Mitogen-activated protein kinase

Overview
NameMitogen-activated protein kinase
Smed IDSMED30008112
Length (bp)1906
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mitogen-activated protein kinase (SMED30008112) t-SNE clustered cells

Violin plots show distribution of expression levels for Mitogen-activated protein kinase (SMED30008112) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mitogen-activated protein kinase (SMED30008112) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mitogen-activated protein kinase (SMED30008112) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008112

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30008112SMESG000081061.1 dd_Smed_v4_6769_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30008112SMESG000081061.1 dd_Smed_v4_6769_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30008112SMESG000081061.1 dd_Smed_v4_6769_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30008112SMESG000081061.1 dd_Smed_v6_6769_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30008112SMESG000081061.1 DN309332ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30008112SMESG000081061.1 DN309332ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30008112SMESG000081061.1 dd_Smed_v4_6769_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30008112SMESG000081061.1 dd_Smed_v4_6769_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30008112SMESG000081061.1 dd_Smed_v4_6769_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mitogen-activated protein kinase vs. Ensembl Human
Match: MAPK15 (mitogen-activated protein kinase 15 [Source:HGNC Symbol;Acc:HGNC:24667])

HSP 1 Score: 405.986 bits (1042), Expect = 1.877e-134
Identity = 183/362 (50.55%), Postives = 258/362 (71.27%), Query Frame = 3
Query:   36 MTNEVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDP---TLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQ 1112
            M   V+  I++RY ++ ++G GAYGIVWKA+D+++GE VA+KKIFDAF+++TDAQRTFREI  LQ+F  HPNII+L++V +A+NDRDIYLVFE MD+DL+ VI++G LL+ VH   I YQ+L+A +++HSG+V+HRD KPSNVLLD+NCTVKLCDFGL RS                 LGD    P    +TEYVATRWYRAPE+LL S +YT  VD+WS+GCIL E++ G+ LF G+S+L+Q+E I+  +P PSEED+ ++ S    S+L+Q+  +P +  + + P +    A DL++ LL F P KR +  QAL+H Y+++FH P  E   + ++ P  ++  QLS+ EYRS++Y MI +
Sbjct:    1 MCTVVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFREITLLQEFGDHPNIISLLDVIRAENDRDIYLVFEFMDTDLNAVIRKGGLLQDVHVRSIFYQLLRATRFLHSGHVVHRDQKPSNVLLDANCTVKLCDFGLARS-----------------LGDLPEGPEDQAVTEYVATRWYRAPEVLLSSHRYTLGVDMWSLGCILGEMLRGRPLFPGTSTLHQLELILETIPPPSEEDLLALGSGCRASVLHQLGSRPRQTLDALLPPDTSPEALDLLRRLLVFAPDKRLSATQALQHPYVQRFHCPSDEWAREADVRPRAHEGVQLSVPEYRSRVYQMILE 345          
BLAST of Mitogen-activated protein kinase vs. Ensembl Human
Match: MAPK15 (mitogen-activated protein kinase 15 [Source:HGNC Symbol;Acc:HGNC:24667])

HSP 1 Score: 405.986 bits (1042), Expect = 1.877e-134
Identity = 183/362 (50.55%), Postives = 258/362 (71.27%), Query Frame = 3
Query:   36 MTNEVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDP---TLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQ 1112
            M   V+  I++RY ++ ++G GAYGIVWKA+D+++GE VA+KKIFDAF+++TDAQRTFREI  LQ+F  HPNII+L++V +A+NDRDIYLVFE MD+DL+ VI++G LL+ VH   I YQ+L+A +++HSG+V+HRD KPSNVLLD+NCTVKLCDFGL RS                 LGD    P    +TEYVATRWYRAPE+LL S +YT  VD+WS+GCIL E++ G+ LF G+S+L+Q+E I+  +P PSEED+ ++ S    S+L+Q+  +P +  + + P +    A DL++ LL F P KR +  QAL+H Y+++FH P  E   + ++ P  ++  QLS+ EYRS++Y MI +
Sbjct:    1 MCTVVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFREITLLQEFGDHPNIISLLDVIRAENDRDIYLVFEFMDTDLNAVIRKGGLLQDVHVRSIFYQLLRATRFLHSGHVVHRDQKPSNVLLDANCTVKLCDFGLARS-----------------LGDLPEGPEDQAVTEYVATRWYRAPEVLLSSHRYTLGVDMWSLGCILGEMLRGRPLFPGTSTLHQLELILETIPPPSEEDLLALGSGCRASVLHQLGSRPRQTLDALLPPDTSPEALDLLRRLLVFAPDKRLSATQALQHPYVQRFHCPSDEWAREADVRPRAHEGVQLSVPEYRSRVYQMILE 345          
BLAST of Mitogen-activated protein kinase vs. Ensembl Human
Match: MAPK15 (mitogen-activated protein kinase 15 [Source:HGNC Symbol;Acc:HGNC:24667])

HSP 1 Score: 323.939 bits (829), Expect = 1.151e-106
Identity = 149/266 (56.02%), Postives = 202/266 (75.94%), Query Frame = 3
Query:   36 MTNEVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRS 833
            M   V+  I++RY ++ ++G GAYGIVWKA+D+++GE VA+KKIFDAF+++TDAQRTFREI  LQ+F  HPNII+L++V +A+NDRDIYLVFE MD+DL+ VI++G LL+ VH   I YQ+L+A +++HSG+V+HRD KPSNVLLD+NCTVKLCDFGL RSL  +    P+  +          D  +TEYVATRWYRAPE+LL S +YT  VD+WS+GCIL E++ G+ LF G+S+L+Q+E I+  +P PSEE  ++     CRS
Sbjct:    1 MCTVVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFREITLLQEFGDHPNIISLLDVIRAENDRDIYLVFEFMDTDLNAVIRKGGLLQDVHVRSIFYQLLRATRFLHSGHVVHRDQKPSNVLLDANCTVKLCDFGLARSLGDL----PEGPE----------DQAVTEYVATRWYRAPEVLLSSHRYTLGVDMWSLGCILGEMLRGRPLFPGTSTLHQLELILETIPPPSEEGAQTA----CRS 248          
BLAST of Mitogen-activated protein kinase vs. Ensembl Human
Match: MAPK15 (mitogen-activated protein kinase 15 [Source:HGNC Symbol;Acc:HGNC:24667])

HSP 1 Score: 320.472 bits (820), Expect = 6.825e-105
Identity = 151/288 (52.43%), Postives = 208/288 (72.22%), Query Frame = 3
Query:   36 MTNEVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELM-----------------DSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQI 848
            M   V+  I++RY ++ ++G GAYGIVWKA+D+++GE VA+KKIFDAF+++TDAQRTFREI  LQ+F  HPNII+L++V +A+NDRDIYLVFE M                 D+DL+ VI++G LL+ VH   I YQ+L+A +++HSG+V+HRD KPSNVLLD+NCTVKLCDFGL RSL  +    P+  +          D  +TEYVATRWYRAPE+LL S +YT  VD+WS+GCIL E++ G+ LF G+S+L+Q+E I+  +P PSEED+ ++ S    S+L+Q+
Sbjct:    1 MCTVVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFREITLLQEFGDHPNIISLLDVIRAENDRDIYLVFEFMGCPPSPPPPTAVRTLSADTDLNAVIRKGGLLQDVHVRSIFYQLLRATRFLHSGHVVHRDQKPSNVLLDANCTVKLCDFGLARSLGDL----PEGPE----------DQAVTEYVATRWYRAPEVLLSSHRYTLGVDMWSLGCILGEMLRGRPLFPGTSTLHQLELILETIPPPSEEDLLALGSGCRASVLHQL 274          
BLAST of Mitogen-activated protein kinase vs. Ensembl Human
Match: MAPK15 (mitogen-activated protein kinase 15 [Source:HGNC Symbol;Acc:HGNC:24667])

HSP 1 Score: 320.087 bits (819), Expect = 8.727e-105
Identity = 151/288 (52.43%), Postives = 208/288 (72.22%), Query Frame = 3
Query:   36 MTNEVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELM-----------------DSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQI 848
            M   V+  I++RY ++ ++G GAYGIVWKA+D+++GE VA+KKIFDAF+++TDAQRTFREI  LQ+F  HPNII+L++V +A+NDRDIYLVFE M                 D+DL+ VI++G LL+ VH   I YQ+L+A +++HSG+V+HRD KPSNVLLD+NCTVKLCDFGL RSL  +    P+  +          D  +TEYVATRWYRAPE+LL S +YT  VD+WS+GCIL E++ G+ LF G+S+L+Q+E I+  +P PSEED+ ++ S    S+L+Q+
Sbjct:    1 MCTVVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFREITLLQEFGDHPNIISLLDVIRAENDRDIYLVFEFMGCPPSPPPPTAVRTLSADTDLNAVIRKGGLLQDVHVRSIFYQLLRATRFLHSGHVVHRDQKPSNVLLDANCTVKLCDFGLARSLGDL----PEGPE----------DQAVTEYVATRWYRAPEVLLSSHRYTLGVDMWSLGCILGEMLRGRPLFPGTSTLHQLELILETIPPPSEEDLLALGSGCRASVLHQL 274          
BLAST of Mitogen-activated protein kinase vs. Ensembl Celegans
Match: mapk-15 (Mitogen-activated protein kinase 15 [Source:UniProtKB/Swiss-Prot;Acc:Q11179])

