nicolin-1

Overview
Namenicolin-1
Smed IDSMED30008113
Length (bp)932
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of nicolin-1 (SMED30008113) t-SNE clustered cells

Violin plots show distribution of expression levels for nicolin-1 (SMED30008113) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of nicolin-1 (SMED30008113) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for nicolin-1 (SMED30008113) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008113

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30008113SMESG000079687.1 SMESG000054751.1 SmedASXL_015180SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30008113SMESG000079687.1 SMESG000054751.1 dd_Smed_v4_11961_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30008113SMESG000079687.1 SMESG000054751.1 dd_Smed_v4_11961_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30008113SMESG000079687.1 SMESG000054751.1 dd_Smed_v6_11961_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30008113SMESG000079687.1 SMESG000054751.1 dd_Smed_v4_11961_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of nicolin-1 vs. Ensembl Human
Match: NICN1 (nicolin 1 [Source:HGNC Symbol;Acc:HGNC:18317])

HSP 1 Score: 72.7886 bits (177), Expect = 1.366e-14
Identity = 39/141 (27.66%), Postives = 68/141 (48.23%), Query Frame = 2
Query:   44 IKANIKSPVYLNLDITGSKTKSSRHSSGCCIFDVNFANNAFHSISTISFKNFFTAQITIKFR---STNKNSKWKIAIDSFILMKDPHSTMNSEDVIIFVTKDFKEPLNDVYVLRFILQQPSCLWKEFNIKNLCFYSNHNTS 457
            +  ++K  V L +       ++S+   G  + DV F + A   +  I+FKN++TA ++I+ R   S +  +KW   +  + LM DPHS   +++ +          +  +  LR IL+QPS LW  F ++ L  Y     S
Sbjct:    6 VPCHVKGSVALQV----GDVRTSQGRPGVLVIDVTFPSVAPFELQEITFKNYYTAFLSIRVRQYTSAHTPAKWVTCLRDYCLMPDPHSEEGAQEYVSLFKHQMLCDMARISELRLILRQPSPLWLSFTVEELQIYQQGPKS 142          
BLAST of nicolin-1 vs. Ensembl Human
Match: NICN1 (nicolin 1 [Source:HGNC Symbol;Acc:HGNC:18317])

HSP 1 Score: 72.7886 bits (177), Expect = 1.366e-14
Identity = 39/141 (27.66%), Postives = 68/141 (48.23%), Query Frame = 2
Query:   44 IKANIKSPVYLNLDITGSKTKSSRHSSGCCIFDVNFANNAFHSISTISFKNFFTAQITIKFR---STNKNSKWKIAIDSFILMKDPHSTMNSEDVIIFVTKDFKEPLNDVYVLRFILQQPSCLWKEFNIKNLCFYSNHNTS 457
            +  ++K  V L +       ++S+   G  + DV F + A   +  I+FKN++TA ++I+ R   S +  +KW   +  + LM DPHS   +++ +          +  +  LR IL+QPS LW  F ++ L  Y     S
Sbjct:    6 VPCHVKGSVALQV----GDVRTSQGRPGVLVIDVTFPSVAPFELQEITFKNYYTAFLSIRVRQYTSAHTPAKWVTCLRDYCLMPDPHSEEGAQEYVSLFKHQMLCDMARISELRLILRQPSPLWLSFTVEELQIYQQGPKS 142          
BLAST of nicolin-1 vs. Ensembl Human
Match: NICN1 (nicolin 1 [Source:HGNC Symbol;Acc:HGNC:18317])

HSP 1 Score: 72.7886 bits (177), Expect = 1.366e-14
Identity = 39/141 (27.66%), Postives = 68/141 (48.23%), Query Frame = 2
Query:   44 IKANIKSPVYLNLDITGSKTKSSRHSSGCCIFDVNFANNAFHSISTISFKNFFTAQITIKFR---STNKNSKWKIAIDSFILMKDPHSTMNSEDVIIFVTKDFKEPLNDVYVLRFILQQPSCLWKEFNIKNLCFYSNHNTS 457
            +  ++K  V L +       ++S+   G  + DV F + A   +  I+FKN++TA ++I+ R   S +  +KW   +  + LM DPHS   +++ +          +  +  LR IL+QPS LW  F ++ L  Y     S
Sbjct:    6 VPCHVKGSVALQV----GDVRTSQGRPGVLVIDVTFPSVAPFELQEITFKNYYTAFLSIRVRQYTSAHTPAKWVTCLRDYCLMPDPHSEEGAQEYVSLFKHQMLCDMARISELRLILRQPSPLWLSFTVEELQIYQQGPKS 142          
BLAST of nicolin-1 vs. Ensembl Human
Match: AC104452.1 (novel protein)

