADP L LL      + +  L +MTREE   L+   GF+ K+  + +VP ++   P
Sbjct:   37 LTRARVETCGG-QLNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAP 131          
BLAST of Selenoprotein M vs. Ensembl Zebrafish
Match: selenom (selenoprotein M [Source:NCBI gene;Acc:352913])

HSP 1 Score: 85.5001 bits (210), Expect = 1.017e-19
Identity = 43/99 (43.43%), Postives = 59/99 (59.60%), Query Frame = 2
Query:  209 IFKASVVSCGG*RLNALPEVKSFIRFDVPLFHNVQFNESPGADPVLYLLNSNNRFVTKFNLIDMTREECKNLLIHRGFFMKSKKEDEVPVKFRDGPYGD 505
            + +A V +CGG +LN + EVK+F+  D+PL+HN+     PGADP L LLN     + +  L +MTR E   LL   GF+ K   ED+VP +FR  P  D
Sbjct:   27 LARARVETCGGUQLNRMREVKAFVTQDIPLYHNLVMKHIPGADPELVLLNHYYEELDRIPLSEMTRAEINKLLAELGFYKKDHPEDQVPEEFRFSPAKD 125          
BLAST of Selenoprotein M vs. Ensembl Mouse
Match: Selenom (selenoprotein M [Source:MGI Symbol;Acc:MGI:2149786])

HSP 1 Score: 77.411 bits (189), Expect = 7.359e-17
Identity = 38/98 (38.78%), Postives = 58/98 (59.18%), Query Frame = 2
Query:  203 KKIFKASVVSCGG*RLNALPEVKSFIRFDVPLFHNVQFNESPGADPVLYLLNSNNRFVTKFNLIDMTREECKNLLIHRGFFMKSKKEDEVPVKFRDGP 496
            + + +  V +CGG +LN L EVK+F+  D+ L+HN+     PGADP L LL+ N + + +  L  MTR+E   L+   GF+ KS  E +VP ++   P
Sbjct:   35 RGLARGRVETCGGUQLNRLKEVKAFVTEDIQLYHNLVMKHLPGADPELVLLSRNYQELERIPLSQMTRDEINALVQELGFYRKSAPEAQVPPEYLWAP 132          
BLAST of Selenoprotein M vs. UniProt/SwissProt
Match: sp|G4WAW9|SELM_ERISI (Selenoprotein M OS=Eriocheir sinensis OX=95602 GN=Selenom PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 9.979e-24
Identity = 45/100 (45.00%), Postives = 67/100 (67.00%), Query Frame = 2
Query:  200 DKKIFKASVVSCGG*RLNALPEVKSFIRFDVPLFHNVQFNESPGADPVLYLLNSNNRFVTKFNLIDMTREECKNLLIHRGFFMKSKKEDEVPVKFRDGPY 499
            DK + KA V SC G +LN  P  K FI+ D+PLFHN +F    GA P L LLN  ++ + +F+L  ++REE   L+I +GF+ KS K+++VP ++++GPY
Sbjct:   24 DKGVAKARVESCSGUQLNRYPGAKQFIQEDLPLFHNTKFQHIGGAAPELLLLNKQDQELERFDLKKLSREEINELMIKKGFYKKSSKDEQVPEEYQEGPY 123          
BLAST of Selenoprotein M vs. UniProt/SwissProt
Match: sp|Q802G7|SELM_DANRE (Selenoprotein M OS=Danio rerio OX=7955 GN=Selenom PE=2 SV=2)

HSP 1 Score: 85.8853 bits (211), Expect = 5.896e-19
Identity = 43/99 (43.43%), Postives = 59/99 (59.60%), Query Frame = 2
Query:  209 IFKASVVSCGG*RLNALPEVKSFIRFDVPLFHNVQFNESPGADPVLYLLNSNNRFVTKFNLIDMTREECKNLLIHRGFFMKSKKEDEVPVKFRDGPYGD 505
            + +A V +CGG +LN + EVK+F+  D+PL+HN+     PGADP L LLN     + +  L +MTR E   LL   GF+ K   ED+VP +FR  P  D
