DjotxB protein

Overview
NameDjotxB protein
Smed IDSMED30008131
Uniprot Best hitHomeobox protein OTX1 B OS=Danio rerio OX=7955 GN=otx1b PE=2 SV=1 (E=2.22507e-17)
Length (bp)1726
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DjotxB protein (SMED30008131) t-SNE clustered cells

Violin plots show distribution of expression levels for DjotxB protein (SMED30008131) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DjotxB protein (SMED30008131) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DjotxB protein (SMED30008131) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008131

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30008131SMESG000023717.1 dd_Smed_v6_15516_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
cephalic gangliaSMED30008131SMESG000023717.1 SMED30008131smed_20140614PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30008131SMESG000023717.1 KJ934809smed_ncbi_20200123PMID:25254346
Scimone et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30008131SMESG000023717.1 SMED30008131smed_20140614PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30008131SMESG000023717.1 dd_Smed_v4_15516_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30008131SMESG000023717.1 dd_Smed_v4_15516_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ventral epidermisSMED30008131SMESG000023717.1 dd_Smed_v4_15516_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermis progenitor cellSMED30008131SMESG000023717.1 dd_Smed_v4_15516_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DjotxB protein vs. Ensembl Human
Match: OTX2 (orthodenticle homeobox 2 [Source:HGNC Symbol;Acc:HGNC:8522])

HSP 1 Score: 81.6481 bits (200), Expect = 1.408e-17
Identity = 46/69 (66.67%), Postives = 56/69 (81.16%), Query Frame = 1
Query:  568 HPAL-YQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 771
            HP++ Y    +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of DjotxB protein vs. Ensembl Human
Match: OTX1 (orthodenticle homeobox 1 [Source:HGNC Symbol;Acc:HGNC:8521])

HSP 1 Score: 85.5001 bits (210), Expect = 2.417e-17
Identity = 48/82 (58.54%), Postives = 62/82 (75.61%), Query Frame = 1
Query:  568 HPAL-YQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKPNSYTMP 810
            HP++ Y    +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+ +    + + P
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRP 107          
BLAST of DjotxB protein vs. Ensembl Human
Match: OTX1 (orthodenticle homeobox 1 [Source:HGNC Symbol;Acc:HGNC:8521])

HSP 1 Score: 85.5001 bits (210), Expect = 2.417e-17
Identity = 48/82 (58.54%), Postives = 62/82 (75.61%), Query Frame = 1
Query:  568 HPAL-YQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKPNSYTMP 810
            HP++ Y    +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+ +    + + P
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRP 107          
BLAST of DjotxB protein vs. Ensembl Human
Match: OTX2 (orthodenticle homeobox 2 [Source:HGNC Symbol;Acc:HGNC:8522])

HSP 1 Score: 82.4185 bits (202), Expect = 4.461e-17
Identity = 34/46 (73.91%), Postives = 40/46 (86.96%), Query Frame = 1
Query:  634 QLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 771
            QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   57 QLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 102          
BLAST of DjotxB protein vs. Ensembl Human
Match: OTX2 (orthodenticle homeobox 2 [Source:HGNC Symbol;Acc:HGNC:8522])

HSP 1 Score: 83.5741 bits (205), Expect = 4.477e-17
Identity = 46/69 (66.67%), Postives = 56/69 (81.16%), Query Frame = 1
Query:  568 HPAL-YQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 771
            HP++ Y    +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of DjotxB protein vs. Ensembl Celegans
Match: ttx-1 (pep chromosome:WBcel235:V:20053733:20059754:-1 gene:WBGene00006652.1 transcript:Y113G7A.6c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ttx-1)

HSP 1 Score: 85.5001 bits (210), Expect = 9.294e-18
Identity = 36/50 (72.00%), Postives = 43/50 (86.00%), Query Frame = 1
Query:  634 QLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSK 783
            QLEILE +F K RYPDIF+R++++ KI LPESRVQVWFKNRRAK RQ+ K
Sbjct:  173 QLEILESYFVKTRYPDIFMREDMAHKIQLPESRVQVWFKNRRAKARQQKK 222          
BLAST of DjotxB protein vs. Ensembl Celegans
Match: ttx-1 (pep chromosome:WBcel235:V:20053741:20064174:-1 gene:WBGene00006652.1 transcript:Y113G7A.6b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ttx-1)

HSP 1 Score: 85.1149 bits (209), Expect = 9.891e-18
Identity = 36/50 (72.00%), Postives = 43/50 (86.00%), Query Frame = 1
Query:  634 QLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSK 783
            QLEILE +F K RYPDIF+R++++ KI LPESRVQVWFKNRRAK RQ+ K
Sbjct:  157 QLEILESYFVKTRYPDIFMREDMAHKIQLPESRVQVWFKNRRAKARQQKK 206          
BLAST of DjotxB protein vs. Ensembl Celegans
Match: ttx-1 (pep chromosome:WBcel235:V:20053733:20064174:-1 gene:WBGene00006652.1 transcript:Y113G7A.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ttx-1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.171e-17
Identity = 36/50 (72.00%), Postives = 43/50 (86.00%), Query Frame = 1
Query:  634 QLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSK 783
            QLEILE +F K RYPDIF+R++++ KI LPESRVQVWFKNRRAK RQ+ K
Sbjct:  210 QLEILESYFVKTRYPDIFMREDMAHKIQLPESRVQVWFKNRRAKARQQKK 259          
BLAST of DjotxB protein vs. Ensembl Celegans
Match: ttx-1 (pep chromosome:WBcel235:V:20053733:20061420:-1 gene:WBGene00006652.1 transcript:Y113G7A.6d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ttx-1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.277e-17
Identity = 36/50 (72.00%), Postives = 43/50 (86.00%), Query Frame = 1
Query:  634 QLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSK 783
            QLEILE +F K RYPDIF+R++++ KI LPESRVQVWFKNRRAK RQ+ K
Sbjct:  198 QLEILESYFVKTRYPDIFMREDMAHKIQLPESRVQVWFKNRRAKARQQKK 247          
BLAST of DjotxB protein vs. Ensembl Celegans
Match: ceh-37 (Homeobox protein ceh-37 [Source:UniProtKB/Swiss-Prot;Acc:Q93356])

HSP 1 Score: 76.6406 bits (187), Expect = 2.703e-15
Identity = 33/54 (61.11%), Postives = 42/54 (77.78%), Query Frame = 1
Query:  631 QQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKP 792
            QQLEILE  F + +YPD+F R+ ++ +I L ESR+QVWFKNRRAK R + KQKP
Sbjct:   51 QQLEILETLFNETQYPDVFARERVADQIRLQESRIQVWFKNRRAKYRLQEKQKP 104          
BLAST of DjotxB protein vs. Ensembl Fly
Match: oc (gene:FBgn0004102 transcript:FBtr0331305)

HSP 1 Score: 82.0333 bits (201), Expect = 3.907e-16
Identity = 44/66 (66.67%), Postives = 54/66 (81.82%), Query Frame = 1
Query:  574 ALYQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 771
             ++ V  +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   58 GMWGVNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 123          
BLAST of DjotxB protein vs. Ensembl Fly
Match: oc (gene:FBgn0004102 transcript:FBtr0331738)

HSP 1 Score: 82.0333 bits (201), Expect = 3.907e-16
Identity = 44/66 (66.67%), Postives = 54/66 (81.82%), Query Frame = 1
Query:  574 ALYQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 771
             ++ V  +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   58 GMWGVNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 123          
BLAST of DjotxB protein vs. Ensembl Fly
Match: oc (gene:FBgn0004102 transcript:FBtr0300106)

HSP 1 Score: 82.0333 bits (201), Expect = 3.907e-16
Identity = 44/66 (66.67%), Postives = 54/66 (81.82%), Query Frame = 1
Query:  574 ALYQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 771
             ++ V  +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   58 GMWGVNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 123          
BLAST of DjotxB protein vs. Ensembl Fly
Match: oc (gene:FBgn0004102 transcript:FBtr0474137)