HSP 1 Score: 444.121 bits (1141), Expect = 9.575e-151
Identity = 207/380 (54.47%), Postives = 285/380 (75.00%), Query Frame = 3
Query:   36 MTNEVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQKKAE-KEARTQARRPNEEIKS 1172
            MT++V+++I +++D++ R+G GAYGIVWKA DK+S E VALKKIFDAF+N TD+QRTFRE+ FLQ+F  HPN+I L N+ +ADNDRDIYL FE M++DLHNVIK+G++LK VHK+YI+ Q+ +A++++HSGNV+HRDLKPSNVLLD++C VKL DFGL RSL  +E  +P+  K           P LTEYVATRWYR+PEILL + +YTK VD+WS+GCILAE+++G+ALF GSS++NQIE+I++ + +PS  D+ SI S Y  S+L ++  +P K  + I        A D+V+ LL F P+KR TVEQ L H Y+ +FH+P  E ++++E+ PP+ D  QLSID+YR +LY+MI +KKA  K  + +  RP  E KS
Sbjct:    1 MTDDVDTHIHEKFDLQKRLGKGAYGIVWKAYDKRSRETVALKKIFDAFRNPTDSQRTFREVMFLQEFGKHPNVIKLYNIFRADNDRDIYLAFEFMEADLHNVIKKGSILKDVHKQYIMCQLFRAIRFLHSGNVLHRDLKPSNVLLDADCRVKLADFGLARSLSSLED-YPEGQKM----------PDLTEYVATRWYRSPEILLAAKRYTKGVDMWSLGCILAEMLIGRALFPGSSTINQIERIMNTIAKPSRADIASIGSHYAASVLEKMPQRPRKPLDLII-TQSQTAAIDMVQRLLIFAPQKRLTVEQCLVHPYVVQFHNPSEEPVLNYEVYPPLPDHIQLSIDDYRDRLYEMIDEKKASFKRIQHEKIRPYGEDKS 368          
BLAST of Mitogen-activated protein kinase vs. Ensembl Celegans
Match: mpk-1 (Mitogen-activated protein kinase mpk-1 [Source:UniProtKB/Swiss-Prot;Acc:P39745])

HSP 1 Score: 258.84 bits (660), Expect = 2.283e-79
Identity = 147/364 (40.38%), Postives = 215/364 (59.07%), Query Frame = 3
Query:   60 IIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRK--ADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQKKAEKEARTQA 1145
            +  RY   + IG GAYG+V  A+D  + + VA+KKI   F+++T  QRT REI  L  F     I     +R    D+ +DIY+V  LM++DL+ ++K   L  + H  Y +YQIL+ +KYIHS NV+HRDLKPSN+LL++ C +K+CDFGL R            + +TD  G       LTEYVATRWYRAPEI+L S  YTKS+D+WSVGCILAE++  + LF G   L+Q+  I++ +  PS  D++ I ++  RS L  + +KP + +  ++P   D  A DL+  +L FNP  R  +EQAL H Y+E+++DP  E + +     P   E +   D  + KL ++I ++      R +A
Sbjct:   92 VAPRYVNLSYIGEGAYGMVASALDTITRDRVAIKKI-SPFEHQTFCQRTLREIKILNRFKHENIINIQEIIRSETVDSLKDIYIVQCLMETDLYKLLKTQKL-SNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARV----------TDPQTDHTG------FLTEYVATRWYRAPEIMLNSKGYTKSIDVWSVGCILAEMLSNRPLFPGKHYLDQLNLILAVVGSPSNADLQCIINDKARSYLISLPHKPKQPWARLYPG-ADPRALDLLDKMLTFNPHNRIDIEQALAHPYLEQYYDPGDEPVCEE----PFTLEMEFD-DLPKEKLKELIWEEAEAHHRRMEA 431          
BLAST of Mitogen-activated protein kinase vs. Ensembl Celegans
Match: mpk-1 (Mitogen-activated protein kinase mpk-1 [Source:UniProtKB/Swiss-Prot;Acc:P39745])

HSP 1 Score: 256.144 bits (653), Expect = 3.044e-79
Identity = 147/364 (40.38%), Postives = 215/364 (59.07%), Query Frame = 3
Query:   60 IIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRK--ADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQKKAEKEARTQA 1145
            +  RY   + IG GAYG+V  A+D  + + VA+KKI   F+++T  QRT REI  L  F     I     +R    D+ +DIY+V  LM++DL+ ++K   L  + H  Y +YQIL+ +KYIHS NV+HRDLKPSN+LL++ C +K+CDFGL R            + +TD  G       LTEYVATRWYRAPEI+L S  YTKS+D+WSVGCILAE++  + LF G   L+Q+  I++ +  PS  D++ I ++  RS L  + +KP + +  ++P   D  A DL+  +L FNP  R  +EQAL H Y+E+++DP  E + +     P   E +   D  + KL ++I ++      R +A
Sbjct:   24 VAPRYVNLSYIGEGAYGMVASALDTITRDRVAIKKI-SPFEHQTFCQRTLREIKILNRFKHENIINIQEIIRSETVDSLKDIYIVQCLMETDLYKLLKTQKL-SNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARV----------TDPQTDHTG------FLTEYVATRWYRAPEIMLNSKGYTKSIDVWSVGCILAEMLSNRPLFPGKHYLDQLNLILAVVGSPSNADLQCIINDKARSYLISLPHKPKQPWARLYPG-ADPRALDLLDKMLTFNPHNRIDIEQALAHPYLEQYYDPGDEPVCEE----PFTLEMEFD-DLPKEKLKELIWEEAEAHHRRMEA 363          
BLAST of Mitogen-activated protein kinase vs. Ensembl Celegans
Match: mpk-2 (Mitogen-activated protein kinase [Source:UniProtKB/TrEMBL;Acc:Q6ABN8])

HSP 1 Score: 247.284 bits (630), Expect = 3.213e-75
Identity = 130/337 (38.58%), Postives = 202/337 (59.94%), Query Frame = 3
Query:   72 YDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKAD--NDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSID 1076
            Y  +  +G GAYG+V KA+D ++ + VA+KKI  AF   T A+R+ RE+  L++   H NII ++++  A+  + +DIYLV +LM++DLH ++     L   H +Y  YQ+L+ +KY+HS  +IHRDLKPSN+LL+ +C +++ DFG+ R+       +  A+   D   D N    +T+YV+TRWYRAPEIL    +Y   VDLWS GCI AE++L + LF G  S++QI+ IV  L  P EE +  I S+  R  +     K    F+ IFP    + A ++V  LLQ +P KR++ +Q L+H ++ ++H+ + E      + PP     Q+ +D
Sbjct:   57 YLAEENVGAGAYGVVCKAMDTRNKKQVAIKKIPRAFTAHTLAKRSLREVRILRELL-HENIIAVLDMFTAEGAHGKDIYLVMDLMETDLHQILHSRQTLMEQHFQYFFYQLLRGLKYLHSAGIIHRDLKPSNLLLNGDCLLRIADFGMARA-------YASASTVRD---DANVGGHMTQYVSTRWYRAPEILFSMVEYDTKVDLWSAGCIFAEMLLRRQLFPGKDSVSQIKMIVYYLGSPEEEVINRITSDLVRDSIEACGRKTPLPFSAIFPKASPE-ARNMVSYLLQISPWKRYSADQILQHPFMAQYHNDQYE-----PLCPP---RVQVDVD 373          
BLAST of Mitogen-activated protein kinase vs. Ensembl Celegans
Match: F09C12.2 (Mitogen-activated protein kinase [Source:UniProtKB/TrEMBL;Acc:Q19243])

HSP 1 Score: 242.662 bits (618), Expect = 1.343e-73
Identity = 127/313 (40.58%), Postives = 196/313 (62.62%), Query Frame = 3
Query:   69 RYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNII--TLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFH 1001
            +Y  +  +G GA+G+V +AID K  + VA+KKI   FKN++ A+   REI   ++ S H NII  T + +R++ + +DIY+V +LM++DL +V+K    L   H +Y  YQILK +KY+HS  +IHRDLKP+N+LL+ +C++K+ DFG++RS    ++  P  +      GD      L++YV+T WYRAPEILL   +Y   VD+WS GCILAE++L + +FTG+ S +QI+ ++  L  P E+ +  IKS   R  ++    K    F  +FP N    A ++V  +LQ +P KRF+ EQ LE  +++ +H
Sbjct:   43 QYLAQENLGAGAFGVVCRAIDSKLNKQVAIKKITRVFKNQSTAKCALREIRITRELS-HENIINSTDVLMRESGSGQDIYIVMDLMETDLLSVLKSNQTLNEKHFQYFFYQILKGLKYLHSAGIIHRDLKPANLLLNEDCSLKIADFGMSRSGPSTKTT-PNTSPNAHISGD------LSQYVSTLWYRAPEILLSMGEYDTQVDIWSAGCILAEMLLLRPIFTGTDSYSQIQLLIEYLGTPDEQVIRRIKSPSIRDYISSFGPKTPLPFTAMFP-NASIEARNIVSKMLQISPWKRFSAEQLLEEPFVKHWH 346          
BLAST of Mitogen-activated protein kinase vs. Ensembl Fly
Match: Erk7 (gene:FBgn0052703 transcript:FBtr0302966)

HSP 1 Score: 367.851 bits (943), Expect = 3.161e-121
Identity = 170/354 (48.02%), Postives = 245/354 (69.21%), Query Frame = 3
Query:   45 EVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMI 1106
            E++  +   +D++ R+G GAYGIVWKA D+++   VALKK+FDAF++ETDAQRT+RE+ FL+ F  HPNI+ L+++ KA N+ D YLVFE M+SDLHNVIKRGN+LK VHK +++YQ++ A+K+IHSGNVIHRDLKPSN+L+DS C +K+ DFGL R+L    S     + E DG+        LT+YVATRWYRAPEIL+ S  YTK +D+W +GCIL E++  K LF G+S++NQIEKIV++LP  ++ D+ SI   +   +L++ I +  +   +    N       LVK LL  NP  R T ++A+ H Y+ +F     E+ +  ++VPP+ D  +  +D+YR+ LY++I
Sbjct:   16 ELDQTVESIFDVRKRMGKGAYGIVWKATDRRTKNTVALKKVFDAFRDETDAQRTYREVIFLRAFRCHPNIVRLVDIFKASNNLDFYLVFEFMESDLHNVIKRGNVLKDVHKRFVMYQLINAIKFIHSGNVIHRDLKPSNILIDSKCRLKVADFGLARTL---SSRRIYDDLEQDGM--------LTDYVATRWYRAPEILVASRNYTKGIDMWGLGCILGEMIRQKPLFQGTSTVNQIEKIVTSLPNVTKLDIASIGPSFGSVLLSRNIQRDRRYSLDEMMKNCCDDGISLVKALLVLNPHNRLTAKEAIRHPYVSRFQYASAEMDLHMDVVPPLKDHVRYDVDQYRNSLYELI 358          
BLAST of Mitogen-activated protein kinase vs. Ensembl Fly
Match: Erk7 (gene:FBgn0052703 transcript:FBtr0071329)