Sbjct:   27 LARARVETCGGUQLNRMREVKAFVTQDIPLYHNLVMKHIPGADPELVLLNHYYEELDRIPLSEMTRAEINKLLAELGFYKKGHPEDQVPEEFRFSPAKD 125          
BLAST of Selenoprotein M vs. UniProt/SwissProt
Match: sp|Q6GP98|SELM_XENLA (Selenoprotein M OS=Xenopus laevis OX=8355 GN=selenom PE=2 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 6.774e-18
Identity = 41/98 (41.84%), Postives = 58/98 (59.18%), Query Frame = 2
Query:  203 KKIFKASVVSCGG*RLNALPEVKSFIRFDVPLFHNVQFNESPGADPVLYLLNSNNRFVTKFNLIDMTREECKNLLIHRGFFMKSKKEDEVPVKFRDGP 496
            ++I +  V SCGG +LN L EVK F+  D+PL+HN++    PGADP L L+ S    + +  L DM R+E   LL   GF+ KS  +  VP +F+  P
Sbjct:   28 ERINRGKVESCGGUQLNRLKEVKGFVTEDLPLYHNLEMKHIPGADPELVLITSRYEELERIPLSDMKRDEINQLLKDLGFYRKSSPDAPVPAEFKMAP 125          
BLAST of Selenoprotein M vs. UniProt/SwissProt
Match: sp|Q8VHC3|SELM_MOUSE (Selenoprotein M OS=Mus musculus OX=10090 GN=Selenom PE=1 SV=3)

HSP 1 Score: 77.411 bits (189), Expect = 5.148e-16
Identity = 38/98 (38.78%), Postives = 58/98 (59.18%), Query Frame = 2
Query:  203 KKIFKASVVSCGG*RLNALPEVKSFIRFDVPLFHNVQFNESPGADPVLYLLNSNNRFVTKFNLIDMTREECKNLLIHRGFFMKSKKEDEVPVKFRDGP 496
            + + +  V +CGG +LN L EVK+F+  D+ L+HN+     PGADP L LL+ N + + +  L  MTR+E   L+   GF+ KS  E +VP ++   P
Sbjct:   35 RGLARGRVETCGGUQLNRLKEVKAFVTEDIQLYHNLVMKHLPGADPELVLLSRNYQELERIPLSQMTRDEINALVQELGFYRKSAPEAQVPPEYLWAP 132          
BLAST of Selenoprotein M vs. UniProt/SwissProt
Match: sp|Q8WWX9|SELM_HUMAN (Selenoprotein M OS=Homo sapiens OX=9606 GN=SELENOM PE=1 SV=3)

HSP 1 Score: 76.6406 bits (187), Expect = 1.092e-15
Identity = 37/96 (38.54%), Postives = 56/96 (58.33%), Query Frame = 2
Query:  209 IFKASVVSCGG*RLNALPEVKSFIRFDVPLFHNVQFNESPGADPVLYLLNSNNRFVTKFNLIDMTREECKNLLIHRGFFMKSKKEDEVPVKFRDGP 496
            + +A V +CGG +LN L EVK+F+  D+P +HN+     PGADP L LL      + +  L +MTREE   L+   GF+ K+  + +VP ++   P
Sbjct:   37 LTRARVETCGGUQLNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAP 132          
BLAST of Selenoprotein M vs. TrEMBL
Match: A0A1S3H6N6 (selenoprotein M-like OS=Lingula unguis OX=7574 GN=LOC106152566 PE=4 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 5.954e-25
Identity = 60/129 (46.51%), Postives = 76/129 (58.91%), Query Frame = 2
Query:  113 FLFVLVVCSVKAEDDDEDFDEYLPAIASDDKKIFKASVVSCGG*RLNALPEVKSFIRFDVPLFHNVQFNESPGADPVLYLLNSNNRFVTKFNLIDMTREECKNLLIHRGFFMKSKKEDEVPVKFRDGPY 499
             LF+LVV      + DED +         DK++  A V SC G RLN LPEVK FI  D+PLFHNV+F +  GA P L LLN     V + +L    REEC  LLI  GF+ KS K+++VP +F +GPY