HSP 1 Score: 81.6481 bits (200), Expect = 6.952e-16
Identity = 44/66 (66.67%), Postives = 54/66 (81.82%), Query Frame = 1
Query:  574 ALYQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 771
             ++ V  +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   58 GMWGVNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 123          
BLAST of DjotxB protein vs. Ensembl Fly
Match: oc (gene:FBgn0004102 transcript:FBtr0331306)

HSP 1 Score: 80.8777 bits (198), Expect = 1.004e-15
Identity = 34/46 (73.91%), Postives = 40/46 (86.96%), Query Frame = 1
Query:  634 QLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 771
            QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   75 QLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 120          
BLAST of DjotxB protein vs. Ensembl Zebrafish
Match: otx1 (orthodenticle homeobox 1 [Source:NCBI gene;Acc:30500])

HSP 1 Score: 87.0409 bits (214), Expect = 2.948e-18
Identity = 50/82 (60.98%), Postives = 63/82 (76.83%), Query Frame = 1
Query:  568 HPAL-YQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKPNSYTMP 810
            HP++ Y    +K RR+RTTFTR QL+ILE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+ +   ++ T P
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRSQLDILEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSSTKTRP 107          
BLAST of DjotxB protein vs. Ensembl Zebrafish
Match: otx1 (orthodenticle homeobox 1 [Source:NCBI gene;Acc:30500])

HSP 1 Score: 87.0409 bits (214), Expect = 2.948e-18
Identity = 50/82 (60.98%), Postives = 63/82 (76.83%), Query Frame = 1
Query:  568 HPAL-YQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKPNSYTMP 810
            HP++ Y    +K RR+RTTFTR QL+ILE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+ +   ++ T P
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRSQLDILEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSSTKTRP 107          
BLAST of DjotxB protein vs. Ensembl Zebrafish
Match: otx2b (orthodenticle homeobox 2b [Source:NCBI gene;Acc:30501])

HSP 1 Score: 83.1889 bits (204), Expect = 6.888e-18
Identity = 46/69 (66.67%), Postives = 56/69 (81.16%), Query Frame = 1
Query:  568 HPAL-YQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 771
            HP++ Y    +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of DjotxB protein vs. Ensembl Zebrafish
Match: otx2b (orthodenticle homeobox 2b [Source:NCBI gene;Acc:30501])

HSP 1 Score: 83.5741 bits (205), Expect = 2.902e-17
Identity = 46/69 (66.67%), Postives = 56/69 (81.16%), Query Frame = 1
Query:  568 HPAL-YQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 771
            HP++ Y    +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of DjotxB protein vs. Ensembl Zebrafish
Match: otx2b (orthodenticle homeobox 2b [Source:NCBI gene;Acc:30501])

HSP 1 Score: 83.5741 bits (205), Expect = 2.902e-17
Identity = 46/69 (66.67%), Postives = 56/69 (81.16%), Query Frame = 1
Query:  568 HPAL-YQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 771
            HP++ Y    +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of DjotxB protein vs. Ensembl Xenopus
Match: otx2 (orthodenticle homeobox 2 [Source:NCBI gene;Acc:548931])

HSP 1 Score: 83.5741 bits (205), Expect = 4.333e-17
Identity = 46/69 (66.67%), Postives = 56/69 (81.16%), Query Frame = 1
Query:  568 HPAL-YQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 771
            HP++ Y    +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of DjotxB protein vs. Ensembl Xenopus
Match: tnnt1 (troponin T1, slow skeletal type [Source:Xenbase;Acc:XB-GENE-481588])

HSP 1 Score: 83.1889 bits (204), Expect = 5.453e-17
Identity = 35/46 (76.09%), Postives = 40/46 (86.96%), Query Frame = 1
Query:  634 QLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 771
            QL+ILE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   49 QLDILEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of DjotxB protein vs. Ensembl Xenopus
Match: otx1 (orthodenticle homeobox 1 [Source:NCBI gene;Acc:394824])

HSP 1 Score: 75.485 bits (184), Expect = 3.593e-14
Identity = 45/71 (63.38%), Postives = 55/71 (77.46%), Query Frame = 1
Query:  568 HPAL-YQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVW--FKNRRAKER 771
            HP++ Y    +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVW   KNRRAK R
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWGLVKNRRAKCR 96          
BLAST of DjotxB protein vs. Ensembl Xenopus
Match: stx19 (syntaxin 19 [Source:Xenbase;Acc:XB-GENE-5749239])

HSP 1 Score: 73.559 bits (179), Expect = 1.949e-13
Identity = 39/70 (55.71%), Postives = 50/70 (71.43%), Query Frame = 1
Query:  574 ALYQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSK 783
            A Y   ++K RR RT FT QQLE LE  F+K  YPD+ +R+ ++   NLPE+RVQVWFKNRRAK R+K +
Sbjct:   62 ARYGSQHRKQRRSRTAFTAQQLEALEKTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKKQR 131          
BLAST of DjotxB protein vs. Ensembl Xenopus
Match: ENSXETT00000028778.1 (retina and anterior neural fold homeobox [Source:NCBI gene;Acc:100038124])

HSP 1 Score: 73.1738 bits (178), Expect = 2.016e-13
Identity = 41/67 (61.19%), Postives = 52/67 (77.61%), Query Frame = 1
Query:  583 QVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSK 783
            Q P KK RR+RTTFT  QL  LE  FEK+ YPD++ R+E++ K+NLPE RVQVWF+NRRAK R++ K
Sbjct:  125 QQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEK 191          
BLAST of DjotxB protein vs. Ensembl Mouse
Match: Otx1 (orthodenticle homeobox 1 [Source:MGI Symbol;Acc:MGI:97450])

HSP 1 Score: 82.8037 bits (203), Expect = 3.585e-18
Identity = 49/82 (59.76%), Postives = 62/82 (75.61%), Query Frame = 1
Query:  568 HPAL-YQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKPNSYTMP 810
            HP++ Y    +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+ +    + T P
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGNGTKTRP 107          
BLAST of DjotxB protein vs. Ensembl Mouse
Match: Otx2 (orthodenticle homeobox 2 [Source:MGI Symbol;Acc:MGI:97451])

HSP 1 Score: 83.1889 bits (204), Expect = 8.062e-18
Identity = 46/69 (66.67%), Postives = 56/69 (81.16%), Query Frame = 1
Query:  568 HPAL-YQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 771
            HP++ Y    +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of DjotxB protein vs. Ensembl Mouse
Match: Otx1 (orthodenticle homeobox 1 [Source:MGI Symbol;Acc:MGI:97450])

HSP 1 Score: 85.5001 bits (210), Expect = 1.502e-17
Identity = 49/82 (59.76%), Postives = 62/82 (75.61%), Query Frame = 1
Query:  568 HPAL-YQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKPNSYTMP 810
            HP++ Y    +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+ +    + T P
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGNGTKTRP 107          
BLAST of DjotxB protein vs. Ensembl Mouse
Match: Otx2 (orthodenticle homeobox 2 [Source:MGI Symbol;Acc:MGI:97451])

HSP 1 Score: 83.5741 bits (205), Expect = 3.221e-17
Identity = 46/69 (66.67%), Postives = 56/69 (81.16%), Query Frame = 1
Query:  568 HPAL-YQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 771
            HP++ Y    +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of DjotxB protein vs. Ensembl Mouse
Match: Otx2 (orthodenticle homeobox 2 [Source:MGI Symbol;Acc:MGI:97451])