HSP 1 Score: 72.7886 bits (177), Expect = 1.366e-14
Identity = 39/141 (27.66%), Postives = 68/141 (48.23%), Query Frame = 2
Query:   44 IKANIKSPVYLNLDITGSKTKSSRHSSGCCIFDVNFANNAFHSISTISFKNFFTAQITIKFR---STNKNSKWKIAIDSFILMKDPHSTMNSEDVIIFVTKDFKEPLNDVYVLRFILQQPSCLWKEFNIKNLCFYSNHNTS 457
            +  ++K  V L +       ++S+   G  + DV F + A   +  I+FKN++TA ++I+ R   S +  +KW   +  + LM DPHS   +++ +          +  +  LR IL+QPS LW  F ++ L  Y     S
Sbjct:    6 VPCHVKGSVALQV----GDVRTSQGRPGVLVIDVTFPSVAPFELQEITFKNYYTAFLSIRVRQYTSAHTPAKWVTCLRDYCLMPDPHSEEGAQEYVSLFKHQMLCDMARISELRLILRQPSPLWLSFTVEELQIYQQGPKS 142          
BLAST of nicolin-1 vs. Ensembl Human
Match: AC104452.1 (novel protein)

HSP 1 Score: 72.7886 bits (177), Expect = 1.366e-14
Identity = 39/141 (27.66%), Postives = 68/141 (48.23%), Query Frame = 2
Query:   44 IKANIKSPVYLNLDITGSKTKSSRHSSGCCIFDVNFANNAFHSISTISFKNFFTAQITIKFR---STNKNSKWKIAIDSFILMKDPHSTMNSEDVIIFVTKDFKEPLNDVYVLRFILQQPSCLWKEFNIKNLCFYSNHNTS 457
            +  ++K  V L +       ++S+   G  + DV F + A   +  I+FKN++TA ++I+ R   S +  +KW   +  + LM DPHS   +++ +          +  +  LR IL+QPS LW  F ++ L  Y     S
Sbjct:    6 VPCHVKGSVALQV----GDVRTSQGRPGVLVIDVTFPSVAPFELQEITFKNYYTAFLSIRVRQYTSAHTPAKWVTCLRDYCLMPDPHSEEGAQEYVSLFKHQMLCDMARISELRLILRQPSPLWLSFTVEELQIYQQGPKS 142          
BLAST of nicolin-1 vs. Ensembl Zebrafish
Match: nicn1 (nicolin 1 [Source:ZFIN;Acc:ZDB-GENE-040801-129])

HSP 1 Score: 71.633 bits (174), Expect = 2.633e-14
Identity = 44/134 (32.84%), Postives = 68/134 (50.75%), Query Frame = 2
Query:   44 IKANIKSPVYLNLDITGSKTKSSRHSSGCCIFDVNFANNAFHSISTISFKNFFTAQITIKF--RSTNKNSKWKIAIDSFILMKDPHSTMNSEDVIIFVTKDFKEPLNDVYVLRFILQQPSCLWKEFNIKNLCFY 439
            +   +KSPV   L I  + + SSR   G  I D+  A     +I  ISFKNF+TA +T++   R  +  SKW   + ++ LM +PH+   S D      +      ++V  +R IL+QPS  W  F+I+ +  Y
Sbjct:    6 VSCTVKSPV--ALQIGDAVSDSSR--PGVYITDITLAEPV--NIQEISFKNFYTAYLTVRLQRRHGSTASKWVTCLKNYCLMGNPHAEAGSHDYFSIYRQQMSTEPDNVTTVRLILRQPSSEWLSFSIEEINIY 133          
BLAST of nicolin-1 vs. Ensembl Zebrafish
Match: nicn1 (nicolin 1 [Source:ZFIN;Acc:ZDB-GENE-040801-129])

HSP 1 Score: 71.633 bits (174), Expect = 2.633e-14
Identity = 44/134 (32.84%), Postives = 68/134 (50.75%), Query Frame = 2
Query:   44 IKANIKSPVYLNLDITGSKTKSSRHSSGCCIFDVNFANNAFHSISTISFKNFFTAQITIKF--RSTNKNSKWKIAIDSFILMKDPHSTMNSEDVIIFVTKDFKEPLNDVYVLRFILQQPSCLWKEFNIKNLCFY 439
            +   +KSPV   L I  + + SSR   G  I D+  A     +I  ISFKNF+TA +T++   R  +  SKW   + ++ LM +PH+   S D      +      ++V  +R IL+QPS  W  F+I+ +  Y
Sbjct:    6 VSCTVKSPV--ALQIGDAVSDSSR--PGVYITDITLAEPV--NIQEISFKNFYTAYLTVRLQRRHGSTASKWVTCLKNYCLMGNPHAEAGSHDYFSIYRQQMSTEPDNVTTVRLILRQPSSEWLSFSIEEINIY 133          
BLAST of nicolin-1 vs. Ensembl Xenopus
Match: mst1r (macrophage stimulating 1 receptor [Source:NCBI gene;Acc:493453])