HSP 1 Score: 368.237 bits (944), Expect = 6.806e-116
Identity = 170/354 (48.02%), Postives = 245/354 (69.21%), Query Frame = 3
Query:   45 EVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMI 1106
            E++  +   +D++ R+G GAYGIVWKA D+++   VALKK+FDAF++ETDAQRT+RE+ FL+ F  HPNI+ L+++ KA N+ D YLVFE M+SDLHNVIKRGN+LK VHK +++YQ++ A+K+IHSGNVIHRDLKPSN+L+DS C +K+ DFGL R+L    S     + E DG+        LT+YVATRWYRAPEIL+ S  YTK +D+W +GCIL E++  K LF G+S++NQIEKIV++LP  ++ D+ SI   +   +L++ I +  +   +    N       LVK LL  NP  R T ++A+ H Y+ +F     E+ +  ++VPP+ D  +  +D+YR+ LY++I
Sbjct:   16 ELDQTVESIFDVRKRMGKGAYGIVWKATDRRTKNTVALKKVFDAFRDETDAQRTYREVIFLRAFRCHPNIVRLVDIFKASNNLDFYLVFEFMESDLHNVIKRGNVLKDVHKRFVMYQLINAIKFIHSGNVIHRDLKPSNILIDSKCRLKVADFGLARTL---SSRRIYDDLEQDGM--------LTDYVATRWYRAPEILVASRNYTKGIDMWGLGCILGEMIRQKPLFQGTSTVNQIEKIVTSLPNVTKLDIASIGPSFGSVLLSRNIQRDRRYSLDEMMKNCCDDGISLVKALLVLNPHNRLTAKEAIRHPYVSRFQYASAEMDLHMDVVPPLKDHVRYDVDQYRNSLYELI 358          
BLAST of Mitogen-activated protein kinase vs. Ensembl Fly
Match: Erk7 (gene:FBgn0052703 transcript:FBtr0302965)

HSP 1 Score: 368.237 bits (944), Expect = 6.806e-116
Identity = 170/354 (48.02%), Postives = 245/354 (69.21%), Query Frame = 3
Query:   45 EVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMI 1106
            E++  +   +D++ R+G GAYGIVWKA D+++   VALKK+FDAF++ETDAQRT+RE+ FL+ F  HPNI+ L+++ KA N+ D YLVFE M+SDLHNVIKRGN+LK VHK +++YQ++ A+K+IHSGNVIHRDLKPSN+L+DS C +K+ DFGL R+L    S     + E DG+        LT+YVATRWYRAPEIL+ S  YTK +D+W +GCIL E++  K LF G+S++NQIEKIV++LP  ++ D+ SI   +   +L++ I +  +   +    N       LVK LL  NP  R T ++A+ H Y+ +F     E+ +  ++VPP+ D  +  +D+YR+ LY++I
Sbjct:   16 ELDQTVESIFDVRKRMGKGAYGIVWKATDRRTKNTVALKKVFDAFRDETDAQRTYREVIFLRAFRCHPNIVRLVDIFKASNNLDFYLVFEFMESDLHNVIKRGNVLKDVHKRFVMYQLINAIKFIHSGNVIHRDLKPSNILIDSKCRLKVADFGLARTL---SSRRIYDDLEQDGM--------LTDYVATRWYRAPEILVASRNYTKGIDMWGLGCILGEMIRQKPLFQGTSTVNQIEKIVTSLPNVTKLDIASIGPSFGSVLLSRNIQRDRRYSLDEMMKNCCDDGISLVKALLVLNPHNRLTAKEAIRHPYVSRFQYASAEMDLHMDVVPPLKDHVRYDVDQYRNSLYELI 358          
BLAST of Mitogen-activated protein kinase vs. Ensembl Fly
Match: rl (gene:FBgn0003256 transcript:FBtr0113703)

HSP 1 Score: 269.24 bits (687), Expect = 3.892e-84
Identity = 146/316 (46.20%), Postives = 199/316 (62.97%), Query Frame = 3
Query:   69 RYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITL---INVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDP 1007
            RY     IG GAYG+V  A D  + + VA+KKI   F+++T  QRT REI  L  F  H NII +   + V   D  RD+Y+V  LM++DL+ ++K   L  + H  Y +YQIL+ +KYIHS NV+HRDLKPSN+LL+  C +K+CDFGL R           A+ E D  G       LTEYVATRWYRAPEI+L S  YTKS+D+WSVGCILAE++  + +F G   L+Q+  I+  L  PS +D+E I +E  R+ L  + +KP   + ++FP N D +A DL+  +L FNP KR  VE+AL H Y+E+++DP
Sbjct:   37 RYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKI-SPFEHQTYCQRTLREITILTRFK-HENIIDIRDILRVDSIDQMRDVYIVQCLMETDLYKLLKTQRL-SNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLARI----------ADPEHDHTG------FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKPNVPWAKLFP-NADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDP 332          
BLAST of Mitogen-activated protein kinase vs. Ensembl Fly
Match: rl (gene:FBgn0003256 transcript:FBtr0113702)

HSP 1 Score: 269.24 bits (687), Expect = 3.892e-84
Identity = 146/316 (46.20%), Postives = 199/316 (62.97%), Query Frame = 3
Query:   69 RYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITL---INVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDP 1007
            RY     IG GAYG+V  A D  + + VA+KKI   F+++T  QRT REI  L  F  H NII +   + V   D  RD+Y+V  LM++DL+ ++K   L  + H  Y +YQIL+ +KYIHS NV+HRDLKPSN+LL+  C +K+CDFGL R           A+ E D  G       LTEYVATRWYRAPEI+L S  YTKS+D+WSVGCILAE++  + +F G   L+Q+  I+  L  PS +D+E I +E  R+ L  + +KP   + ++FP N D +A DL+  +L FNP KR  VE+AL H Y+E+++DP
Sbjct:   37 RYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKI-SPFEHQTYCQRTLREITILTRFK-HENIIDIRDILRVDSIDQMRDVYIVQCLMETDLYKLLKTQRL-SNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLARI----------ADPEHDHTG------FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKPNVPWAKLFP-NADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDP 332          
BLAST of Mitogen-activated protein kinase vs. Ensembl Zebrafish
Match: mapk15 (mitogen-activated protein kinase 15 [Source:ZFIN;Acc:ZDB-GENE-050522-307])

HSP 1 Score: 468.003 bits (1203), Expect = 3.756e-159
Identity = 217/366 (59.29%), Postives = 288/366 (78.69%), Query Frame = 3
Query:   45 EVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQKKAEKEARTQ 1142
            EVE +I  +Y+IK R+G GAYGIVWKA+D+KSGE VA+KKIFDAF+N TDAQRTFREI FLQ+F  HPNII L+NV +A ND+DIYL+FE MD+DLH VIK+GNLLK +HK Y++YQ+LKA KY+HSGNVIHRD KPSN+LLDS+C VKLCDFGL RSL+QI+        E  G      +P LTEYVATRWYRAPEILLGS++YTK VD+WS+GCILAE++LGK LF G+S++NQIEKI++ +P PS ED+ +I+SEY  S++ +++ +P    +EI PA+V   A DL++ LL FNP KR + E+AL H Y+ KFH+P  E  + ++++ P++D+ QLS+ +YR+KLY+MI +K+A ++ + Q
Sbjct:    5 EVEEHISSKYEIKRRLGKGAYGIVWKAVDRKSGETVAVKKIFDAFRNRTDAQRTFREIMFLQEFGDHPNIIKLLNVIRAQNDKDIYLIFEFMDTDLHAVIKKGNLLKDIHKRYVMYQLLKATKYLHSGNVIHRDQKPSNILLDSDCFVKLCDFGLARSLYQIQ--------EDAG------NPALTEYVATRWYRAPEILLGSSRYTKGVDMWSIGCILAEMLLGKPLFPGTSTINQIEKIMNVIPHPSTEDVLAIRSEYGASVIQRMLLRPQVPLDEILPASVPPDALDLLQRLLLFNPDKRLSAEEALRHPYVSKFHNPSSEPSLLYDVILPVDDDVQLSVTQYRNKLYEMIVEKRASRQMQKQ 356          
BLAST of Mitogen-activated protein kinase vs. Ensembl Zebrafish
Match: mapk3 (mitogen-activated protein kinase 3 [Source:ZFIN;Acc:ZDB-GENE-040121-1])

HSP 1 Score: 266.159 bits (679), Expect = 1.211e-82
Identity = 154/362 (42.54%), Postives = 216/362 (59.67%), Query Frame = 3
Query:   69 RYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITL---INVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQKKAEKEARTQA 1145
            RY     IG GAYG+V  A D  +   VA+KKI   F+++T  QRT REI  L  F  H NII +   +  R  D  RD+Y+V +LM++DL+ ++K   L  + H  Y +YQIL+ +KYIHS NV+HRDLKPSN+L+++ C +K+CDFGL R           A+ E D  G       LTEYVATRWYRAPEI+L S  YTKS+D+WSVGCILAE++  + +F G   L+Q+  I+  L  PS++D+  I +   R+ L  +  KP   +N++FP   D  A DL+  +L FNP KR  VEQAL H Y+E+++DP  E + +     P     +L  D  + KL ++I ++ A  +A  Q 
Sbjct:   55 RYTDLQYIGEGAYGMVCSAFDNVNKIRVAIKKI-SPFEHQTYCQRTLREIKILLRFH-HENIIGINDILRARHIDYMRDVYIVQDLMETDLYKLLKTQQL-SNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARI----------ADPEHDHTG------FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSQDDLNCIINMKARNYLQSLPQKPKIPWNKLFP-KADNKALDLLDRMLTFNPLKRINVEQALAHPYLEQYYDPSDEPVAEE----PFTFNMELD-DLPKEKLKELIFEETARFQANYQG 391          
BLAST of Mitogen-activated protein kinase vs. Ensembl Zebrafish
Match: mapk1 (mitogen-activated protein kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030722-2])