HSP 1 Score: 83.5741 bits (205), Expect = 3.221e-17
Identity = 46/69 (66.67%), Postives = 56/69 (81.16%), Query Frame = 1
Query:  568 HPAL-YQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 771
            HP++ Y    +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of DjotxB protein vs. UniProt
Match: sp|Q91994|OTX1B_DANRE (Homeobox protein OTX1 B OS=Danio rerio OX=7955 GN=otx1b PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 2.225e-17
Identity = 50/82 (60.98%), Postives = 63/82 (76.83%), Query Frame = 1
Query:  568 HPAL-YQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKPNSYTMP 810
            HP++ Y    +K RR+RTTFTR QL+ILE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+ +   ++ T P
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRSQLDILEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSSTKTRP 107          
BLAST of DjotxB protein vs. UniProt
Match: sp|P80205|OTX1_MOUSE (Homeobox protein OTX1 OS=Mus musculus OX=10090 GN=Otx1 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.050e-16
Identity = 49/82 (59.76%), Postives = 62/82 (75.61%), Query Frame = 1
Query:  568 HPAL-YQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKPNSYTMP 810
            HP++ Y    +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+ +    + T P
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGNGTKTRP 107          
BLAST of DjotxB protein vs. UniProt
Match: sp|P32242|OTX1_HUMAN (Homeobox protein OTX1 OS=Homo sapiens OX=9606 GN=OTX1 PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.161e-16
Identity = 48/82 (58.54%), Postives = 62/82 (75.61%), Query Frame = 1
Query:  568 HPAL-YQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKPNSYTMP 810
            HP++ Y    +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+ +    + + P
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRP 107          
BLAST of DjotxB protein vs. UniProt
Match: sp|Q6DKN2|OTX2B_XENLA (Homeobox protein OTX2-B OS=Xenopus laevis OX=8355 GN=otx2-b PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.451e-16
Identity = 47/69 (68.12%), Postives = 56/69 (81.16%), Query Frame = 1
Query:  568 HPAL-YQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 771
            HP++ Y    +K RR+RTTFTR QL+ILE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRAQLDILEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of DjotxB protein vs. UniProt
Match: sp|Q63410|OTX1_RAT (Homeobox protein OTX1 OS=Rattus norvegicus OX=10116 GN=Otx1 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 2.093e-16
Identity = 47/71 (66.20%), Postives = 58/71 (81.69%), Query Frame = 1
Query:  568 HPAL-YQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQK 777
            HP++ Y    +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQ 96          
BLAST of DjotxB protein vs. TrEMBL
Match: gnl|BL_ORD_ID|19620017 (tr|A8C1Q2|A8C1Q2_DUGJA DjotxB protein OS=Dugesia japonica OX=6161 GN=DjotxB PE=2 SV=1)

HSP 1 Score: 651.744 bits (1680), Expect = 0.000e+0
Identity = 395/496 (79.64%), Postives = 437/496 (88.10%), Query Frame = 1
Query:  178 MFLSQPMHPTNHLSMFPYSQAFTSSECGYPTINSSTYSQYPISAIEQAFSGFNSNVNLSSTSVEKSISATA-VGSSETCLNSRESLWTTASGYQPQLAPQYSFDHNAMXXXXXXXXXXXXXXXXXXXXXXQHPALYQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKPNSYTMPPEQMPALSDKHLLHRMASMKNGSHLKEKIKISQDLPDNRGINELNCVNDSINSSDKFVKSDGKKNPKPKIKEXXXXXX-XXXXXXXXAKSLPXXXXXXXXXXXXXXXXXXXXXDPRSPEQKPFYPEYINKYSSWLNGNNAFGCDNNLWSARHKPIMTSHDNPFTTSCLTGQQERNSLLISSQNAELNSSTSLVPPSTNFLRYFDHSSTDQSIMDPSCNPA-----NMFCDLPNEGYINGYTHNFYNYSPKFSSGTLSNYNDSYPPTASWPLTMSGHRDFGQWTQ 1644
            MFLSQ MHPT+HL +FPYSQAFTSSECGYP INSSTYSQYPISAIEQAFSGFNSNVNLS TS +KSISATA VG+SETCLNSRESLWTTASGYQPQLAPQYSFD NAM AASALALATGGSSFPSSPYFPQHPALYQVPNKKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKPN Y+MPPEQ+P+L DKHLLHRM ++KNG H+KEK+K+  D+ D+R  N   C +DS + SDKF+KS+ KKN KPK KENQ S G SIK+  ++ K+LP+K++T+ +TNS+NNISP  +ID RSPEQKPFYPEYINKYS+WLNGNNAF C+NN+W  RHK IM SH+N F T+ L  QQERNSLLI  QN E+NSS S+VPPSTNFLRYFDHSSTDQSIMDP+CNPA     NMFCDLPNEGYINGY+HNFYNYSPKFSSG LSNY+DSYP TA+WPLTM  ++DFGQWTQ
Sbjct:    1 MFLSQQMHPTSHLPIFPYSQAFTSSECGYPPINSSTYSQYPISAIEQAFSGFNSNVNLS-TSTDKSISATAAVGTSETCLNSRESLWTTASGYQPQLAPQYSFDQNAMAAASALALATGGSSFPSSPYFPQHPALYQVPNKKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKPNGYSMPPEQLPSLPDKHLLHRMTTIKNG-HMKEKVKMCTDILDSRATN---CSSDSNHHSDKFMKSESKKNSKPKNKENQHSVGPSIKSNNSNIKTLPLKTDTNNMTNSSNNISPPTNIDTRSPEQKPFYPEYINKYSNWLNGNNAFACENNIWGTRHKSIMQSHENLFATNSLAVQQERNSLLIPPQNNEVNSSASIVPPSTNFLRYFDHSSTDQSIMDPTCNPANMLNGNMFCDLPNEGYINGYSHNFYNYSPKFSSGALSNYSDSYPHTATWPLTMPTNKDFGQWTQ 491          
BLAST of DjotxB protein vs. TrEMBL
Match: gnl|BL_ORD_ID|23068716 (tr|T1E106|T1E106_9PLAT OtxB OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 401.364 bits (1030), Expect = 5.840e-131
Identity = 271/499 (54.31%), Postives = 345/499 (69.14%), Query Frame = 1
Query:  178 MFLSQPMHPTNHLSMFPYSQAFTSSECGYPTINSSTYSQYPISAIEQAFSGFNSNVNLSSTSVEKSISATAVGSSETCLNSRESLWTTASGYQPQLAPQYSFDHNAMXXXXXXXXXXXXXXXXXXXXXXQHPALYQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKPNSYTMPPEQMPALSDKHLLHRMASMK-NGSHLKEKIKISQDLPDNRGINELNCVNDSINSSDKFVKSDGKKNPKPKIKEXXXXXXXXXXXXXXAKSLPXXXXXXXXXXXXXXXXXXXXXDPRSPEQKPFYPEYINKYSSWLNGNNAFGCDNNLWSARHKPIMTSHDNPFTTSCLTGQQ----ERNSLLISSQNAELNSSTSLVPPSTNFLRYFDHSSTDQSIMDPSCNPA-----NMFCDLPNEGYINGYTHNFYNYSPKFSSGTLSNYNDSYPPTASWPLTMSGHRDFGQWTQ 1644
            MFLSQP+HP NHLSMFPYSQAFT S+  Y   +S   SQYPISAIEQAFSGFN+  ++ S S EKSI   +VGS++ CLN+RESLW++ASGYQPQL  QYSFD NAM AASA+ALA G SSFP+SPYFPQHP+LYQVPNKKTRRDRTTFTRQQLE+LE+HFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQK+KQKPN+Y +   Q  +L DK++ HR++  K N +  KEKIK++ ++P+ R    ++CV D  +  DK +KS+ K++ K K K+  + NGS     ++++  P     S  + +    SP       SP+ K  YPEYI KYS WLN +  F  DNN W  R K I  ++DN F+++ +   Q    ER++    +  +  N+S  +VP + NFLR F++ +T+  I+DPSC        NMFCDLP++ Y+ GY   FYNYS K  S  L+ YN+SY PT  W L M    +FG+W+Q
Sbjct:    1 MFLSQPVHPNNHLSMFPYSQAFTGSDYSYSMASSQNPSQYPISAIEQAFSGFNAGTSVQSMS-EKSIPPPSVGSTDNCLNNRESLWSSASGYQPQLNTQYSFDQNAMAAASAIALAAGTSSFPNSPYFPQHPSLYQVPNKKTRRDRTTFTRQQLEVLEIHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQKPNNYNIQAVQNQSLQDKNVQHRISIGKHNHTAFKEKIKMNNEIPEMR---IMDCVIDQSSIQDKALKSEMKRSSKSKSKD--NQNGSSLKQNHNSQKSPSHKPESLHSTNPIISSPTMKPIKTSPDHKSLYPEYITKYSHWLNDSPTFNSDNNFWMNRQKSIHQTNDNLFSSNNIIPPQISPVERHNGTFHTPISGGNASNIMVPNTANFLRCFENPTTESQIIDPSCPSTSMLGNNMFCDLPSDNYMTGYPGPFYNYSSKLQSNGLNAYNNSYHPTGPWTLGMPIKGEFGEWSQ 493          
BLAST of DjotxB protein vs. TrEMBL
Match: gnl|BL_ORD_ID|20909728 (tr|H6V049|H6V049_SCHPL OTX-B (Fragment) OS=Schmidtea polychroa OX=50054 GN=otxB PE=2 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 1.025e-85
Identity = 129/136 (94.85%), Postives = 132/136 (97.06%), Query Frame = 1
Query: 1201 SSWLNGNNAFGCDNNLWSARHKPIMTSHDNPFTTSCLTGQQERNSLLISSQNAELNSSTSLVPPSTNFLRYFDHSSTDQSIMDPSCNPANMFCDLPNEGYINGYTHNFYNYSPKFSSGTLSNYNDSYPPTASWPLT 1608
            SSWLNGNNAFGCDNNLWS RHKPIM+SHDNPFTTSCLTGQ ERNSLLI SQNAE+NSSTSLVPP TNFLRYFDHSSTDQSIMDP+CNPANMFCDLPNEGYINGYTHNFYNYSPKFSSGTLSNYNDSYPPTASWPLT
Sbjct:    1 SSWLNGNNAFGCDNNLWSTRHKPIMSSHDNPFTTSCLTGQHERNSLLIPSQNAEVNSSTSLVPPLTNFLRYFDHSSTDQSIMDPTCNPANMFCDLPNEGYINGYTHNFYNYSPKFSSGTLSNYNDSYPPTASWPLT 136          
BLAST of DjotxB protein vs. TrEMBL
Match: gnl|BL_ORD_ID|22493278 (tr|Q9U084|Q9U084_GIRTI Homeobox protein (Fragment) OS=Girardia tigrina OX=6162 GN=Otx PE=2 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 1.928e-65
Identity = 120/154 (77.92%), Postives = 137/154 (88.96%), Query Frame = 1
Query:  565 QHPALYQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKPNSYTMPPEQMPALSDKHLLHRMASMKNGSHLKEKIKISQDLPDNRGINELNCVNDSINSSDKFVKSDGKKNPKPKIKE 1026
            QHPALYQVPNKKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKPN YT+ PE +PAL DKH+L+RM ++K G +LK+K+KI Q++PD R  NEL+C+ DS N+ DKF+KS+ +KNPK K KE
Sbjct:   20 QHPALYQVPNKKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKPNGYTIQPEPLPALPDKHILNRMTAIKTG-NLKDKMKICQEIPDLRVTNELSCLTDSNNTPDKFIKSENRKNPKTKNKE 172          
BLAST of DjotxB protein vs. TrEMBL
Match: gnl|BL_ORD_ID|20349207 (tr|H9B8J3|H9B8J3_SCHMD OtxA OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 2.704e-26
Identity = 71/77 (92.21%), Postives = 73/77 (94.81%), Query Frame = 1
Query:  565 QHPALYQVPN--KKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQK 789
            QHPALYQV    KKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQK+KQ+
Sbjct:  141 QHPALYQVGAQVKKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQR 217          
BLAST of DjotxB protein vs. Ensembl Cavefish
Match: otx2a (orthodenticle homeobox 1 [Source:NCBI gene;Acc:103037567])