Sbjct:    7 LLFILVVAIFAETEKDEDVE---------DKEVASARVESCAGURLNRLPEVKKFIFEDIPLFHNVEFKKVGGAPPDLLLLNKAGEVVKRIDLSKYNREECNQLLIDLGFYKKSDKDEDVPEEFLEGPY 126          
BLAST of Selenoprotein M vs. TrEMBL
Match: K9M8M2 (Selenoprotein M OS=Penaeus monodon OX=6687 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 3.926e-22
Identity = 48/97 (49.48%), Postives = 66/97 (68.04%), Query Frame = 2
Query:  209 IFKASVVSCGG*RLNALPEVKSFIRFDVPLFHNVQFNESPGADPVLYLLNSNNRFVTKFNLIDMTREECKNLLIHRGFFMKSKKEDEVPVKFRDGPY 499
            I KA V SCGG RLN LPEVK FI  D+PLFHN +F +  GA P L LLN  ++ V +  L  ++REEC  L++ +GF+ K+  ++EVP ++ +GPY
Sbjct:   29 IAKARVESCGGURLNRLPEVKKFIHEDIPLFHNAKFKQIGGAPPELVLLNRFDQVVERLPLDKLSREECNKLMLKKGFYKKNSPDEEVPEEYLNGPY 125          
BLAST of Selenoprotein M vs. TrEMBL
Match: T1G3I0 (Sep15_SelM domain-containing protein OS=Helobdella robusta OX=6412 GN=20215628 PE=4 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 8.005e-21
Identity = 46/90 (51.11%), Postives = 59/90 (65.56%), Query Frame = 2
Query:  245 RLNALPEVKSFIRFDVPLFHNVQFNESPGADPVLYLLNSNNRFVTKFNLIDMTREECKNLLIHRGFFMKSKKEDEVPVKFRDGPYGDEVK 514
            RLN  PEVK FI  D+PLFHNV+F   PGA P LY LN+ +  V   +L  + RE C  LLI +GFF ++   D VP +F+DGPYG+ V+
Sbjct:    1 RLNRYPEVKRFIFDDIPLFHNVEFKSVPGASPNLYFLNAQDEKVETVDLTQLDREGCNQLLIRKGFFKRNNPGDGVPPQFKDGPYGEHVE 90          
BLAST of Selenoprotein M vs. TrEMBL
Match: A5J2A1 (Selenoprotein M OS=Penaeus vannamei OX=6689 GN=SelM PE=2 SV=2)

HSP 1 Score: 94.3597 bits (233), Expect = 7.867e-20
Identity = 51/102 (50.00%), Postives = 69/102 (67.65%), Query Frame = 2
Query:  200 DKKIFKASVVSCGG*RLNALPEVKSFIRFDVPLFHNVQFNESPGADPVLYLLNSNNRFVTKFNLIDMTREECKNLLIHRGFFMKSKKEDEVPVKFRDGPYGD 505
            +  I KA V SCGG RLN LPEVK FI  D+PLFHN +F +  GA P L LLN  ++ V +  L  ++REEC  L++ +GF+ KS  E+EVP ++R+GPY +
Sbjct:   26 ETAIAKARVESCGGURLNRLPEVKKFIHEDIPLFHNAKFKQIGGAPPELVLLNRFDQVVERLPLDKLSREECNKLMLKKGFYKKSSPEEEVPEEYRNGPYTE 127          
BLAST of Selenoprotein M vs. TrEMBL
Match: R7UQI1 (Sep15_SelM domain-containing protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_146389 PE=4 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 2.803e-19
Identity = 44/86 (51.16%), Postives = 58/86 (67.44%), Query Frame = 2
Query:  245 RLNALPEVKSFIRFDVPLFHNVQFNESPGADPVLYLLNSNNRFVTKFNLIDMTREECKNLLIHRGFFMKSKKEDEVPVKFRDGPYG 502
            RLN LPEVK+FIR DV  FHNV++   PGA+P L+LLN+    V KF+L  + R+EC+ LL   GF+ K    +EVP +F+ GPY 
Sbjct:    1 RLNRLPEVKAFIREDVKFFHNVEYKAIPGANPDLFLLNAAGEKVQKFDLSKLNRKECEALLTDLGFYKKISSNEEVPEEFQKGPYA 86          
BLAST of Selenoprotein M vs. Ensembl Cavefish