HSP 1 Score: 63.929 bits (154), Expect = 1.928e-11
Identity = 39/135 (28.89%), Postives = 64/135 (47.41%), Query Frame = 2
Query:   44 IKANIKSPVYLNLDITGSKTKSSRHSSGCCIFDVNFANNAFHSISTISFKNFFTAQITIKFRSTNKN------SKWKIAIDSFILMKDPHSTMNSEDVIIFVTKDFKEPLNDVYVLRFILQQPSCLWKEFNIKNL 430
            +   ++ PV   L +   KT+ SR   G  + DV F       +  I+FKN++TA +T+K +    +      + W   I +  LM +PH+   S+D +           + V  LR IL+QPS +W  FN++ L
Sbjct:    6 VPYTVRPPV--PLQVGDVKTEISR--PGVYVIDVTFPKYQPVDVEEITFKNYYTAFLTVKIQQKRPSETVACPAVWHTCIRNMRLMPNPHTEEGSQDYVSLQRHQMLCDTDHVISLRLILRQPSPVWLNFNLEEL 136          
BLAST of nicolin-1 vs. Ensembl Mouse
Match: Nicn1 (nicolin 1 [Source:MGI Symbol;Acc:MGI:1913507])

HSP 1 Score: 78.9518 bits (193), Expect = 5.694e-17
Identity = 44/141 (31.21%), Postives = 69/141 (48.94%), Query Frame = 2
Query:   44 IKANIKSPVYLNLDITGSKTKSSRHSSGCCIFDVNFANNAFHSISTISFKNFFTAQITIKFR---STNKNSKWKIAIDSFILMKDPHSTMNSEDVIIFVTKDFKEPLNDVYVLRFILQQPSCLWKEFNIKNLCFYSNHNTS 457
            +  ++KS V L +       ++S+   G  + DV F N A   +  I FKN++TA ++I+ R   S +  +KW   +  + LM DPHS   ++D +          +N V  LR IL+QPS LW  F ++ L  Y     S
Sbjct:    6 VPCHVKSTVALQV----GDMRTSQGRPGVLVVDVTFPNIAPFELQEIMFKNYYTAFLSIRVRQQSSMHTAAKWVTCLRDYCLMPDPHSEEGAQDYVSLFKHQMLCDMNRVLELRLILRQPSPLWLSFTVEELQIYQQGPKS 142          
BLAST of nicolin-1 vs. UniProt/SwissProt
Match: sp|Q9CQM0|NICN1_MOUSE (Nicolin-1 OS=Mus musculus OX=10090 GN=Nicn1 PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 3.983e-16
Identity = 44/141 (31.21%), Postives = 69/141 (48.94%), Query Frame = 2
Query:   44 IKANIKSPVYLNLDITGSKTKSSRHSSGCCIFDVNFANNAFHSISTISFKNFFTAQITIKFR---STNKNSKWKIAIDSFILMKDPHSTMNSEDVIIFVTKDFKEPLNDVYVLRFILQQPSCLWKEFNIKNLCFYSNHNTS 457
            +  ++KS V L +       ++S+   G  + DV F N A   +  I FKN++TA ++I+ R   S +  +KW   +  + LM DPHS   ++D +          +N V  LR IL+QPS LW  F ++ L  Y     S
Sbjct:    6 VPCHVKSTVALQV----GDMRTSQGRPGVLVVDVTFPNIAPFELQEIMFKNYYTAFLSIRVRQQSSMHTAAKWVTCLRDYCLMPDPHSEEGAQDYVSLFKHQMLCDMNRVLELRLILRQPSPLWLSFTVEELQIYQQGPKS 142          
BLAST of nicolin-1 vs. UniProt/SwissProt
Match: sp|Q861Y6|NICN1_CANLF (Nicolin-1 OS=Canis lupus familiaris OX=9615 GN=NICN1 PE=3 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.226e-14
Identity = 41/141 (29.08%), Postives = 68/141 (48.23%), Query Frame = 2
Query:   44 IKANIKSPVYLNLDITGSKTKSSRHSSGCCIFDVNFANNAFHSISTISFKNFFTAQITIKFR---STNKNSKWKIAIDSFILMKDPHSTMNSEDVIIFVTKDFKEPLNDVYVLRFILQQPSCLWKEFNIKNLCFYSNHNTS 457