HSP 1 Score: 85.8853 bits (211), Expect = 1.022e-17
Identity = 49/71 (69.01%), Postives = 58/71 (81.69%), Query Frame = 1
Query:  568 HPAL-YQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQK 777
            HPA+ Y    +K RR+RTTFTR QL+ILE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+
Sbjct:   26 HPAVGYPANPRKQRRERTTFTRTQLDILESLFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQ 96          
BLAST of DjotxB protein vs. Ensembl Cavefish
Match: otx1 (homeobox protein OTX1 B [Source:NCBI gene;Acc:103033915])

HSP 1 Score: 84.7297 bits (208), Expect = 1.494e-17
Identity = 36/48 (75.00%), Postives = 42/48 (87.50%), Query Frame = 1
Query:  634 QLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQK 777
            QL+ILE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+
Sbjct:   50 QLDILEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQ 97          
BLAST of DjotxB protein vs. Ensembl Cavefish
Match: OTX2 (orthodenticle homeobox 2 [Source:NCBI gene;Acc:103046890])

HSP 1 Score: 82.8037 bits (203), Expect = 2.788e-17
Identity = 46/69 (66.67%), Postives = 55/69 (79.71%), Query Frame = 1
Query:  568 HPAL-YQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 771
            HP + Y    +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   26 HPTVGYPAVPRKQRRERTTFTRAQLDVLEAMFAKTRYPDIFMREEVAMKINLPESRVQVWFKNRRAKCR 94          
BLAST of DjotxB protein vs. Ensembl Cavefish
Match: ENSAMXT00000021580.2 (homeobox protein otx5-like [Source:NCBI gene;Acc:103033864])

HSP 1 Score: 83.1889 bits (204), Expect = 3.085e-17
Identity = 46/64 (71.88%), Postives = 53/64 (82.81%), Query Frame = 1
Query:  580 YQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 771
            YQ   +K RR+RTTFTR QL+ILE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   31 YQNTPRKQRRERTTFTRAQLDILEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of DjotxB protein vs. Ensembl Cavefish
Match: OTX2 (homeobox protein OTX2 [Source:NCBI gene;Acc:103027403])

HSP 1 Score: 83.1889 bits (204), Expect = 3.741e-17
Identity = 46/69 (66.67%), Postives = 56/69 (81.16%), Query Frame = 1
Query:  568 HPAL-YQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 771
            HP++ Y    +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of DjotxB protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010761.1 (pep scaffold:Pmarinus_7.0:GL476415:928307:936594:-1 gene:ENSPMAG00000009746.1 transcript:ENSPMAT00000010761.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.0258 bits (188), Expect = 7.361e-18
Identity = 45/61 (73.77%), Postives = 53/61 (86.89%), Query Frame = 1
Query:  589 PNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 771
            PN+K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:    2 PNRKQRRERTTFTRAQLDVLEALFSKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 62          
BLAST of DjotxB protein vs. Ensembl Sea Lamprey
Match: dmbx1b (diencephalon/mesencephalon homeobox 1b [Source:NCBI gene;Acc:550288])

HSP 1 Score: 70.8626 bits (172), Expect = 1.487e-13
Identity = 30/51 (58.82%), Postives = 39/51 (76.47%), Query Frame = 1
Query:  631 QQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSK 783
            QQLE LE  F+K  YPD+ +R+ ++   NLPE+RVQVWFKNRRAK R+K +
Sbjct:   53 QQLEALEKTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKKQR 103          
BLAST of DjotxB protein vs. Ensembl Sea Lamprey
Match: otx5 (orthodenticle homolog 5 [Source:ZFIN;Acc:ZDB-GENE-030508-1])