HSP 1 Score: 259.225 bits (661), Expect = 3.011e-80
Identity = 142/316 (44.94%), Postives = 198/316 (62.66%), Query Frame = 3
Query:   69 RYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITL---INVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDP 1007
            RY   + IG GAYG+V  A D+ +   VA+KKI   F+++T  QRT REI  L  F  H NII +   I     D  +D+Y+V +LM++DL+ ++K  +L  + H  Y +YQIL+ +KYIHS NV+HRDLKPSN+LL++ C +K+CDFGL R           A+ + D  G       LTEYVATRWYRAPEI+L S  YTKS+D+WSVGCILAE++  + +F G   L+Q+  I+  L  PS+ED+  I +   R+ L  +  +    +N +FP N D  A DL+  +L FNP KR  VE+AL H Y+E+++DP
Sbjct:   33 RYSNLSYIGEGAYGMVCSAYDRDNKVRVAIKKI-SPFEHQTYCQRTLREIKILLRFK-HENIIGINDIIRTPTIDQMKDVYIVQDLMETDLYKLLKTQHL-SNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARV----------ADPDHDHTG------FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRSKVPWNRLFP-NADPKALDLLDKMLTFNPHKRIEVEEALAHPYLEQYYDP 328          
BLAST of Mitogen-activated protein kinase vs. Ensembl Zebrafish
Match: mapk1 (mitogen-activated protein kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030722-2])

HSP 1 Score: 259.225 bits (661), Expect = 3.011e-80
Identity = 142/316 (44.94%), Postives = 198/316 (62.66%), Query Frame = 3
Query:   69 RYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITL---INVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDP 1007
            RY   + IG GAYG+V  A D+ +   VA+KKI   F+++T  QRT REI  L  F  H NII +   I     D  +D+Y+V +LM++DL+ ++K  +L  + H  Y +YQIL+ +KYIHS NV+HRDLKPSN+LL++ C +K+CDFGL R           A+ + D  G       LTEYVATRWYRAPEI+L S  YTKS+D+WSVGCILAE++  + +F G   L+Q+  I+  L  PS+ED+  I +   R+ L  +  +    +N +FP N D  A DL+  +L FNP KR  VE+AL H Y+E+++DP
Sbjct:   33 RYSNLSYIGEGAYGMVCSAYDRDNKVRVAIKKI-SPFEHQTYCQRTLREIKILLRFK-HENIIGINDIIRTPTIDQMKDVYIVQDLMETDLYKLLKTQHL-SNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARV----------ADPDHDHTG------FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRSKVPWNRLFP-NADPKALDLLDKMLTFNPHKRIEVEEALAHPYLEQYYDP 328          
BLAST of Mitogen-activated protein kinase vs. Ensembl Zebrafish
Match: mapk1 (mitogen-activated protein kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030722-2])

HSP 1 Score: 259.225 bits (661), Expect = 3.011e-80
Identity = 142/316 (44.94%), Postives = 198/316 (62.66%), Query Frame = 3
Query:   69 RYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITL---INVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDP 1007
            RY   + IG GAYG+V  A D+ +   VA+KKI   F+++T  QRT REI  L  F  H NII +   I     D  +D+Y+V +LM++DL+ ++K  +L  + H  Y +YQIL+ +KYIHS NV+HRDLKPSN+LL++ C +K+CDFGL R           A+ + D  G       LTEYVATRWYRAPEI+L S  YTKS+D+WSVGCILAE++  + +F G   L+Q+  I+  L  PS+ED+  I +   R+ L  +  +    +N +FP N D  A DL+  +L FNP KR  VE+AL H Y+E+++DP
Sbjct:   33 RYSNLSYIGEGAYGMVCSAYDRDNKVRVAIKKI-SPFEHQTYCQRTLREIKILLRFK-HENIIGINDIIRTPTIDQMKDVYIVQDLMETDLYKLLKTQHL-SNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARV----------ADPDHDHTG------FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRSKVPWNRLFP-NADPKALDLLDKMLTFNPHKRIEVEEALAHPYLEQYYDP 328          
BLAST of Mitogen-activated protein kinase vs. Ensembl Xenopus
Match: atxn7 (ataxin 7 [Source:Xenbase;Acc:XB-GENE-956283])

HSP 1 Score: 489.96 bits (1260), Expect = 1.413e-166
Identity = 268/600 (44.67%), Postives = 374/600 (62.33%), Query Frame = 3
Query:   45 EVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQKKAEKEARTQARRPNEE-IKSLRXXXXXXXX---------------XXXENAMIMEQKIASRA-NYDIAFGRTTHQRP---PPPKNNHASNQSNNPLIGMKAFLTKTENTKIDNSRSRLSHSAFQ-RDDGNSRNETS--FQKKSFGSDVEQKRPSRNVMTCSKEASNPVILRDLHSTSISATGNKVSMQSRPASAQHVRSNSATFGRKQFD---NAKNHSNMRSTLGSYSQTYGTVSSSQLNNL 1766
            EVE +I ++Y+IK R+G GAYGIVWKAID+KSGE VA+KKIFDAF+N TDAQRTFREI FLQ+F  HPNII L+NV +A ND+DIYLVFE M++DLH VIK+GNLL+ +H  YI+YQ+LKA K+IHSGNVIHRD KPSN+LLD +C VKLCDFGL RSL+QI+        E  G      +P LTEYVATRWYRAPEILL S +YTK VD+WSVGCIL E++LGK LF G+S++NQIE+I+S +  P+ ED+ +I+SEY  S++ ++  K      E+FPA+  + A DL+  LL FNP KR T E ALEH Y+ +FH P  E  +D++++ P++D+ QLS+ EYR+KLY+MI ++K     R Q R   +E + SL S                         E +  + Q+ A  A N   A   +T Q P    P  N  + + ++      +A   + E  +  N +     +A + R +  SR+ T+   + +SF    + +  + N     K+ +       L + S++A   +++ ++ P   +  RS +  FGRK F    N ++  + ++TL SY+Q YGT+S S L+NL
Sbjct:    5 EVEDHISQKYEIKKRLGKGAYGIVWKAIDRKSGEIVAVKKIFDAFRNRTDAQRTFREIMFLQEFGEHPNIIKLLNVIRAQNDKDIYLVFEHMETDLHAVIKKGNLLRDIHMRYILYQLLKATKFIHSGNVIHRDQKPSNILLDGDCLVKLCDFGLARSLYQIQ--------EDAG------NPALTEYVATRWYRAPEILLASHRYTKGVDMWSVGCILGEMLLGKPLFPGTSTINQIERIMSIIEPPTHEDILAIRSEYGASVIGRMAAKQRVPLAELFPASCPREALDLLSKLLVFNPGKRLTAEGALEHPYVSRFHSPAREPALDYDVILPVDDDTQLSVAEYRNKLYEMILERKM--NIRRQKREAQKESVSSLASAAEGKQVADTSKHPAAPTGTNPAPQEISSTVPQRAAIAAPNQPPALKDSTQQSPKGKAPSSNPISHSTTHGSSEDWRAAQNRKEGQQNSNQQGAAGSTAQEVRKEAESRSRTAPIGRARSFSHSQQARAAATNSALMRKDGA------PLGTVSVAAVSARLNQRAPPVQGRDQRS-APRFGRKMFQGKTNVESAGDPKATLHSYTQAYGTISKSALHNL 581          
BLAST of Mitogen-activated protein kinase vs. Ensembl Xenopus
Match: atxn7 (ataxin 7 [Source:Xenbase;Acc:XB-GENE-956283])

HSP 1 Score: 443.736 bits (1140), Expect = 1.368e-149
Identity = 206/347 (59.37%), Postives = 265/347 (76.37%), Query Frame = 3
Query:   78 IKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQKK 1118
            I++ IG  AYGIVWKAID+KSGE VA+KKIFDAF+N TDAQRTFREI FLQ+F  HPNII L+NV +A ND+DIYLVFE M++DLH VIK+GNLL+ +H  YI+YQ+LKA K+IHSGNVIHRD KPSN+LLD +C VKLCDFGL RSL+QI+        E  G      +P LTEYVATRWYRAPEILL S +YTK VD+WSVGCIL E++LGK LF G+S++NQIE+I+S +  P+ ED+ +I+SEY  S++ ++  K      E+FPA+  + A DL+  LL FNP KR T E ALEH Y+ +FH P  E  +D++++ P++D+ QLS+ EYR+KLY+MI ++K
Sbjct:   43 IRHCIGWAAYGIVWKAIDRKSGEIVAVKKIFDAFRNRTDAQRTFREIMFLQEFGEHPNIIKLLNVIRAQNDKDIYLVFEHMETDLHAVIKKGNLLRDIHMRYILYQLLKATKFIHSGNVIHRDQKPSNILLDGDCLVKLCDFGLARSLYQIQ--------EDAG------NPALTEYVATRWYRAPEILLASHRYTKGVDMWSVGCILGEMLLGKPLFPGTSTINQIERIMSIIEPPTHEDILAIRSEYGASVIGRMAAKQRVPLAELFPASCPREALDLLSKLLVFNPGKRLTAEGALEHPYVSRFHSPAREPALDYDVILPVDDDTQLSVAEYRNKLYEMILERK 375          
BLAST of Mitogen-activated protein kinase vs. Ensembl Xenopus
Match: cdknx (cyclin-dependent kinase inhibitor xic1 [Source:Xenbase;Acc:XB-GENE-1032978])

HSP 1 Score: 258.84 bits (660), Expect = 6.912e-80
Identity = 143/323 (44.27%), Postives = 203/323 (62.85%), Query Frame = 3
Query:   69 RYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKA---DNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMD 1028
            RY   + IG GAYG+V  A D  +   VA+KKI   F+++T  QRT REI  L  F  H NII + ++ +A   +  +D+Y+V +LM++DL+ ++K  +L  + H  Y +YQIL+ +KYIHS NV+HRDLKPSN+LL++ C +K+CDFGL R           A+ + D  G       LTEYVATRWYRAPEI+L S  YTKS+D+WSVGCILAE++  + +F G   L+Q+  I+  L  PS+ED+  I +   R+ L  + +K    +N +FP N D  A DL+  +L FNP KR  VE AL H Y+E+++DP  E + +
Sbjct:   35 RYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-SPFEHQTYCQRTLREIKILLRFK-HENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHL-SNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARV----------ADPDHDHTG------FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFP-NADPKALDLLDKMLTFNPHKRIEVEAALAHPYLEQYYDPSDEPVAE 337          
BLAST of Mitogen-activated protein kinase vs. Ensembl Xenopus
Match: cdknx (cyclin-dependent kinase inhibitor xic1 [Source:Xenbase;Acc:XB-GENE-1032978])