            +  ++K  V L +       ++S+   G  + DV F + A   +  I FKN++TA ++I+ R   ST+  +KW   +  + LM DPHS   +++ +          +  V  LR IL+QPS LW  F ++ L  Y     S
Sbjct:    6 VPCHVKGTVALQV----GDVRTSQGRPGVLVIDVTFPSVAPFELQEIMFKNYYTAFLSIRVRQHTSTHTPAKWVTCLRDYCLMPDPHSEEGAQEYVSLFKHQMLCDMARVLELRLILRQPSPLWLSFTVEELQIYQQGPKS 142          
BLAST of nicolin-1 vs. UniProt/SwissProt
Match: sp|Q9BSH3|NICN1_HUMAN (Nicolin-1 OS=Homo sapiens OX=9606 GN=NICN1 PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 6.559e-14
Identity = 39/141 (27.66%), Postives = 68/141 (48.23%), Query Frame = 2
Query:   44 IKANIKSPVYLNLDITGSKTKSSRHSSGCCIFDVNFANNAFHSISTISFKNFFTAQITIKFR---STNKNSKWKIAIDSFILMKDPHSTMNSEDVIIFVTKDFKEPLNDVYVLRFILQQPSCLWKEFNIKNLCFYSNHNTS 457
            +  ++K  V L +       ++S+   G  + DV F + A   +  I+FKN++TA ++I+ R   S +  +KW   +  + LM DPHS   +++ +          +  +  LR IL+QPS LW  F ++ L  Y     S
Sbjct:    6 VPCHVKGSVALQV----GDVRTSQGRPGVLVIDVTFPSVAPFELQEITFKNYYTAFLSIRVRQYTSAHTPAKWVTCLRDYCLMPDPHSEEGAQEYVSLFKHQMLCDMARISELRLILRQPSPLWLSFTVEELQIYQQGPKS 142          
BLAST of nicolin-1 vs. TrEMBL
Match: R7U8V7 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_173344 PE=4 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.541e-16
Identity = 40/123 (32.52%), Postives = 70/123 (56.91%), Query Frame = 2
Query:  122 SGCCIFDVNFANNAFHSISTISFKNFFTAQITIKFR------STNKNSKWKIAIDSFILMKDPHSTMNSEDVI-IFVTKDFKEPLNDVYVLRFILQQPSCLWKEFNIKNLCFYSNHNTSTLNL 469
            +GC + DV F N  +  +  I FKN++TA IT+  +      +  K   WK+ + +F LM  PH+    E+   I  ++    PL ++  LRF+LQQPS +WKEF I+++  + N + +++++
Sbjct:   26 AGCSVIDVTFQNPVYVELQEIHFKNYYTASITVLVKRKAGITAAEKEKAWKVCVRNFTLMPHPHADQGGEEYFSIGPSQLGGAPLQNITALRFVLQQPSSVWKEFYIEDIKLFKNLSLTSVDV 148          
BLAST of nicolin-1 vs. TrEMBL
Match: A0A1S3JQ80 (nicolin-1 OS=Lingula unguis OX=7574 GN=LOC106175195 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.291e-16
Identity = 48/132 (36.36%), Postives = 67/132 (50.76%), Query Frame = 2
Query:   50 ANIKSPVYLNLDITGSKTKSSRHSSGCCIFDVNFANNAFHSISTISFKNFFTAQITIKFRSTNK---NSKWKIAIDSFILMKDPHSTMNSEDVIIFVTKDFKEPLNDVYVLRFILQQPSCLWKEFNIKNLCF 436
              +K+PVY+ +   G   K     SGCCIFDV F N     I+  SFKN++   +T+  R   +     KWK  +    LM +PH    ++D      K     L +V  LRFIL+QPS +WKEF ++ L F
Sbjct:    8 GTVKTPVYIKV---GDPKKE--FFSGCCIFDVAFPNTVSVEINEFSFKNYYGHTLTVMARRKEEPGIEPKWKTCLKRMKLMPNPHFETGAQDYFTVTRKQLLFDLTNVTGLRFILRQPSPVWKEFKLEELTF 134          
BLAST of nicolin-1 vs. TrEMBL