HSP 1 Score: 62.3882 bits (150), Expect = 4.680e-11
Identity = 46/85 (54.12%), Postives = 58/85 (68.24%), Query Frame = 1
Query:  568 HPAL-YQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKPNSYTMPPEQ 819
            HPAL Y    +K RR+RTTFTR QL+ LE  F K RYPDIF+R+E++ KINLPESRVQ+ F   R K    S+ +P + + PP Q
Sbjct:   26 HPALGYPAAPRKQRRERTTFTRAQLD-LESLFSKTRYPDIFMREEVALKINLPESRVQINFPESRVK-LGPSRCQPLTSSGPPPQ 108          
BLAST of DjotxB protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000987.1 (pep scaffold:Pmarinus_7.0:GL477479:61561:69115:-1 gene:ENSPMAG00000000895.1 transcript:ENSPMAT00000000987.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.2098 bits (108), Expect = 1.142e-6
Identity = 22/49 (44.90%), Postives = 33/49 (67.35%), Query Frame = 1
Query:  631 QQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQK 777
            Q+ E LE  F  NRY +I  + EI++ + L E +V++WF+NRRAKE  +
Sbjct:   20 QRFE-LEKEFHFNRYINIRRKAEIAASLGLTERQVKIWFQNRRAKETTR 67          
BLAST of DjotxB protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000988.1 (pep scaffold:Pmarinus_7.0:GL477479:64107:69103:-1 gene:ENSPMAG00000000895.1 transcript:ENSPMAT00000000988.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.4394 bits (106), Expect = 3.122e-6
Identity = 22/46 (47.83%), Postives = 32/46 (69.57%), Query Frame = 1
Query:  631 QQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKE 768
            Q+ E LE  F  NRY +I  + EI++ + L E +V++WF+NRRAKE
Sbjct:   16 QRFE-LEKEFHFNRYINIRRKAEIAASLGLTERQVKIWFQNRRAKE 60          
BLAST of DjotxB protein vs. Ensembl Yeast
Match: PHO2 (Homeobox transcription factor; regulatory targets include genes involved in phosphate metabolism; binds cooperatively with Pho4p to the PHO5 promoter; phosphorylation of Pho2p facilitates interaction with Pho4p; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000002264])

HSP 1 Score: 52.7582 bits (125), Expect = 9.811e-8
Identity = 26/63 (41.27%), Postives = 39/63 (61.90%), Query Frame = 1
Query:  631 QQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKPNSYTMPPEQ 819
            + L++L+  FE N  P +  R +IS  I +PE  V++WF+NRRAK R+K +   N  T+P  Q
Sbjct:   87 EALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRKK-QHGSNKDTIPSSQ 148          
BLAST of DjotxB protein vs. Ensembl Nematostella
Match: OTXC (OtxC; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKM4])

HSP 1 Score: 85.1149 bits (209), Expect = 9.202e-19
Identity = 48/65 (73.85%), Postives = 55/65 (84.62%), Query Frame = 1
Query:  589 PNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSK 783
            P +K RR+RTTFT+ QLEILE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ SK
Sbjct:   37 PPRKQRRERTTFTKNQLEILEELFAKTRYPDIFMREEVAIKINLPESRVQVWFKNRRAKLRQLSK 101          
BLAST of DjotxB protein vs. Ensembl Nematostella
Match: EDO35749 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKM2])

HSP 1 Score: 79.7221 bits (195), Expect = 1.340e-18
Identity = 46/65 (70.77%), Postives = 54/65 (83.08%), Query Frame = 1
Query:  589 PNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSK 783
            P +K RR+RTTFT+ QLE+LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ  K
Sbjct:    8 PTRKQRRERTTFTKNQLEVLEELFAKTRYPDIFMREEVAIKINLPESRVQVWFKNRRAKTRQLEK 72          
BLAST of DjotxB protein vs. Ensembl Nematostella
Match: OTX (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKM3])

HSP 1 Score: 77.411 bits (189), Expect = 7.071e-18
Identity = 45/61 (73.77%), Postives = 53/61 (86.89%), Query Frame = 1
Query:  595 KKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQK 777
            +K RR+RTTFT+ QLEILE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+
Sbjct:    2 RKQRRERTTFTKNQLEILEELFAKTRYPDIFMREEVAIKINLPESRVQVWFKNRRAKARQQ 62          
BLAST of DjotxB protein vs. Ensembl Nematostella
Match: EDO38664 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCD3])

HSP 1 Score: 71.2478 bits (173), Expect = 7.419e-16
Identity = 30/51 (58.82%), Postives = 42/51 (82.35%), Query Frame = 1
Query:  631 QQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSK 783
            QQL+ILE  F K  YPD+ +R+++++ IN+PESR+QVWFKNRRAK R++ K
Sbjct:    4 QQLQILESTFSKTHYPDVVMREQLAAYINIPESRIQVWFKNRRAKYRKQVK 54          
BLAST of DjotxB protein vs. Ensembl Nematostella
Match: GSC (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S024])

HSP 1 Score: 70.8626 bits (172), Expect = 4.511e-14
Identity = 29/56 (51.79%), Postives = 44/56 (78.57%), Query Frame = 1
Query:  631 QQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKPNS 798
            +QLE+LE  F+K  YPD+ LR+E++ K++L E RV+VWFKNRRAK R++ ++  +S
Sbjct:   84 EQLELLETTFQKTHYPDVLLREELAMKVDLKEERVEVWFKNRRAKWRKQKREAVDS 139          
BLAST of DjotxB protein vs. Ensembl Medaka
Match: otx1 (homeobox protein OTX1 B-like [Source:NCBI gene;Acc:101163925])

HSP 1 Score: 86.6557 bits (213), Expect = 8.473e-18
Identity = 37/62 (59.68%), Postives = 48/62 (77.42%), Query Frame = 1
Query:  634 QLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKPNSYTMPPEQ 819
            QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+ +    +   PP++
Sbjct:  130 QLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSTAKARPPKK 191          
BLAST of DjotxB protein vs. Ensembl Medaka
Match: otx2a (homeobox protein OTX1 B [Source:NCBI gene;Acc:101169019])

HSP 1 Score: 85.1149 bits (209), Expect = 1.189e-17
Identity = 40/60 (66.67%), Postives = 48/60 (80.00%), Query Frame = 1
Query:  634 QLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKPNSYTMPP 813
            QL+ILE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+ +Q  NS  + P
Sbjct:   49 QLDILESLFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQ-QQSTNSAKVKP 107          
BLAST of DjotxB protein vs. Ensembl Medaka
Match: otx2a (homeobox protein OTX1 B [Source:NCBI gene;Acc:101169019])

HSP 1 Score: 85.1149 bits (209), Expect = 1.189e-17
Identity = 40/60 (66.67%), Postives = 48/60 (80.00%), Query Frame = 1
Query:  634 QLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKPNSYTMPP 813
            QL+ILE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+ +Q  NS  + P
Sbjct:   49 QLDILESLFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQ-QQSTNSAKVKP 107          
BLAST of DjotxB protein vs. Ensembl Medaka
Match: otx2b (orthodenticle homeobox 2 [Source:NCBI gene;Acc:100049357])

HSP 1 Score: 83.1889 bits (204), Expect = 2.854e-17
Identity = 46/69 (66.67%), Postives = 56/69 (81.16%), Query Frame = 1
Query:  568 HPAL-YQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 771
            HP++ Y    +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of DjotxB protein vs. Ensembl Medaka
Match: ENSORLT00000000395.2 (homeobox protein otx5-like [Source:NCBI gene;Acc:101164666])

HSP 1 Score: 83.1889 bits (204), Expect = 2.888e-17
Identity = 35/46 (76.09%), Postives = 40/46 (86.96%), Query Frame = 1
Query:  634 QLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 771
            QL+ILE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   49 QLDILEALFSKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of DjotxB protein vs. Planmine SMEST
Match: SMESG000023717.1 (SMESG000023717.1)