Match: selenom (selenoprotein M [Source:NCBI gene;Acc:352913])

HSP 1 Score: 76.2554 bits (186), Expect = 1.724e-16
Identity = 38/81 (46.91%), Postives = 49/81 (60.49%), Query Frame = 2
Query:  263 EVKSFIRFDVPLFHNVQFNESPGADPVLYLLNSNNRFVTKFNLIDMTREECKNLLIHRGFFMKSKKEDEVPVKFRDGPYGD 505
            EVK+F+  D+PL+HN+     PGADP L LLN     + +  L DMTR E   LL   GF+ K++ EDEVP +FR  P  D
Sbjct:   33 EVKAFVTQDIPLYHNLVMKHIPGADPELVLLNHYYEELDRIPLSDMTRTEINKLLAELGFYKKAQPEDEVPEEFRFSPAKD 113          
BLAST of Selenoprotein M vs. Ensembl Medaka
Match: selenom (selenoprotein M-like [Source:NCBI gene;Acc:101173635])

HSP 1 Score: 73.9442 bits (180), Expect = 1.022e-15
Identity = 40/92 (43.48%), Postives = 54/92 (58.70%), Query Frame = 2
Query:  248 LNALPEVKSFIRFDVPLFHNVQFNESPGADPVLYLLNSNNRFVTKFNLIDMTREECKNLLIHRGFFMKSKKEDEVPVKFR-----DGPYGDE 508
            L+ L  VK+F+  D+PL+HN+     PGADP L LL+     + +  L  MTR E   LL+  GF+ K K+EDEVP +FR     D P+ DE
Sbjct:   37 LHPLIMVKAFVTQDIPLYHNLVMKHIPGADPELVLLSHYYDELDRIALSHMTRTEINELLVKLGFYKKEKQEDEVPEEFRFSPAKDSPFKDE 128          
The following BLAST results are available for this feature:
BLAST of Selenoprotein M vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SELENOM2.274e-1638.54selenoprotein M [Source:HGNC Symbol;Acc:HGNC:30397... [more]
SELENOM2.274e-1638.54selenoprotein M [Source:HGNC Symbol;Acc:HGNC:30397... [more]
SELENOM2.236e-1538.54selenoprotein M [Source:HGNC Symbol;Acc:HGNC:30397... [more]
back to top
BLAST of Selenoprotein M vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Selenoprotein M vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Selenoprotein M vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
selenom1.017e-1943.43selenoprotein M [Source:NCBI gene;Acc:352913][more]
back to top
BLAST of Selenoprotein M vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Selenoprotein M vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Selenom7.359e-1738.78selenoprotein M [Source:MGI Symbol;Acc:MGI:2149786... [more]
back to top
BLAST of Selenoprotein M vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|G4WAW9|SELM_ERISI9.979e-2445.00Selenoprotein M OS=Eriocheir sinensis OX=95602 GN=... [more]
sp|Q802G7|SELM_DANRE5.896e-1943.43Selenoprotein M OS=Danio rerio OX=7955 GN=Selenom ... [more]
sp|Q6GP98|SELM_XENLA6.774e-1841.84Selenoprotein M OS=Xenopus laevis OX=8355 GN=selen... [more]
sp|Q8VHC3|SELM_MOUSE5.148e-1638.78Selenoprotein M OS=Mus musculus OX=10090 GN=Seleno... [more]