Match: A0A4Y2I5A0 (Uncharacterized protein OS=Araneus ventricosus OX=182803 GN=AVEN_82710_1 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 4.790e-15
Identity = 52/163 (31.90%), Postives = 86/163 (52.76%), Query Frame = 2
Query:   59 KSPVYLNLDITGSKTKSSRHSSGCCIFDVNFANNAFHSISTISFKNFFTAQITI--KFRSTNKNSK------WKIAIDSFILMKDPHSTMNSEDVIIFVTKDFKEPLNDVYVLRFILQQPSCLWKEFNIKNLCFYSNHNTSTLNLKSILKKINSFSDIKSECN 523
            K+PV + LD      + + +  GCCI +V+F      +I  I F+N +TA I +  K  +  K+ K      W+ ++  FILM+DP    NS+D++    K+   P   +  +RF+L+QPS  WK+F I+ L FY    T  +   S+ + +++ S + SEC 
Sbjct:   15 KAPVSIFLD-----DERADYKPGCCILEVSFPEPV--TIGDIRFRNNYTAFIGLSCKKVAAEKDVKNRDILPWQASVKRFILMQDPDCEKNSQDIVSIPAKESCIPWVGIVNVRFVLKQPSFRWKKFGIEELTFYGEITTKDVKQMSVTRPLSAASRM-SECK 169          
BLAST of nicolin-1 vs. TrEMBL
Match: A0A5C6N3K6 (Nicolin-1 NPCEDRG OS=Takifugu flavidus OX=433684 GN=D4764_04G0000340 PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.968e-14
Identity = 42/138 (30.43%), Postives = 71/138 (51.45%), Query Frame = 2
Query:   44 IKANIKSPVYLNLDITGSKTKSSRHSSGCCIFDVNFANNAFHSISTISFKNFFTAQITIKF--RSTNKNS--KWKIAIDSFILMKDPHSTMNSEDVIIFVTKDFKEPLNDVYVLRFILQQPSCLWKEFNIKNLCFYSN 445
            +   IK  V+LN+   G    ++R  SG C+ DV+       +I  I+F NF+TA +T++   R   + +  +W  A+    LM DPH+   S+D         + P + V  +R IL+QPSC+W  F ++++  Y +
Sbjct:    6 VSCTIKPAVFLNI---GGAEAAAR--SGVCVLDVSLPVGKTVNIEKITFTNFYTASVTLRLLRRGPGQEAAARWCTALKELRLMHDPHTEGGSQDSCCIHRTQMQVPPDHVSSVRLILRQPSCVWLNFTLEDIKIYPH 138          
BLAST of nicolin-1 vs. TrEMBL
Match: A0A2I4AHE6 (nicolin-1 isoform X2 OS=Austrofundulus limnaeus OX=52670 GN=nicn1 PE=4 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.431e-14
Identity = 54/194 (27.84%), Postives = 90/194 (46.39%), Query Frame = 2
Query:   44 IKANIKSPVYLNLDITGSKTKSSRHSSGCCIFDVNFANNAFHSISTISFKNFFTAQITIKF--RSTNKN--SKWKIAIDSFILMKDPHSTMNSEDVIIFVTKDFKEPLNDVYVLRFILQQPSCLWKEFNIKNLCFYSNHNTSTLNLKSILKKINSF-SDIKSECNDFHRSALTDSQESLNELPGNLVDSSIISQ 610
            +   IK PVYL +         S+  SG C+ D+N ++    SI  ++FKN +TA +T++   RS  +   ++W  A+    LM +PH+   S+D         +E  + V  +R IL+QPS  W  F+++++  + +       LK   K+++ + SD+           L D    L  LP     SS I Q
Sbjct:    9 VAPTIKGPVYLQM-------GESKAQSGVCVLDLNLSSGRPVSIEELTFKNHYTAYLTVRLLRRSPEQGGLARWCTAVRDLPLMDNPHTEGGSQDYYSLHRTQMQEKPDHVVTVRLILRQPSSAWLTFSLEDIRVFPHMEP----LKEPEKEVSDWLSDL----------ILVDQHPDLEGLPDPQTVSSSIQQ 181          
BLAST of nicolin-1 vs. Ensembl Cavefish
Match: nicn1 (nicolin 1 [Source:NCBI gene;Acc:103041364])