HSP 1 Score: 258.07 bits (658), Expect = 9.383e-80
Identity = 142/316 (44.94%), Postives = 200/316 (63.29%), Query Frame = 3
Query:   69 RYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKA---DNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDP 1007
            RY   + IG GAYG+V  A D  +   VA+KKI   F+++T  QRT REI  L  F  H NII + ++ +A   +  +D+Y+V +LM++DL+ ++K  +L  + H  Y +YQIL+ +KYIHS NV+HRDLKPSN+LL++ C +K+CDFGL R           A+ + D  G       LTEYVATRWYRAPEI+L S  YTKS+D+WSVGCILAE++  + +F G   L+Q+  I+  L  PS+ED+  I +   R+ L  + +K    +N +FP N D  A DL+  +L FNP KR  VE AL H Y+E+++DP
Sbjct:   27 RYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-SPFEHQTYCQRTLREIKILLRFK-HENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHL-SNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARV----------ADPDHDHTG------FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFP-NADPKALDLLDKMLTFNPHKRIEVEAALAHPYLEQYYDP 322          
BLAST of Mitogen-activated protein kinase vs. Ensembl Xenopus
Match: cdknx (cyclin-dependent kinase inhibitor xic1 [Source:Xenbase;Acc:XB-GENE-1032978])

HSP 1 Score: 258.07 bits (658), Expect = 1.052e-79
Identity = 142/316 (44.94%), Postives = 200/316 (63.29%), Query Frame = 3
Query:   69 RYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKA---DNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDP 1007
            RY   + IG GAYG+V  A D  +   VA+KKI   F+++T  QRT REI  L  F  H NII + ++ +A   +  +D+Y+V +LM++DL+ ++K  +L  + H  Y +YQIL+ +KYIHS NV+HRDLKPSN+LL++ C +K+CDFGL R           A+ + D  G       LTEYVATRWYRAPEI+L S  YTKS+D+WSVGCILAE++  + +F G   L+Q+  I+  L  PS+ED+  I +   R+ L  + +K    +N +FP N D  A DL+  +L FNP KR  VE AL H Y+E+++DP
Sbjct:   31 RYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-SPFEHQTYCQRTLREIKILLRFK-HENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHL-SNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARV----------ADPDHDHTG------FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFP-NADPKALDLLDKMLTFNPHKRIEVEAALAHPYLEQYYDP 326          
BLAST of Mitogen-activated protein kinase vs. Ensembl Mouse
Match: Mapk15 (mitogen-activated protein kinase 15 [Source:MGI Symbol;Acc:MGI:2652894])

HSP 1 Score: 401.749 bits (1031), Expect = 7.952e-133
Identity = 189/376 (50.27%), Postives = 256/376 (68.09%), Query Frame = 3
Query:   45 EVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDP---TLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQKKAEKEARTQARRPNEE 1163
            EV+ ++ +RY IK R+G GAYGIVWKA+D+++GE VA+KKIFDAF+++ DAQRTFREI  L++F GHPNII L++V  A NDRDIYLVFE MD+DL+ VI++G LLK +HK  I YQ+L+A K+IHSG VIHRD KP+NVLLDS C VKLCDFGL RS                 LGD    P    LTEYVATRWYRAPE+LL S  YT  VD+WS+GCIL E++ G+ LF G+S+ +Q+E I+  +P PS E+++ + S+Y   IL  +  +P +  + + P +    A DL+K LL F P KR + EQAL+H Y+++FH P+ E   + ++  P+++  QLS  EYR +LY +I ++         +R P EE
Sbjct:    5 EVDRHVAQRYLIKRRLGKGAYGIVWKAMDRRTGEVVAIKKIFDAFRDQIDAQRTFREIMLLKEFGGHPNIIRLLDVIPAKNDRDIYLVFESMDTDLNAVIQKGRLLKDIHKRCIFYQLLRATKFIHSGRVIHRDQKPANVLLDSACRVKLCDFGLARS-----------------LGDLPEGPGGQALTEYVATRWYRAPEVLLSSRWYTPGVDMWSLGCILGEMLRGQPLFPGTSTFHQLELILKTIPLPSMEELQDLGSDYSALILQNLGSRPQQTLDALLPPDTPPEALDLLKRLLAFAPDKRLSAEQALQHPYVQRFHCPDREWARESDVRLPVHEGDQLSAPEYRKRLYQIILEQSG------NSRSPREE 357          
BLAST of Mitogen-activated protein kinase vs. Ensembl Mouse
Match: Mapk1 (mitogen-activated protein kinase 1 [Source:MGI Symbol;Acc:MGI:1346858])

HSP 1 Score: 260.766 bits (665), Expect = 7.264e-81
Identity = 145/321 (45.17%), Postives = 203/321 (63.24%), Query Frame = 3
Query:   69 RYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKA---DNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEII 1022
            RY   + IG GAYG+V  A D  +   VA+KKI   F+++T  QRT REI  L  F  H NII + ++ +A   +  +D+Y+V +LM++DL+ ++K  +L  + H  Y +YQIL+ +KYIHS NV+HRDLKPSN+LL++ C +K+CDFGL R           A+ + D  G       LTEYVATRWYRAPEI+L S  YTKS+D+WSVGCILAE++  + +F G   L+Q+  I+  L  PS+ED+  I +   R+ L  + +K    +N +FP N D  A DL+  +L FNP KR  VEQAL H Y+E+++DP  E I
Sbjct:   22 RYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKI-SPFEHQTYCQRTLREIKILLRFR-HENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHL-SNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARV----------ADPDHDHTG------FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFP-NADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPI 322          
BLAST of Mitogen-activated protein kinase vs. Ensembl Mouse
Match: Mapk1 (mitogen-activated protein kinase 1 [Source:MGI Symbol;Acc:MGI:1346858])

HSP 1 Score: 260.766 bits (665), Expect = 7.264e-81
Identity = 145/321 (45.17%), Postives = 203/321 (63.24%), Query Frame = 3
Query:   69 RYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKA---DNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEII 1022
            RY   + IG GAYG+V  A D  +   VA+KKI   F+++T  QRT REI  L  F  H NII + ++ +A   +  +D+Y+V +LM++DL+ ++K  +L  + H  Y +YQIL+ +KYIHS NV+HRDLKPSN+LL++ C +K+CDFGL R           A+ + D  G       LTEYVATRWYRAPEI+L S  YTKS+D+WSVGCILAE++  + +F G   L+Q+  I+  L  PS+ED+  I +   R+ L  + +K    +N +FP N D  A DL+  +L FNP KR  VEQAL H Y+E+++DP  E I
Sbjct:   22 RYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKI-SPFEHQTYCQRTLREIKILLRFR-HENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHL-SNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARV----------ADPDHDHTG------FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFP-NADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPI 322          
BLAST of Mitogen-activated protein kinase vs. Ensembl Mouse
Match: Mapk1 (mitogen-activated protein kinase 1 [Source:MGI Symbol;Acc:MGI:1346858])

HSP 1 Score: 260.766 bits (665), Expect = 7.264e-81
Identity = 145/321 (45.17%), Postives = 203/321 (63.24%), Query Frame = 3
Query:   69 RYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKA---DNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEII 1022
            RY   + IG GAYG+V  A D  +   VA+KKI   F+++T  QRT REI  L  F  H NII + ++ +A   +  +D+Y+V +LM++DL+ ++K  +L  + H  Y +YQIL+ +KYIHS NV+HRDLKPSN+LL++ C +K+CDFGL R           A+ + D  G       LTEYVATRWYRAPEI+L S  YTKS+D+WSVGCILAE++  + +F G   L+Q+  I+  L  PS+ED+  I +   R+ L  + +K    +N +FP N D  A DL+  +L FNP KR  VEQAL H Y+E+++DP  E I
Sbjct:   22 RYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKI-SPFEHQTYCQRTLREIKILLRFR-HENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHL-SNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARV----------ADPDHDHTG------FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFP-NADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPI 322          
BLAST of Mitogen-activated protein kinase vs. Ensembl Mouse
Match: Mapk3 (mitogen-activated protein kinase 3 [Source:MGI Symbol;Acc:MGI:1346859])

HSP 1 Score: 259.61 bits (662), Expect = 3.931e-80
Identity = 142/320 (44.38%), Postives = 200/320 (62.50%), Query Frame = 3
Query:   69 RYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKA---DNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEI 1019
            RY     IG GAYG+V  A D      VA+KKI   F+++T  QRT REI  L  F  H N+I + ++ +A   +  RD+Y+V +LM++DL+ ++K    L + H  Y +YQIL+ +KYIHS NV+HRDLKPSN+L+++ C +K+CDFGL R           A+ E D  G       LTEYVATRWYRAPEI+L S  YTKS+D+WSVGCILAE++  + +F G   L+Q+  I+  L  PS+ED+  I +   R+ L  +  K    + ++FP + D  A DL+  +L FNP KR TVE+AL H Y+E+++DP  E+
Sbjct:   42 RYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKI-SPFEHQTYCQRTLREIQILLRFR-HENVIGIRDILRAPTLEAMRDVYIVQDLMETDLYKLLK-SQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARI----------ADPEHDHTG------FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKS-DSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEV 341          
BLAST of Mitogen-activated protein kinase vs. UniProt/SwissProt
Match: sp|Q501Q9|MK15_XENLA (Mitogen-activated protein kinase 15 OS=Xenopus laevis OX=8355 GN=mapk15 PE=1 SV=1)