HSP 1 Score: 836.254 bits (2159), Expect = 0.000e+0
Identity = 485/491 (98.78%), Postives = 487/491 (99.19%), Query Frame = 1
Query:  178 MFLSQPMHPTNHLSMFPYSQAFTSSECGYPTINSSTYSQYPISAIEQAFSGFNSNVNLSSTSVEKSISATAVGSSETCLNSRESLWTTASGYQPQLAPQYSFDHNAMXXXXXXXXXXXXXXXXXXXXXXQHPALYQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKPNSYT--MPPEQMPALSDKHLLHRMASMKNGSHLKEKIKISQDLPDNRGINELNCVNDSINSSDKFVKSDGKKNPKPKIKEXXXXXXXXXXXXXXAKSLPXXXXXXXXXXXXXXXXXXXXXDPRSPEQKPFYPEYINKYSSWLNGNNAFGCDNNLWSARHKPIMTSHDNPFTTSCLTGQQERNSLLISSQNAELNSSTSLVPPSTNFLRYFDHSSTDQSIMDPSCNPANMFCDLPNEGYINGYTHNFYNYSPKFSSGTLSNYNDSYPPTASWPLTMSGHRDFGQWTQ 1644
            MFLSQPMHPTNHLSMFPYSQAFTSSECGYPTINSSTYSQYPISAIEQAFSGFNSNVNLSSTSVEKSISATAVGSSETCLNSRESLWTTASGYQPQLAPQYSFDHNAMTAASALALATGGSSFPSSPYFPQHPALYQVPNKKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQK KQKPNSYT  MPPEQMPALSDKHLLHRMASMKNGSHLKEKIKISQDLPDNRGINELNCVNDSINSSDKFVKSDGKKNPKPKIKENQSSNGSIKNIGNSAKSLPIKSETSTITNSNNNISPINSIDPRSPEQKPFYPEYINKYSSWLNGNNAFGCDNNLWS RHKPIMTSHDNPFTTSCLTGQQERNSLLISSQNA+LNSSTSLVPPSTNFLRYFDHSSTDQSIMDPSCNPANMFCD+PNEGYINGYTHNFYNYSPKFSSGTLSNYNDSYPPTASWPLTMSGHRDFGQWTQ
Sbjct:    1 MFLSQPMHPTNHLSMFPYSQAFTSSECGYPTINSSTYSQYPISAIEQAFSGFNSNVNLSSTSVEKSISATAVGSSETCLNSRESLWTTASGYQPQLAPQYSFDHNAMTAASALALATGGSSFPSSPYFPQHPALYQVPNKKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKCKQKPNSYTVKMPPEQMPALSDKHLLHRMASMKNGSHLKEKIKISQDLPDNRGINELNCVNDSINSSDKFVKSDGKKNPKPKIKENQSSNGSIKNIGNSAKSLPIKSETSTITNSNNNISPINSIDPRSPEQKPFYPEYINKYSSWLNGNNAFGCDNNLWSTRHKPIMTSHDNPFTTSCLTGQQERNSLLISSQNADLNSSTSLVPPSTNFLRYFDHSSTDQSIMDPSCNPANMFCDIPNEGYINGYTHNFYNYSPKFSSGTLSNYNDSYPPTASWPLTMSGHRDFGQWTQ 491          
BLAST of DjotxB protein vs. Planmine SMEST
Match: SMESG000023717.1 (SMESG000023717.1)

HSP 1 Score: 828.935 bits (2140), Expect = 0.000e+0
Identity = 479/483 (99.17%), Postives = 481/483 (99.59%), Query Frame = 1
Query:  196 MHPTNHLSMFPYSQAFTSSECGYPTINSSTYSQYPISAIEQAFSGFNSNVNLSSTSVEKSISATAVGSSETCLNSRESLWTTASGYQPQLAPQYSFDHNAMXXXXXXXXXXXXXXXXXXXXXXQHPALYQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKPNSYTMPPEQMPALSDKHLLHRMASMKNGSHLKEKIKISQDLPDNRGINELNCVNDSINSSDKFVKSDGKKNPKPKIKEXXXXXXXXXXXXXXAKSLPXXXXXXXXXXXXXXXXXXXXXDPRSPEQKPFYPEYINKYSSWLNGNNAFGCDNNLWSARHKPIMTSHDNPFTTSCLTGQQERNSLLISSQNAELNSSTSLVPPSTNFLRYFDHSSTDQSIMDPSCNPANMFCDLPNEGYINGYTHNFYNYSPKFSSGTLSNYNDSYPPTASWPLTMSGHRDFGQWTQ 1644
            MHPTNHLSMFPYSQAFTSSECGYPTINSSTYSQYPISAIEQAFSGFNSNVNLSSTSVEKSISATAVGSSETCLNSRESLWTTASGYQPQLAPQYSFDHNAMTAASALALATGGSSFPSSPYFPQHPALYQVPNKKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQK KQKPNSYTMPPEQMPALSDKHLLHRMASMKNGSHLKEKIKISQDLPDNRGINELNCVNDSINSSDKFVKSDGKKNPKPKIKENQSSNGSIKNIGNSAKSLPIKSETSTITNSNNNISPINSIDPRSPEQKPFYPEYINKYSSWLNGNNAFGCDNNLWS RHKPIMTSHDNPFTTSCLTGQQERNSLLISSQNA+LNSSTSLVPPSTNFLRYFDHSSTDQSIMDPSCNPANMFCD+PNEGYINGYTHNFYNYSPKFSSGTLSNYNDSYPPTASWPLTMSGHRDFGQWTQ
Sbjct:    1 MHPTNHLSMFPYSQAFTSSECGYPTINSSTYSQYPISAIEQAFSGFNSNVNLSSTSVEKSISATAVGSSETCLNSRESLWTTASGYQPQLAPQYSFDHNAMTAASALALATGGSSFPSSPYFPQHPALYQVPNKKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKCKQKPNSYTMPPEQMPALSDKHLLHRMASMKNGSHLKEKIKISQDLPDNRGINELNCVNDSINSSDKFVKSDGKKNPKPKIKENQSSNGSIKNIGNSAKSLPIKSETSTITNSNNNISPINSIDPRSPEQKPFYPEYINKYSSWLNGNNAFGCDNNLWSTRHKPIMTSHDNPFTTSCLTGQQERNSLLISSQNADLNSSTSLVPPSTNFLRYFDHSSTDQSIMDPSCNPANMFCDIPNEGYINGYTHNFYNYSPKFSSGTLSNYNDSYPPTASWPLTMSGHRDFGQWTQ 483          
BLAST of DjotxB protein vs. Planmine SMEST
Match: SMESG000023717.1 (SMESG000023717.1)