HSP 1 Score: 63.5438 bits (153), Expect = 1.505e-11
Identity = 41/141 (29.08%), Postives = 66/141 (46.81%), Query Frame = 2
Query:   44 IKANIKSPVYLNLDITGSKTKSSRHSSGCCIFDVNFANNAFHSISTISFKNFFTAQITIKF-----RSTNKNSKWKIAIDSFILMKDPHSTMNSEDVIIFVTKDFKEPLNDVYVLRFILQQPSCLWKEFNIKNLCFYSNHN 451
            +   +KSPV L +   G     S H  G  I D+        +I  ISFKN++TA +T++       S    +KW   + +  LM +PH+   S+D      +      ++V  +R IL+QPS +W  FN++ +  Y   N
Sbjct:    6 VNCTVKSPVALQI---GDVVSDSFHP-GVYITDIVLGEPV--NIQEISFKNYYTAYLTVRVLKKEVGSEEAPAKWVTCLRNHCLMANPHTEEGSQDYFSLYRQQMLMQPDNVTTVRLILRQPSSVWLNFNLEEIKIYPVMN 140          
BLAST of nicolin-1 vs. Ensembl Cavefish
Match: nicn1 (nicolin 1 [Source:NCBI gene;Acc:103041364])

HSP 1 Score: 63.5438 bits (153), Expect = 1.505e-11
Identity = 41/141 (29.08%), Postives = 66/141 (46.81%), Query Frame = 2
Query:   44 IKANIKSPVYLNLDITGSKTKSSRHSSGCCIFDVNFANNAFHSISTISFKNFFTAQITIKF-----RSTNKNSKWKIAIDSFILMKDPHSTMNSEDVIIFVTKDFKEPLNDVYVLRFILQQPSCLWKEFNIKNLCFYSNHN 451
            +   +KSPV L +   G     S H  G  I D+        +I  ISFKN++TA +T++       S    +KW   + +  LM +PH+   S+D      +      ++V  +R IL+QPS +W  FN++ +  Y   N
Sbjct:    6 VNCTVKSPVALQI---GDVVSDSFHP-GVYITDIVLGEPV--NIQEISFKNYYTAYLTVRVLKKEVGSEEAPAKWVTCLRNHCLMANPHTEEGSQDYFSLYRQQMLMQPDNVTTVRLILRQPSSVWLNFNLEEIKIYPVMN 140          
BLAST of nicolin-1 vs. Ensembl Nematostella
Match: EDO48118 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK72])

HSP 1 Score: 68.9366 bits (167), Expect = 6.664e-14
Identity = 45/132 (34.09%), Postives = 62/132 (46.97%), Query Frame = 2
Query:   50 ANIKSPVYLNLDITGSKTKSSRHSSGCCIFDVNFANNAFHSISTISFKNFF--TAQITIKFRSTNKNSKWKIAIDSFILMKDPHSTMNSEDVIIFVTKDFKEPLNDVYVLRFILQQPSCLWKEFNIKNL-CF 436
            A IK PV L +        SS   SGC + D+ F      +I  ISFKN +  + +I +K    + N  WK  I    LM +PH    S+    F  +D   P + V ++R IL+Q S  W  F I +L CF
Sbjct:   11 AIIKKPVVLRV-----GEASSDFRSGCAVVDILFPGTDTVNIDRISFKNNYCSSVEIRMKVHGPDSNEVWKQCIKKTKLMPEPHYEAGSQSYFEFTAQDMCVPTDKVIMIRIILRQSSPHWANFGIDDLKCF 137          
BLAST of nicolin-1 vs. Ensembl Medaka
Match: nicn1 (nicolin 1 [Source:NCBI gene;Acc:101161050])

HSP 1 Score: 77.7962 bits (190), Expect = 1.313e-16
Identity = 43/144 (29.86%), Postives = 76/144 (52.78%), Query Frame = 2
Query:   44 IKANIKSPVYLNLDITGSKTKSSRHSSGCCIFDVNFANNAFHSISTISFKNFFTAQITIKF---RSTNKNS-KWKIAIDSFILMKDPHSTMNSEDVIIFVTKDFKEPLNDVYVLRFILQQPSCLWKEFNIKNLCFYSNHNTSTL 463
            +   +K PV+L   I  +K  S+R  SG C+ DV   +    +I  I+FKN++TA +TI+    ++ N+ S KW  A+    LM +PH+   S++      +  +   + V  LR IL+QPS  W+ FN++ +  + +   + +
Sbjct:   11 VDCTVKPPVFLQ--IGDAKGDSAR--SGVCVVDVTLPHGKPINIEKITFKNYYTAYVTIRLLRRKAENEGSAKWCTALSDLALMDNPHTEGGSQNYFSIHRRQMQVEPDHVESLRLILRQPSSAWRLFNLEEIRLFPHKEPAPV 150          
BLAST of nicolin-1 vs. Planmine SMEST
Match: SMESG000054751.1 (SMESG000054751.1)