HSP 1 Score: 488.034 bits (1255), Expect = 3.525e-165
Identity = 268/613 (43.72%), Postives = 375/613 (61.17%), Query Frame = 3
Query:   45 EVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQKKAEKEARTQARRPNEEIKSLRXXXXXXXXXXXENAMIMEQKIASRANYDIAFGRT-THQRPPPPKNNHASNQSNNPLIGMKAFL-----------TKTENTKIDNSRSR-LSHSAFQ---RDDGNSRNETSFQKKSFGSDVEQKRP-----SRNV-----------MTCSKEASNPVILRD----LHSTSISATGNKVSMQSRPASAQHVRSNSATFGRKQFD---NAKNHSNMRSTLGSYSQTYGTVSSSQLNNL 1766
            EVE +I ++YDIK R+G GAYGIVWKAID+KSGE VA+KKIFDAF+N TDAQRTFREI FLQ+F  HPNII L+NV +A ND+DIYLVFE M++DLH VIK+GNLLK +H  YI+YQ+LKA K+IHSGNVIHRD KPSN+LLD +C VKLCDFGL RSL+QI+          + +G+    P LTEYVATRWYRAPEILL S +YTK VD+WSVGCIL E++LGK LF G+S++NQIE+I+S +  P+ ED+ SIKSEY  S+++++  K      E+FPA+  + A DL+  LL FNP KR T E+ALEH Y+ +FH P  E  +D++++ P++D+ QLS+ EYR+KLY+MI ++K         RR   E                     +++ ++S AN       T T + P PP   + + Q  +  +  +A +           +  ++ KI    S  ++HS       D   S N+ + Q+ + G+  ++ R      SR                   A+N  ++R       + S++A   +++ ++ P   +  RS +  FGRK F    N ++  + ++TL SY+Q YGT+S + L NL
Sbjct:    5 EVEDHISQKYDIKKRLGKGAYGIVWKAIDRKSGEIVAVKKIFDAFRNRTDAQRTFREIMFLQEFGEHPNIIKLLNVIRAQNDKDIYLVFEHMETDLHAVIKKGNLLKDIHMRYILYQLLKATKFIHSGNVIHRDQKPSNILLDGDCLVKLCDFGLARSLYQIQ----------EDVGN----PALTEYVATRWYRAPEILLASNRYTKGVDMWSVGCILGEMLLGKPLFPGTSTINQIERIMSIIEPPTHEDIVSIKSEYGASVISRMSSKHKVPMAELFPASCPREALDLLSKLLVFNPGKRLTAEEALEHPYVSRFHSPAREPALDYDVILPVDDDIQLSVAEYRNKLYEMILERK------MNIRRQKRES--------------------LKESVSSSANGAKDRQDTDTSKTPAPPAGTNPAPQPTSSTVPQRAAIAAPNQPPAQKDSTQQSPKIKAPSSNPITHSTTHGSTEDWRTSHNKKAGQQGAAGTTAQEVRKEVESRSRTAPIGRARSFSHSQQARAAATNSALIRKDAPPTGTVSVAAVSARLNQRTAPIQGRDPRS-APRFGRKMFQGKTNVESAGDPKATLHSYTQAYGTISKAALQNL 576          
BLAST of Mitogen-activated protein kinase vs. UniProt/SwissProt
Match: sp|Q11179|MK15_CAEEL (Mitogen-activated protein kinase 15 OS=Caenorhabditis elegans OX=6239 GN=mapk-15 PE=1 SV=2)

HSP 1 Score: 444.121 bits (1141), Expect = 1.218e-149
Identity = 207/380 (54.47%), Postives = 285/380 (75.00%), Query Frame = 3
Query:   36 MTNEVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQKKAE-KEARTQARRPNEEIKS 1172
            MT++V+++I +++D++ R+G GAYGIVWKA DK+S E VALKKIFDAF+N TD+QRTFRE+ FLQ+F  HPN+I L N+ +ADNDRDIYL FE M++DLHNVIK+G++LK VHK+YI+ Q+ +A++++HSGNV+HRDLKPSNVLLD++C VKL DFGL RSL  +E  +P+  K           P LTEYVATRWYR+PEILL + +YTK VD+WS+GCILAE+++G+ALF GSS++NQIE+I++ + +PS  D+ SI S Y  S+L ++  +P K  + I        A D+V+ LL F P+KR TVEQ L H Y+ +FH+P  E ++++E+ PP+ D  QLSID+YR +LY+MI +KKA  K  + +  RP  E KS
Sbjct:    1 MTDDVDTHIHEKFDLQKRLGKGAYGIVWKAYDKRSRETVALKKIFDAFRNPTDSQRTFREVMFLQEFGKHPNVIKLYNIFRADNDRDIYLAFEFMEADLHNVIKKGSILKDVHKQYIMCQLFRAIRFLHSGNVLHRDLKPSNVLLDADCRVKLADFGLARSLSSLED-YPEGQKM----------PDLTEYVATRWYRSPEILLAAKRYTKGVDMWSLGCILAEMLIGRALFPGSSTINQIERIMNTIAKPSRADIASIGSHYAASVLEKMPQRPRKPLDLII-TQSQTAAIDMVQRLLIFAPQKRLTVEQCLVHPYVVQFHNPSEEPVLNYEVYPPLPDHIQLSIDDYRDRLYEMIDEKKASFKRIQHEKIRPYGEDKS 368          
BLAST of Mitogen-activated protein kinase vs. UniProt/SwissProt
Match: sp|Q8TD08|MK15_HUMAN (Mitogen-activated protein kinase 15 OS=Homo sapiens OX=9606 GN=MAPK15 PE=1 SV=1)

HSP 1 Score: 405.986 bits (1042), Expect = 9.014e-134
Identity = 183/362 (50.55%), Postives = 258/362 (71.27%), Query Frame = 3
Query:   36 MTNEVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDP---TLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQ 1112
            M   V+  I++RY ++ ++G GAYGIVWKA+D+++GE VA+KKIFDAF+++TDAQRTFREI  LQ+F  HPNII+L++V +A+NDRDIYLVFE MD+DL+ VI++G LL+ VH   I YQ+L+A +++HSG+V+HRD KPSNVLLD+NCTVKLCDFGL RS                 LGD    P    +TEYVATRWYRAPE+LL S +YT  VD+WS+GCIL E++ G+ LF G+S+L+Q+E I+  +P PSEED+ ++ S    S+L+Q+  +P +  + + P +    A DL++ LL F P KR +  QAL+H Y+++FH P  E   + ++ P  ++  QLS+ EYRS++Y MI +
Sbjct:    1 MCTVVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFREITLLQEFGDHPNIISLLDVIRAENDRDIYLVFEFMDTDLNAVIRKGGLLQDVHVRSIFYQLLRATRFLHSGHVVHRDQKPSNVLLDANCTVKLCDFGLARS-----------------LGDLPEGPEDQAVTEYVATRWYRAPEVLLSSHRYTLGVDMWSLGCILGEMLRGRPLFPGTSTLHQLELILETIPPPSEEDLLALGSGCRASVLHQLGSRPRQTLDALLPPDTSPEALDLLRRLLVFAPDKRLSATQALQHPYVQRFHCPSDEWAREADVRPRAHEGVQLSVPEYRSRVYQMILE 345          
BLAST of Mitogen-activated protein kinase vs. UniProt/SwissProt
Match: sp|Q9Z2A6|MK15_RAT (Mitogen-activated protein kinase 15 OS=Rattus norvegicus OX=10116 GN=Mapk15 PE=1 SV=2)

HSP 1 Score: 403.29 bits (1035), Expect = 1.434e-132
Identity = 190/376 (50.53%), Postives = 258/376 (68.62%), Query Frame = 3
Query:   45 EVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDP---TLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQKKAEKEARTQARRPNEE 1163
            EV+ ++ +RY IK R+G GAYGIVWKA+D+++GE VA+KKIFDAF+++TDAQRTFREI  L++F GHPNII L++V  A NDRDIYLVFE MD+DL+ VI++G LL+ +HK  I YQ+L+A K+IHSG VIHRD KP+NVLLD+ C VKLCDFGL RS                 L DF   P    LTEYVATRWYRAPE+LL S  YT  VD+WS+GCIL E++ G+ LF G+S+ +Q+E I+  +P PS E+++ + S+Y   IL  +  +P +  + + P +    A DL+K LL F P KR + EQAL+H Y+++FH P+ E     ++  P+++  QLS  EYR++LY MI ++      R  +R P EE
Sbjct:    5 EVDRHVSQRYLIKRRLGKGAYGIVWKAMDRRTGEVVAIKKIFDAFRDQTDAQRTFREIMLLREFGGHPNIIRLLDVIPAKNDRDIYLVFESMDTDLNAVIQKGRLLEDIHKRCIFYQLLRATKFIHSGRVIHRDQKPANVLLDAACRVKLCDFGLARS-----------------LSDFPEGPGGQALTEYVATRWYRAPEVLLSSRWYTPGVDMWSLGCILGEMLRGQPLFPGTSTFHQLELILETIPLPSMEELQGLGSDYSALILQNLGSRPRQTLDALLPPDTPPEALDLLKRLLAFAPDKRLSAEQALQHPYVQRFHCPDREWTRGSDVRLPVHEGDQLSAPEYRNRLYQMILER------RRNSRSPREE 357          
BLAST of Mitogen-activated protein kinase vs. UniProt/SwissProt
Match: sp|Q80Y86|MK15_MOUSE (Mitogen-activated protein kinase 15 OS=Mus musculus OX=10090 GN=Mapk15 PE=1 SV=1)

HSP 1 Score: 401.749 bits (1031), Expect = 5.562e-132
Identity = 189/376 (50.27%), Postives = 256/376 (68.09%), Query Frame = 3
Query:   45 EVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDP---TLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQKKAEKEARTQARRPNEE 1163
            EV+ ++ +RY IK R+G GAYGIVWKA+D+++GE VA+KKIFDAF+++ DAQRTFREI  L++F GHPNII L++V  A NDRDIYLVFE MD+DL+ VI++G LLK +HK  I YQ+L+A K+IHSG VIHRD KP+NVLLDS C VKLCDFGL RS                 LGD    P    LTEYVATRWYRAPE+LL S  YT  VD+WS+GCIL E++ G+ LF G+S+ +Q+E I+  +P PS E+++ + S+Y   IL  +  +P +  + + P +    A DL+K LL F P KR + EQAL+H Y+++FH P+ E   + ++  P+++  QLS  EYR +LY +I ++         +R P EE
Sbjct:    5 EVDRHVAQRYLIKRRLGKGAYGIVWKAMDRRTGEVVAIKKIFDAFRDQIDAQRTFREIMLLKEFGGHPNIIRLLDVIPAKNDRDIYLVFESMDTDLNAVIQKGRLLKDIHKRCIFYQLLRATKFIHSGRVIHRDQKPANVLLDSACRVKLCDFGLARS-----------------LGDLPEGPGGQALTEYVATRWYRAPEVLLSSRWYTPGVDMWSLGCILGEMLRGQPLFPGTSTFHQLELILKTIPLPSMEELQDLGSDYSALILQNLGSRPQQTLDALLPPDTPPEALDLLKRLLAFAPDKRLSAEQALQHPYVQRFHCPDREWARESDVRLPVHEGDQLSAPEYRKRLYQIILEQSG------NSRSPREE 357          
BLAST of Mitogen-activated protein kinase vs. TrEMBL
Match: A0A1S3JU08 (Mitogen-activated protein kinase OS=Lingula unguis OX=7574 GN=LOC106176147 PE=4 SV=1)