HSP 1 Score: 823.928 bits (2127), Expect = 0.000e+0
Identity = 479/485 (98.76%), Postives = 481/485 (99.18%), Query Frame = 1
Query:  196 MHPTNHLSMFPYSQAFTSSECGYPTINSSTYSQYPISAIEQAFSGFNSNVNLSSTSVEKSISATAVGSSETCLNSRESLWTTASGYQPQLAPQYSFDHNAMXXXXXXXXXXXXXXXXXXXXXXQHPALYQVPNKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKPNSYT--MPPEQMPALSDKHLLHRMASMKNGSHLKEKIKISQDLPDNRGINELNCVNDSINSSDKFVKSDGKKNPKPKIKEXXXXXXXXXXXXXXAKSLPXXXXXXXXXXXXXXXXXXXXXDPRSPEQKPFYPEYINKYSSWLNGNNAFGCDNNLWSARHKPIMTSHDNPFTTSCLTGQQERNSLLISSQNAELNSSTSLVPPSTNFLRYFDHSSTDQSIMDPSCNPANMFCDLPNEGYINGYTHNFYNYSPKFSSGTLSNYNDSYPPTASWPLTMSGHRDFGQWTQ 1644
            MHPTNHLSMFPYSQAFTSSECGYPTINSSTYSQYPISAIEQAFSGFNSNVNLSSTSVEKSISATAVGSSETCLNSRESLWTTASGYQPQLAPQYSFDHNAMTAASALALATGGSSFPSSPYFPQHPALYQVPNKKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQK KQKPNSYT  MPPEQMPALSDKHLLHRMASMKNGSHLKEKIKISQDLPDNRGINELNCVNDSINSSDKFVKSDGKKNPKPKIKENQSSNGSIKNIGNSAKSLPIKSETSTITNSNNNISPINSIDPRSPEQKPFYPEYINKYSSWLNGNNAFGCDNNLWS RHKPIMTSHDNPFTTSCLTGQQERNSLLISSQNA+LNSSTSLVPPSTNFLRYFDHSSTDQSIMDPSCNPANMFCD+PNEGYINGYTHNFYNYSPKFSSGTLSNYNDSYPPTASWPLTMSGHRDFGQWTQ
Sbjct:    1 MHPTNHLSMFPYSQAFTSSECGYPTINSSTYSQYPISAIEQAFSGFNSNVNLSSTSVEKSISATAVGSSETCLNSRESLWTTASGYQPQLAPQYSFDHNAMTAASALALATGGSSFPSSPYFPQHPALYQVPNKKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKCKQKPNSYTVKMPPEQMPALSDKHLLHRMASMKNGSHLKEKIKISQDLPDNRGINELNCVNDSINSSDKFVKSDGKKNPKPKIKENQSSNGSIKNIGNSAKSLPIKSETSTITNSNNNISPINSIDPRSPEQKPFYPEYINKYSSWLNGNNAFGCDNNLWSTRHKPIMTSHDNPFTTSCLTGQQERNSLLISSQNADLNSSTSLVPPSTNFLRYFDHSSTDQSIMDPSCNPANMFCDIPNEGYINGYTHNFYNYSPKFSSGTLSNYNDSYPPTASWPLTMSGHRDFGQWTQ 485          
BLAST of DjotxB protein vs. Planmine SMEST
Match: SMESG000031965.1 (SMESG000031965.1)

HSP 1 Score: 124.405 bits (311), Expect = 4.904e-30
Identity = 71/77 (92.21%), Postives = 73/77 (94.81%), Query Frame = 1
Query:  565 QHPALYQVPN--KKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQK 789
            QHPALYQV    KKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQK+KQ+
Sbjct:   58 QHPALYQVGAQVKKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQR 134          
BLAST of DjotxB protein vs. Planmine SMEST
Match: SMESG000031965.1 (SMESG000031965.1)