HSP 1 Score: 481.1 bits (1237), Expect = 8.231e-174
Identity = 238/240 (99.17%), Postives = 238/240 (99.17%), Query Frame = 2
Query:   35 MSEIKANIKSPVYLNLDITGSKTKSSRHSSGCCIFDVNFANNAFHSISTISFKNFFTAQITIKFRSTNKNSKWKIAIDSFILMKDPHSTMNSEDVIIFVTKDFKEPLNDVYVLRFILQQPSCLWKEFNIKNLCFYSNHNTSTLNLKSILKKINSFSDIKSECNDFHRSALTDSQESLNELPGNLVDSSIISQESINDLLIKMKEMSCLPLFQHEFIPVETFTGCVEKDGFCDSTTLIHPL 754
            MSEIKANIKSPVYLNLDITGSKTKSSRHSSGCCIFDVNFANNAFHSISTISFKNFFTAQITIKFRSTNKNSKWKIAIDSFILMKDPHSTMNSEDV IFVTKDFKEPLNDVYVLRFILQQPSCLWKEFNIKNLCFYSNHNTSTLNLKSILKKINSFSDIKSECNDF RSALTDSQESLNELPGNLVDSSIISQESINDLLIKMKEMSCLPLFQHEFIPVETFTGCVEKDGFCDSTTLIHPL
Sbjct:    1 MSEIKANIKSPVYLNLDITGSKTKSSRHSSGCCIFDVNFANNAFHSISTISFKNFFTAQITIKFRSTNKNSKWKIAIDSFILMKDPHSTMNSEDVFIFVTKDFKEPLNDVYVLRFILQQPSCLWKEFNIKNLCFYSNHNTSTLNLKSILKKINSFSDIKSECNDFQRSALTDSQESLNELPGNLVDSSIISQESINDLLIKMKEMSCLPLFQHEFIPVETFTGCVEKDGFCDSTTLIHPL 240          
BLAST of nicolin-1 vs. Planmine SMEST
Match: SMESG000079687.1 (SMESG000079687.1)