HSP 1 Score: 542.732 bits (1397), Expect = 0.000e+0
Identity = 280/595 (47.06%), Postives = 387/595 (65.04%), Query Frame = 3
Query:   36 MTNEVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQKKAEK--------EARTQARR--PNEEIKSLRXXXXXXXXXXXENAMIM---EQKIASRANYDIAFGRTTHQRPPPPKNNHASNQSNNPLIGMKAFLTKTENTKIDNSRSRLSHSAFQRDDGNSRNETSFQKKSFGSDVEQKRPSRNVMTCSKEASNPVILRDLHSTSISATGNKVSMQSRPASAQHVRSNSATFGRKQFDNAKN---HSNMRSTLGSYSQTYGTVSSSQLNNLYS 1772
            M++E+E ++ K+Y++K R+G GAYGIVWKA+DK++GE VALKKIFDAF+N+TDAQRTFREI FLQ+F  HPNI+ L NV KA+ND+DIYLVFE MD+DLHNVIK+GN+LK +HK YI+YQ+LKA KY+HSGNVIHRD KPSNVLLD  C VK+CDFGL RSL Q+E              D  TDP LTEYVATRWYRAPEILL S +YTK VD+WS+GCIL E++LGK LF GSS+LNQIEKI+S++  PS+ D+ES+KS Y  SIL++   +P K   ++ P +  + A DL+K LL FNP KR T E+AL+H Y+++FH PE E+ +  ++VPP++D+ QLS++EYR+KLY+MI +KKAE+        E++ Q  +  P+E + S  +   ++  +      +     Q   ++    +AFGRTTH  PP        +Q    L   +++    EN           H   + D  N + E        GS     R +R        ++NP+I RD   T ++ + +++    RP+SA+  +    +FGRKQFDN +N   H + ++  GSY+Q +GT+S+  L+ L S
Sbjct:    1 MSSEIEPHVTKKYEVKKRLGKGAYGIVWKAVDKRTGEVVALKKIFDAFRNQTDAQRTFREIMFLQEFGDHPNIVKLHNVMKAENDKDIYLVFEFMDTDLHNVIKKGNILKDIHKRYIMYQLLKATKYMHSGNVIHRDQKPSNVLLDGECFVKVCDFGLARSLTQLEM-------------DEGTDPNLTEYVATRWYRAPEILLASHRYTKGVDMWSLGCILGELLLGKPLFPGSSTLNQIEKIMSSITPPSKSDIESLKSAYGASILDKAAIRPKKPMEDLLP-DAPKDAIDLLKKLLHFNPDKRLTAEEALKHPYVQRFHSPEDELDIGRDVVPPLSDDVQLSVEEYRNKLYEMIMEKKAERRTKRKEEEESKVQKEQVPPSEPLPSQANGYLSNGASPKVATPVTVRPAQPQTTQPAPVVAFGRTTHPNPP-------QSQVKKALPRQRSY----ENV----------HGGEKGDSPNVKKERQ------GSAPAAGRHARTTSAGMFRSNNPIITRD-DKTGLAISSSRIVPGQRPSSAKEGQRTKPSFGRKQFDNVRNNPSHGHTKAAFGSYTQNFGTISNKALSTLKS 553          
BLAST of Mitogen-activated protein kinase vs. TrEMBL
Match: A0A210PNM3 (Mitogen-activated protein kinase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT09106 PE=4 SV=1)

HSP 1 Score: 514.227 bits (1323), Expect = 1.214e-172
Identity = 276/599 (46.08%), Postives = 379/599 (63.27%), Query Frame = 3
Query:   36 MTNEVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQKKAEK--------------EARTQARRPNEEIKSLRXXXXXXXXXXXENAMIMEQKIASRANYD---IAFGRTTH--QRPPPPKNNHASNQSNNPLIGMKAFLTKTENTKIDNSRSRLSHSAFQRDDGNSRNETSFQKKSFGSDVEQKRPSRNVMTCSKEASNPVILRDLHSTSISATGNKVSMQSRPASAQHVRSNSATFGRKQFDNAKNHSNM---RSTLGSYSQTYGTVSSSQLNNL 1766
            M +E+E +I K+Y+IK R+G GAYGIVWKA+D+++GE VA+KKIFDAF+N+TDAQRTFREI FLQ+F  HPNII L NV KA+ND+DIYLVFE M++DLHNVIKRG++L+ VHK YI+YQ+LKA KY+HSGNVIHRD KPSNVLLDS+C VK+CDFGL RSL QI            G+     DP LTEYVATRWYRAPEILL S +YTK VD+WS+GCIL E++ GK LF GSS+LNQIEKI+  +P P+ ED+ES++S Y  S+L +   KP K F ++ P +V + A DL++ LL FNP KR T ++ L H Y+ +FH+P  E  +D+++VPP++D+ QL++DEYR+KLY+MI QKK E+                RT++  P  E     ++          N    +    S   +     AFGRTTH  Q PP PK+ +    +N             EN +   + + ++H  +     N R  ++      GS     RP    ++ +    NP I RD  S+ ++ T +++    RP+SA + +     +G+KQ+ NA N+ +    ++  GSY+Q  GT+SSS L +L
Sbjct:   33 MNSEIEPHISKKYEIKKRLGKGAYGIVWKAVDRRTGEVVAVKKIFDAFRNQTDAQRTFREIMFLQEFGDHPNIIKLHNVIKAENDKDIYLVFEFMETDLHNVIKRGSILRDVHKRYIMYQLLKATKYLHSGNVIHRDNKPSNVLLDSDCVVKVCDFGLARSLTQI------------GIDAETGDPNLTEYVATRWYRAPEILLASHRYTKGVDMWSLGCILGELLGGKPLFPGSSTLNQIEKIMGGIPVPTREDIESLQSAYGSSVLGKASVKPKKSFEDMLP-DVPKEALDLLRRLLHFNPDKRITADEGLRHPYVSRFHNPAEERSIDYDVVPPLSDDVQLTVDEYRNKLYEMIMQKKQERRRRRQEMRSAPHPMRVRTESPHPPSEPYHKDNSPKGASPKVYNNKHAGDGPPQSAPQHHSSFSAFGRTTHGDQVPPQPKSRNVRRPNN-------------ENMERAATNAGMAHDPYPAMSKN-RQASAPAASRMGS-----RP----ISGAYGVKNPTITRDEKSSGLAVTSSRMVPGQRPSSATNQQQRKPLYGKKQYSNAINNPSAGSHKAYFGSYNQNVGTISSSALASL 595          
BLAST of Mitogen-activated protein kinase vs. TrEMBL
Match: A0A433SZV9 (Mitogen-activated protein kinase OS=Elysia chlorotica OX=188477 GN=EGW08_017412 PE=3 SV=1)

HSP 1 Score: 504.212 bits (1297), Expect = 3.410e-169
Identity = 278/610 (45.57%), Postives = 373/610 (61.15%), Query Frame = 3
Query:   36 MTNEVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPG---KKFNEIFP-ANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQKKAEKEARTQARRPNEEIKS--LRXXXXXXXXXXXENAMIMEQKIASRANYDI---------------AFGRTT---HQRPPPPKNNHASNQSNNPLIGMKAFLTKTENTKIDNSRSRLSHSAFQRDDGNSRNETSFQKKSFGSDVEQKRPSRNVMTCSKEASNPVILRD---LHSTSISATGNKVSMQSRPASAQHVRSNSATFGRKQFDNAKNHSNM---RSTLGSYSQTYGTVSSSQLNNLYSR 1775
            M++E+E +I K+Y+IK R+G GAYGIVWKAID++SGE VA+KKIFDAF+N+TDAQRTFREI FLQ+F  HPN+I L NV KA+ND+DIYLVFE M++DLHNVIKRGN+LK VHK YI+YQ+ K+ KY+HSGNVIHRDLKPSN+LLDS C VKLCDFGL RSL QI               D   DP LTEYVATRWYRAPEILL S +YTK VD+WS+GCIL E++LGK LF GSS+LNQIE+I+ ++P PS  D++S+KS Y  S+L +     G   K F+EI P +  D V  DL+K LL FNP KR T ++AL H ++ +FH+P  EI ++ ++VPP++D+ QL++DEYRSKLY+MI QKKAE+  R +    +  ++     + D   +  + EN     ++ + +A +                 AFGR+    HQ+  P +    S Q                       RS  +    Q  +G+     S + +   +    +   R      +  SNP I R+    +   +    +++    RP SA + R+    +GRKQF NA N  +    ++  GSYSQ YGT+SSS L  L  R
Sbjct:    1 MSSEIEPHITKKYEIKKRLGKGAYGIVWKAIDRRSGEVVAVKKIFDAFRNQTDAQRTFREIMFLQEFGDHPNVIKLHNVIKAENDKDIYLVFEFMETDLHNVIKRGNILKDVHKRYIMYQLFKSTKYLHSGNVIHRDLKPSNILLDSECVVKLCDFGLARSLTQIAM-------------DEAGDPNLTEYVATRWYRAPEILLASHRYTKGVDMWSLGCILGEMLLGKPLFPGSSTLNQIERIMGSIPTPSRADVDSLKSSYGASVLEKAASAAGRHKKTFDEILPDSPADGV--DLMKKLLHFNPDKRITADEALRHPFVHRFHNPAGEISLNFDVVPPLSDDVQLTVDEYRSKLYEMIIQKKAERRRRRREEARSAALQQEDYVAGDIPSEPPAKENIHASPKRPSPKAAHKYGQIGDHPSHHHSSFSAFGRSATHDHQQAGPSRQKALSRQ-----------------------RSYENIQGSQAANGDPYPPLSQKGRQTSAPAAMRGQGRPASGVYRAQSNPTITREERAANGGGLMVASSRMVPGQRPTSATNPRAKP-VYGRKQFSNATNAPSSGAPKAVFGSYSQAYGTISSSSLAALQGR 571          
BLAST of Mitogen-activated protein kinase vs. TrEMBL
Match: A0A4S2MDY9 (Mitogen-activated protein kinase OS=Opisthorchis felineus OX=147828 GN=CRM22_000747 PE=3 SV=1)