HSP 1 Score: 124.79 bits (312), Expect = 5.634e-30
Identity = 71/77 (92.21%), Postives = 73/77 (94.81%), Query Frame = 1
Query:  565 QHPALYQVPN--KKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQK 789
            QHPALYQV    KKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQK+KQ+
Sbjct:  108 QHPALYQVGAQVKKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQR 184          
The following BLAST results are available for this feature:
BLAST of DjotxB protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OTX21.408e-1766.67orthodenticle homeobox 2 [Source:HGNC Symbol;Acc:H... [more]
OTX12.417e-1758.54orthodenticle homeobox 1 [Source:HGNC Symbol;Acc:H... [more]
OTX12.417e-1758.54orthodenticle homeobox 1 [Source:HGNC Symbol;Acc:H... [more]
OTX24.461e-1773.91orthodenticle homeobox 2 [Source:HGNC Symbol;Acc:H... [more]
OTX24.477e-1766.67orthodenticle homeobox 2 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of DjotxB protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttx-19.294e-1872.00pep chromosome:WBcel235:V:20053733:20059754:-1 gen... [more]
ttx-19.891e-1872.00pep chromosome:WBcel235:V:20053741:20064174:-1 gen... [more]
ttx-11.171e-1772.00pep chromosome:WBcel235:V:20053733:20064174:-1 gen... [more]
ttx-11.277e-1772.00pep chromosome:WBcel235:V:20053733:20061420:-1 gen... [more]
ceh-372.703e-1561.11Homeobox protein ceh-37 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of DjotxB protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
oc3.907e-1666.67gene:FBgn0004102 transcript:FBtr0331305[more]
oc3.907e-1666.67gene:FBgn0004102 transcript:FBtr0331738[more]
oc3.907e-1666.67gene:FBgn0004102 transcript:FBtr0300106[more]
oc6.952e-1666.67gene:FBgn0004102 transcript:FBtr0474137[more]
oc1.004e-1573.91gene:FBgn0004102 transcript:FBtr0331306[more]
back to top
BLAST of DjotxB protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otx12.948e-1860.98orthodenticle homeobox 1 [Source:NCBI gene;Acc:305... [more]
otx12.948e-1860.98orthodenticle homeobox 1 [Source:NCBI gene;Acc:305... [more]
otx2b6.888e-1866.67orthodenticle homeobox 2b [Source:NCBI gene;Acc:30... [more]
otx2b2.902e-1766.67orthodenticle homeobox 2b [Source:NCBI gene;Acc:30... [more]
otx2b2.902e-1766.67orthodenticle homeobox 2b [Source:NCBI gene;Acc:30... [more]
back to top
BLAST of DjotxB protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otx24.333e-1766.67orthodenticle homeobox 2 [Source:NCBI gene;Acc:548... [more]
tnnt15.453e-1776.09troponin T1, slow skeletal type [Source:Xenbase;Ac... [more]
otx13.593e-1463.38orthodenticle homeobox 1 [Source:NCBI gene;Acc:394... [more]
stx191.949e-1355.71syntaxin 19 [Source:Xenbase;Acc:XB-GENE-5749239][more]
ENSXETT00000028778.12.016e-1361.19retina and anterior neural fold homeobox [Source:N... [more]
back to top
BLAST of DjotxB protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Otx13.585e-1859.76orthodenticle homeobox 1 [Source:MGI Symbol;Acc:MG... [more]
Otx28.062e-1866.67orthodenticle homeobox 2 [Source:MGI Symbol;Acc:MG... [more]
Otx11.502e-1759.76orthodenticle homeobox 1 [Source:MGI Symbol;Acc:MG... [more]
Otx23.221e-1766.67orthodenticle homeobox 2 [Source:MGI Symbol;Acc:MG... [more]
Otx23.221e-1766.67orthodenticle homeobox 2 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of DjotxB protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91994|OTX1B_DANRE2.225e-1760.98Homeobox protein OTX1 B OS=Danio rerio OX=7955 GN=... [more]
sp|P80205|OTX1_MOUSE1.050e-1659.76Homeobox protein OTX1 OS=Mus musculus OX=10090 GN=... [more]
sp|P32242|OTX1_HUMAN1.161e-1658.54Homeobox protein OTX1 OS=Homo sapiens OX=9606 GN=O... [more]
sp|Q6DKN2|OTX2B_XENLA1.451e-1668.12Homeobox protein OTX2-B OS=Xenopus laevis OX=8355 ... [more]
sp|Q63410|OTX1_RAT2.093e-1666.20Homeobox protein OTX1 OS=Rattus norvegicus OX=1011... [more]
back to top
BLAST of DjotxB protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|196200170.000e+079.64tr|A8C1Q2|A8C1Q2_DUGJA DjotxB protein OS=Dugesia j... [more]
gnl|BL_ORD_ID|230687165.840e-13154.31tr|T1E106|T1E106_9PLAT OtxB OS=Dendrocoelum lacteu... [more]
gnl|BL_ORD_ID|209097281.025e-8594.85tr|H6V049|H6V049_SCHPL OTX-B (Fragment) OS=Schmidt... [more]
gnl|BL_ORD_ID|224932781.928e-6577.92tr|Q9U084|Q9U084_GIRTI Homeobox protein (Fragment)... [more]
gnl|BL_ORD_ID|203492072.704e-2692.21tr|H9B8J3|H9B8J3_SCHMD OtxA OS=Schmidtea mediterra... [more]
back to top
BLAST of DjotxB protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otx2a1.022e-1769.01orthodenticle homeobox 1 [Source:NCBI gene;Acc:103... [more]
otx11.494e-1775.00homeobox protein OTX1 B [Source:NCBI gene;Acc:1030... [more]
OTX22.788e-1766.67orthodenticle homeobox 2 [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000021580.23.085e-1771.88homeobox protein otx5-like [Source:NCBI gene;Acc:1... [more]
OTX23.741e-1766.67homeobox protein OTX2 [Source:NCBI gene;Acc:103027... [more]
back to top
BLAST of DjotxB protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010761.17.361e-1873.77pep scaffold:Pmarinus_7.0:GL476415:928307:936594:-... [more]
dmbx1b1.487e-1358.82diencephalon/mesencephalon homeobox 1b [Source:NCB... [more]
otx54.680e-1154.12orthodenticle homolog 5 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000000987.11.142e-644.90pep scaffold:Pmarinus_7.0:GL477479:61561:69115:-1 ... [more]
ENSPMAT00000000988.13.122e-647.83pep scaffold:Pmarinus_7.0:GL477479:64107:69103:-1 ... [more]
back to top
BLAST of DjotxB protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PHO29.811e-841.27Homeobox transcription factor; regulatory targets ... [more]
back to top
BLAST of DjotxB protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
OTXC9.202e-1973.85OtxC; Predicted protein [Source:UniProtKB/TrEMBL;... [more]
EDO357491.340e-1870.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
OTX7.071e-1873.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO386647.419e-1658.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
GSC4.511e-1451.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DjotxB protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otx18.473e-1859.68homeobox protein OTX1 B-like [Source:NCBI gene;Acc... [more]
otx2a1.189e-1766.67homeobox protein OTX1 B [Source:NCBI gene;Acc:1011... [more]
otx2a1.189e-1766.67homeobox protein OTX1 B [Source:NCBI gene;Acc:1011... [more]
otx2b2.854e-1766.67orthodenticle homeobox 2 [Source:NCBI gene;Acc:100... [more]
ENSORLT00000000395.22.888e-1776.09homeobox protein otx5-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of DjotxB protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023717.10.000e+098.78SMESG000023717.1[more]
SMESG000023717.10.000e+099.17SMESG000023717.1[more]
SMESG000023717.10.000e+098.76SMESG000023717.1[more]
SMESG000031965.14.904e-3092.21SMESG000031965.1[more]
SMESG000031965.15.634e-3092.21SMESG000031965.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008131 ID=SMED30008131|Name=DjotxB protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1726bp
CAACCAATCTGACGAAACCTACTGCAAAGCTGTTACGAGCCAAGCAAGAA
TAGATGGACAAAATATAATAAGGATTAACTGGCTTTAACTGCTTCACTCG
CAAATTTCTTTTCGACGACTTCGACTACGATCAAATCTCTTAATGCGCTT
AGTTCTGGGCCGGATTTAGCAAAAACAATGTTTTTATCACAACCAATGCA
TCCGACAAACCATTTATCAATGTTCCCCTATTCACAAGCATTTACATCAT
CAGAATGTGGCTATCCAACCATAAACTCCTCCACATATTCCCAATATCCT
ATCAGTGCTATTGAACAAGCTTTTTCGGGATTCAACTCGAACGTTAATCT
CTCTTCGACATCTGTGGAAAAATCTATATCAGCAACCGCGGTTGGATCAA
GTGAAACGTGTCTTAATTCACGAGAAAGCTTATGGACCACAGCGTCAGGC
TATCAGCCACAATTGGCTCCACAATATTCTTTCGATCACAACGCTATGAC
AGCTGCAAGTGCGTTGGCATTAGCAACCGGCGGATCATCGTTTCCGAGTT
CCCCGTATTTTCCCCAGCATCCAGCATTATATCAAGTACCAAACAAGAAA
ACCCGCCGAGACCGAACTACATTTACAAGACAGCAATTGGAAATATTAGA
GTTGCATTTTGAAAAAAATAGATATCCTGACATATTTCTTCGGGATGAAA
TTTCTTCAAAAATTAATTTACCCGAATCAAGAGTCCAGGTTTGGTTCAAA
AACCGAAGAGCTAAAGAAAGACAAAAGAGTAAACAAAAACCTAACAGTTA
CACAATGCCACCCGAACAAATGCCCGCCTTGTCCGACAAACACCTTCTCC
ATAGAATGGCAAGCATGAAAAATGGAAGTCATTTAAAGGAGAAAATAAAA
ATTAGCCAAGATTTGCCAGATAACCGTGGAATAAATGAACTCAATTGTGT
AAATGATTCCATTAATTCTTCAGATAAATTCGTTAAATCAGACGGCAAGA
AAAATCCAAAACCAAAAATCAAAGAAAATCAAAGTTCTAATGGATCAATT
AAAAACATTGGTAATAGTGCCAAATCACTTCCTATCAAATCGGAAACTAG
CACAATAACTAATTCAAACAATAATATTTCTCCAATAAATAGCATTGACC
CAAGATCTCCAGAACAAAAGCCATTTTATCCAGAATATATCAACAAATAT
TCCAGCTGGTTAAACGGGAACAATGCTTTTGGATGTGACAACAATTTATG
GAGTGCAAGACATAAACCGATAATGACGTCCCATGACAACCCATTTACAA
CGAGCTGCCTGACTGGACAACAAGAAAGAAATTCACTTCTAATATCATCA
CAGAACGCCGAATTGAACTCGTCAACATCACTAGTGCCTCCATCGACGAA
TTTCCTGAGATATTTTGACCATTCCTCCACTGACCAGTCAATAATGGATC
CATCCTGCAATCCTGCTAATATGTTTTGTGACCTACCAAATGAAGGTTAC
ATAAATGGATACACACATAATTTTTACAATTATTCACCGAAATTCTCCTC
AGGAACATTGTCCAATTATAATGATTCTTATCCGCCAACTGCTTCATGGC
CTCTCACAATGTCCGGACACAGAGACTTTGGTCAGTGGACCCAATGAATT
ATACATCTATACAAATATAAATATAAGAAAATATGTCTAATCCAAAATTT
AGTTTTGTATTGTACATGAATTAAAC
back to top

protein sequence of SMED30008131-orf-1

>SMED30008131-orf-1 ID=SMED30008131-orf-1|Name=SMED30008131-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=490bp
MFLSQPMHPTNHLSMFPYSQAFTSSECGYPTINSSTYSQYPISAIEQAFS
GFNSNVNLSSTSVEKSISATAVGSSETCLNSRESLWTTASGYQPQLAPQY
SFDHNAMTAASALALATGGSSFPSSPYFPQHPALYQVPNKKTRRDRTTFT
RQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQK
SKQKPNSYTMPPEQMPALSDKHLLHRMASMKNGSHLKEKIKISQDLPDNR
GINELNCVNDSINSSDKFVKSDGKKNPKPKIKENQSSNGSIKNIGNSAKS
LPIKSETSTITNSNNNISPINSIDPRSPEQKPFYPEYINKYSSWLNGNNA
FGCDNNLWSARHKPIMTSHDNPFTTSCLTGQQERNSLLISSQNAELNSST
SLVPPSTNFLRYFDHSSTDQSIMDPSCNPANMFCDLPNEGYINGYTHNFY
NYSPKFSSGTLSNYNDSYPPTASWPLTMSGHRDFGQWTQ*
back to top
Aliases
The feature 'DjotxB protein' has the following synonyms
Synonym
Dj-otxB
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000044cephalic ganglia
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000103central nervous system
PLANA:0000418head
PLANA:0003503ventral epidermis progenitor cell
Vocabulary: INTERPRO
TermDefinition
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 142..204
e-value: 7.5E-23
score: 91.9
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 143..199
e-value: 2.7E-21
score: 75.2
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 140..200
score: 19.84
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 152..200
e-value: 6.20861E-18
score: 75.7428
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 134..243
e-value: 1.3E-25
score: 90.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 282..325
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 267..281
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 266..328
NoneNo IPR availablePANTHERPTHR45793FAMILY NOT NAMEDcoord: 113..419
NoneNo IPR availablePANTHERPTHR45793:SF5HOMEOTIC PROTEIN OCELLILESScoord: 113..419
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 175..198
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 120..200