HSP 1 Score: 488.804 bits (1257), Expect = 8.120e-163
Identity = 237/240 (98.75%), Postives = 238/240 (99.17%), Query Frame = 2
Query:   35 MSEIKANIKSPVYLNLDITGSKTKSSRHSSGCCIFDVNFANNAFHSISTISFKNFFTAQITIKFRSTNKNSKWKIAIDSFILMKDPHSTMNSEDVIIFVTKDFKEPLNDVYVLRFILQQPSCLWKEFNIKNLCFYSNHNTSTLNLKSILKKINSFSDIKSECNDFHRSALTDSQESLNELPGNLVDSSIISQESINDLLIKMKEMSCLPLFQHEFIPVETFTGCVEKDGFCDSTTLIHPL 754
            MSEIKANIKSPVYLNLDITGSKTKSSRHSSGCCIFDVNFANNAFHSISTISFKNFFTAQITIKFRSTNKNSKWKIAIDSFILMKDPHSTMNSEDV IF+TKDFKEPLNDVYVLRFILQQPSCLWKEFNIKNLCFYSNHNTSTLNLKSILKKINSFSDIKSECNDF RSALTDSQESLNELPGNLVDSSIISQESINDLLIKMKEMSCLPLFQHEFIPVETFTGCVEKDGFCDSTTLIHPL
Sbjct:    1 MSEIKANIKSPVYLNLDITGSKTKSSRHSSGCCIFDVNFANNAFHSISTISFKNFFTAQITIKFRSTNKNSKWKIAIDSFILMKDPHSTMNSEDVFIFITKDFKEPLNDVYVLRFILQQPSCLWKEFNIKNLCFYSNHNTSTLNLKSILKKINSFSDIKSECNDFQRSALTDSQESLNELPGNLVDSSIISQESINDLLIKMKEMSCLPLFQHEFIPVETFTGCVEKDGFCDSTTLIHPL 240          
The following BLAST results are available for this feature:
BLAST of nicolin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NICN11.366e-1427.66nicolin 1 [Source:HGNC Symbol;Acc:HGNC:18317][more]
NICN11.366e-1427.66nicolin 1 [Source:HGNC Symbol;Acc:HGNC:18317][more]
NICN11.366e-1427.66nicolin 1 [Source:HGNC Symbol;Acc:HGNC:18317][more]
AC104452.11.366e-1427.66novel protein[more]
AC104452.11.366e-1427.66novel protein[more]
back to top
BLAST of nicolin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nicolin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nicolin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nicn12.633e-1432.84nicolin 1 [Source:ZFIN;Acc:ZDB-GENE-040801-129][more]
nicn12.633e-1432.84nicolin 1 [Source:ZFIN;Acc:ZDB-GENE-040801-129][more]
back to top
BLAST of nicolin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mst1r1.928e-1128.89macrophage stimulating 1 receptor [Source:NCBI gen... [more]
back to top
BLAST of nicolin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Nicn15.694e-1731.21nicolin 1 [Source:MGI Symbol;Acc:MGI:1913507][more]
back to top
BLAST of nicolin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9CQM0|NICN1_MOUSE3.983e-1631.21Nicolin-1 OS=Mus musculus OX=10090 GN=Nicn1 PE=1 S... [more]
sp|Q861Y6|NICN1_CANLF1.226e-1429.08Nicolin-1 OS=Canis lupus familiaris OX=9615 GN=NIC... [more]
sp|Q9BSH3|NICN1_HUMAN6.559e-1427.66Nicolin-1 OS=Homo sapiens OX=9606 GN=NICN1 PE=1 SV... [more]
back to top
BLAST of nicolin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7U8V71.541e-1632.52Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1S3JQ802.291e-1636.36nicolin-1 OS=Lingula unguis OX=7574 GN=LOC10617519... [more]
A0A4Y2I5A04.790e-1531.90Uncharacterized protein OS=Araneus ventricosus OX=... [more]
A0A5C6N3K61.968e-1430.43Nicolin-1 NPCEDRG OS=Takifugu flavidus OX=433684 G... [more]
A0A2I4AHE62.431e-1427.84nicolin-1 isoform X2 OS=Austrofundulus limnaeus OX... [more]
back to top
BLAST of nicolin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nicn11.505e-1129.08nicolin 1 [Source:NCBI gene;Acc:103041364][more]
nicn11.505e-1129.08nicolin 1 [Source:NCBI gene;Acc:103041364][more]
back to top
BLAST of nicolin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nicolin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nicolin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO481186.664e-1434.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of nicolin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nicn11.313e-1629.86nicolin 1 [Source:NCBI gene;Acc:101161050][more]
back to top
BLAST of nicolin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000054751.18.231e-17499.17SMESG000054751.1[more]
SMESG000079687.18.120e-16398.75SMESG000079687.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008113 ID=SMED30008113|Name=nicolin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=932bp
TATATAAATCTTATATGAAAATAGCTCAATTTTTATGTCTGAAATTAAAG
CTAACATAAAAAGTCCTGTTTATTTGAATTTAGATATAACAGGTTCAAAA
ACAAAATCTTCGAGACATTCTTCTGGTTGTTGCATATTTGATGTTAACTT
TGCTAATAATGCATTTCATAGTATATCAACAATATCATTTAAAAATTTTT
TTACTGCTCAAATTACTATCAAATTTCGGTCGACAAATAAAAATAGCAAG
TGGAAAATAGCTATTGATTCATTTATTTTAATGAAAGATCCTCATTCAAC
CATGAATTCTGAAGATGTAATTATTTTCGTAACAAAAGATTTCAAAGAAC
CTCTCAACGATGTTTATGTATTGCGTTTTATTCTACAACAACCATCTTGT
TTATGGAAAGAATTTAACATTAAAAATCTATGCTTTTATTCAAATCATAA
CACTTCTACTTTAAATCTTAAATCAATTCTCAAAAAAATCAATTCGTTTT
CAGACATTAAAAGTGAGTGTAATGACTTTCATAGGTCAGCACTAACGGAC
TCTCAAGAATCTTTAAACGAACTTCCTGGAAATCTCGTGGATTCGAGCAT
TATTTCACAAGAATCGATTAATGATTTGTTGATTAAAATGAAAGAAATGT
CATGTTTGCCATTATTTCAACATGAATTTATCCCAGTAGAGACTTTTACT
GGATGTGTTGAGAAAGATGGATTTTGTGATTCTACAACTTTGATTCATCC
ACTGTGAGCGGCGTAATATTTTATGGAGACGTTTGAAAGATAATTATTCA
CTTTGGAATTTCTTTTAAGATTTGGTTTTTCTTATTTGATCATGATTTAT
TTGTTAGTTTGTAAATAGTGAATCACAATTTATTACTAAATTTAAGATTT
CTGTAAATTATCAAAATTTAATCGATCATGCC
back to top

protein sequence of SMED30008113-orf-1

>SMED30008113-orf-1 ID=SMED30008113-orf-1|Name=SMED30008113-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=241bp
MSEIKANIKSPVYLNLDITGSKTKSSRHSSGCCIFDVNFANNAFHSISTI
SFKNFFTAQITIKFRSTNKNSKWKIAIDSFILMKDPHSTMNSEDVIIFVT
KDFKEPLNDVYVLRFILQQPSCLWKEFNIKNLCFYSNHNTSTLNLKSILK
KINSFSDIKSECNDFHRSALTDSQESLNELPGNLVDSSIISQESINDLLI
KMKEMSCLPLFQHEFIPVETFTGCVEKDGFCDSTTLIHPL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR040235Nicolin-1
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005874microtubule
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR31239:SF2NICOLIN-1coord: 7..153
NoneNo IPR availablePRODOMPD868899coord: 10..147
e-value: 5.0E-14
score: 189.0
IPR040235Nicolin-1PANTHERPTHR31239FAMILY NOT NAMEDcoord: 7..153