sp|Q8WWX9|SELM_HUMAN1.092e-1538.54Selenoprotein M OS=Homo sapiens OX=9606 GN=SELENOM... [more]
back to top
BLAST of Selenoprotein M vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3H6N65.954e-2546.51selenoprotein M-like OS=Lingula unguis OX=7574 GN=... [more]
K9M8M23.926e-2249.48Selenoprotein M OS=Penaeus monodon OX=6687 PE=2 SV... [more]
T1G3I08.005e-2151.11Sep15_SelM domain-containing protein OS=Helobdella... [more]
A5J2A17.867e-2050.00Selenoprotein M OS=Penaeus vannamei OX=6689 GN=Sel... [more]
R7UQI12.803e-1951.16Sep15_SelM domain-containing protein (Fragment) OS... [more]
back to top
BLAST of Selenoprotein M vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
selenom1.724e-1646.91selenoprotein M [Source:NCBI gene;Acc:352913][more]
back to top
BLAST of Selenoprotein M vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Selenoprotein M vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Selenoprotein M vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Selenoprotein M vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
selenom1.022e-1543.48selenoprotein M-like [Source:NCBI gene;Acc:1011736... [more]
back to top
BLAST of Selenoprotein M vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008140 ID=SMED30008140|Name=Selenoprotein M|organism=Schmidtea mediterranea sexual|type=transcript|length=1043bp
ATTTAATTACGTAGTAGCTCATTATTCAAACGTTATATCTACCAATATAA
ATTTCACGTATTAAGTTATTTCCTTATTTCTCTAAATGGAGCTAAGGAAT
TTATACAAAGTTTTTTTATTTGTTTTGGTGGTTTGTTCTGTAAAAGCTGA
AGATGACGATGAAGATTTTGATGAATATTTACCAGCCATAGCTTCAGACG
ATAAAAAAATATTCAAGGCTTCGGTTGTGAGTTGTGGTGGATGAAGGTTA
AATGCTCTTCCGGAGGTCAAATCTTTCATTAGGTTTGATGTTCCGTTATT
TCACAATGTTCAGTTTAATGAATCTCCAGGTGCAGATCCTGTGTTGTATT
TATTGAATTCTAATAATAGATTTGTTACAAAATTCAATCTCATTGATATG
ACTCGTGAAGAATGCAAAAATCTTTTGATTCACCGTGGATTTTTTATGAA
AAGCAAGAAGGAAGACGAAGTCCCAGTGAAATTTAGAGATGGGCCATATG
GAGATGAAGTTAAAACCGATTTGTAATTCAAATTATTTTCCGTCAAGCTC
ACTTATGAAGAGGATTTTCAAAATCTCAATGAGAAAGGAAATCTTTTGAT
GTTAGAGCTGAATATTAAATAATTTGCATTTGTACAATTTTGTTTGTTGG
TGCTAGTGCGTTAATTACTCATTTACCGATAATAAATAGATTAAGAGCGC
ATTTGATTGCAATCGGCAATGTGTGTATGCATGTGGATTGATAATTGATT
GGTTTCCCATTTTATTTTATGCGACATTGCTCTTAATTTGAATAATCATT
CAACTGCCAATCACAATTGAGTTTTGTTGATTTCGATTTAAATTTGTTTT
TGATTATAATAATTGTTGAGATTGATATCGGTGACGTAATTTATTTGCGT
CAACACTTTGTAATATGAAATGAAAAACTGTTATTTAGGATTGTACTTGT
AAGTTATTAGCAGCGTTAAAATGTTTACTCTTGAAATTTTATATNNAAGA
TTTTTTGTTTATATCAAACTACAGTAACTTTTCTTAAAAAAAA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR014912Sep15_SelM
IPR012336Thioredoxin-like_fold