HSP 1 Score: 503.442 bits (1295), Expect = 1.890e-168
Identity = 278/618 (44.98%), Postives = 390/618 (63.11%), Query Frame = 3
Query:   45 EVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTR--------SLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQKKAEKEARTQARRPNEEIKSLRXXXXXXXXXXXENAMIMEQKIASRANYDIAFGRTTHQRP-PPPKNNHASNQSNNPLIGMKAFLTKTENTKIDNSRSRLSHSAFQRDDGNSRNETSFQKKSFGSDVEQKRPSRN--------------------VMTCSKEASNPVILRDLHSTSISATGNKVSMQSRPASAQHVRSNSATFGRKQ--------FDNAKNHSNMRSTLGSYSQTYGTVSSSQLNNLYSRNCVR 1787
            EVE  I++ Y+I  R+G GAYGIVW+A +KK+G  VALKKIFDAF+N+ DAQRTFREI FLQ+F+GHPNII L+NV KA+NDRDIYLVFE M++DLHN IK+GN+LK +HK YI YQ+L+AVK+IHS NVIHRDLKPSNVLLDS+C VKLCDFGLTR        S    ES+   A+ ++DG      DP LTEYVATRWYRAPEILL S +YTK VD+WS+GCILAE+++GK +F G+S++NQIE+IVSA+PRP+ +D+ ++ S+Y  S+L + + KP    + +FP  V++ A ++ K+LLQ NP KR TVE+AL+H Y+++F D + E++MDH + PP+ND  QLS+ +YR+KLY++I +K+A+++ R +  R  +E +S + T++T + +   +    ++   +       +G + +  P  P + N  +NQ  +       +   TE TK   +R     S   +   +S+N  S + K   + V +  P RN                    + + S+E  NPVILR L   S   T  +     R   ++ + +N+   G  Q              ++   S LGSYSQTYGTVS SQL+ L SR   R
Sbjct:    5 EVEPTILRTYEINKRLGKGAYGIVWRAKNKKTGSTVALKKIFDAFRNQIDAQRTFREITFLQEFAGHPNIIRLLNVIKAENDRDIYLVFEFMETDLHNCIKKGNILKEIHKTYIFYQLLRAVKFIHSANVIHRDLKPSNVLLDSDCHVKLCDFGLTRSLSSPSTGSSFSAESV---ADADSDG-----GDPELTEYVATRWYRAPEILLASNRYTKFVDMWSLGCILAEMLIGKPIFPGTSTINQIERIVSAVPRPNRQDILALHSDYGMSVLEEALRKPSSTLDSLFPETVERNAVEMAKHLLQLNPSKRLTVEKALDHPYVQRFRDRQSELVMDHPVTPPLNDNQQLSVSDYRTKLYEVILEKRAQRKIR-RLLRSVQETESHQKTESTQEKSLKHSGPTSDEGTQTTPELSATYGSSKYVVPYRPAEMNGRANQRGHRERNETNYQNITE-TKASPARKHAHFSPTTQSPQSSKNPES-RTKGLKNGVHEV-PQRNRVGNREIDYVSSNAKSVQCPLRSYSREFDNPVILRSLSGLS---TNPRNLEGHRAIESRQLHANAKKDGVHQSLTPFTAVSPAGDAYTKGVSQLGSYSQTYGTVSRSQLSQLQSRQWTR 607          
BLAST of Mitogen-activated protein kinase vs. TrEMBL
Match: A0A4E0R941 (Mitogen-activated protein kinase OS=Fasciola hepatica OX=6192 GN=D915_005701 PE=3 SV=1)

HSP 1 Score: 498.049 bits (1281), Expect = 4.497e-166
Identity = 284/634 (44.79%), Postives = 381/634 (60.09%), Query Frame = 3
Query:   45 EVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDF---NTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQKKAEKEARTQARRPNEEIKSLRXXXXXXXXXXXENAMIMEQKIASRANYDIAFGRTTHQRPPPPKNNHASNQSNNPLIGMKAFLTKT-EN--------------TKIDNSRSRLSHSA----------------------------------FQRDDGNSRNETSFQKKSFGSDVEQKRPSRNVMTCSKEASNPVILRDLHSTSISATGNKVSMQSRPASAQHVRSNSATFGRKQFDNAKNHSNMRSTL-GSYSQTYGTVSSSQLNNLYSRNCVR 1787
            E+E+ I+K YDI  R+G GAYGIVW+A +KK+G  VALKKIFDAF+N+TDAQRTFREI FLQ F+GHPNII L+NV KADN++DIYLVFE MDSDLHN IK+GN+LK VHK+YI YQ+L+AVKYIHS +VIHRDLKPSNVLLDS+C VK+CDFGLTRSL    ++H       +   D      DP LTEYVATRWYRAPEILL S++YTK VD+WS+GCIL E++ GK +F GSS++NQIE+IVS + +P++ED+ S+ SEY RSIL +   KP      +F  +VD+ A DLVK LL  NP KR TVE+AL HAY++KF DP  E++MDH + PP++D+ QLS+ EY+ KLY++I +KKA++  +   R        L   +  ++ +S+EN  +      SR  YD    R+T  R P    N + +     LI  +  + +T EN                I     R+ H++                                    + +GN  ++T++  KS   +    R      + S+E  NPVILR      + +TGN+ +     A  +       +   +  D +  H  + S + GSY+QTYGTVS SQL  + SR   R
Sbjct:    5 EIENTILKHYDIVKRLGKGAYGIVWRAKNKKNGNTVALKKIFDAFRNQTDAQRTFREITFLQAFAGHPNIIRLLNVIKADNNKDIYLVFEHMDSDLHNCIKKGNILKDVHKKYIFYQLLRAVKYIHSADVIHRDLKPSNVLLDSDCLVKVCDFGLTRSL---AAIHGGFRGSVESFSDAAVNGGDPELTEYVATRWYRAPEILLASSRYTKFVDMWSLGCILGEMLSGKPIFPGSSTINQIERIVSVVDKPTDEDIASLHSEYGRSILAKAFQKPRSHIEALFRTDVDRNAIDLVKKLLVLNPSKRLTVEEALNHAYVKKFRDPSSEMVMDHVVTPPLSDDLQLSVAEYQQKLYEIILEKKAQRRIQRMLR-----TVKLDEENGLNELSSTENETLSR----SRTTYD---DRSTEGRFPDKSENRSRSPIREQLINRRGIINETNENGSMITDDFQTTWHPATIQTQNHRVPHASDVSPKISKHTSNTDNKMYRAENHHDSTMLKQLLPESKLNGNLTDKTAYSAKSRNFNRNPLRSPVKPQSYSRELDNPVILRS--QFRVGSTGNRRNRHQISAFPESKVPQRVSSMHRVGDVS--HKFIGSLVPGSYAQTYGTVSRSQLAQIQSRQWTR 619          
BLAST of Mitogen-activated protein kinase vs. Ensembl Cavefish
Match: mapk15 (mitogen-activated protein kinase 15 [Source:NCBI gene;Acc:103028638])

HSP 1 Score: 473.011 bits (1216), Expect = 8.666e-160
Identity = 212/375 (56.53%), Postives = 289/375 (77.07%), Query Frame = 3
Query:   45 EVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQKKAEK--EARTQARRPNEE 1163
            E+E +I  +Y+IK R+G GAYGIVWKA+D+K+GE VA+KKIFDAF+N TDAQRTFREI FLQ+F  H NII L+NV +A ND+DIYLVFE MD+DLH VIK+GNLLK +HK+YI+YQ+LKA KY+HSGNVIHRD KPSN+LLD++C +KLCDFGL RSL+Q++              +   +P LTEYVATRWYRAPEILLGST+YTK VD+WS+GCIL E++LG+ LF G+S++NQIEKI+ A+P P+ ED+ +I+SEY  S++ +++ +P     ++   +V   A DL+++LL FNP KR T EQAL+H Y+ KFH+P  E  +D++++ P++D+ QLS+ +YR+KLY+MI +K+A +  E R   ++  EE
Sbjct:    5 ELEEHITLKYEIKRRLGKGAYGIVWKAVDRKTGETVAVKKIFDAFRNRTDAQRTFREIMFLQEFGDHANIIKLLNVIRAQNDKDIYLVFEYMDTDLHAVIKKGNLLKDIHKQYIMYQLLKATKYLHSGNVIHRDQKPSNILLDADCFIKLCDFGLARSLYQMQ--------------EDVANPALTEYVATRWYRAPEILLGSTRYTKGVDMWSIGCILGEMLLGRPLFPGTSTINQIEKIMGAIPHPTAEDVFAIRSEYGASVIQRMLLRPQVPLGDLLQPSVPPDALDLLQHLLVFNPYKRLTAEQALQHPYVAKFHNPAREPSLDYDVILPVDDDVQLSVAQYRNKLYEMILEKRATRQIERRVHLKKQTEE 365          
BLAST of Mitogen-activated protein kinase vs. Ensembl Cavefish
Match: mapk3 (mitogen-activated protein kinase 1 [Source:NCBI gene;Acc:103041389])

HSP 1 Score: 266.929 bits (681), Expect = 6.859e-83
Identity = 154/362 (42.54%), Postives = 218/362 (60.22%), Query Frame = 3
Query:   69 RYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITL---INVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQKKAEKEARTQA 1145
            RY     IG GAYG+V  A D  +   VA+KKI   F+++T  QRT REI  L  F  H NII +   +  R+ D  RD+Y+V +LM++DL+ ++K   L  + H  Y +YQIL+ +KYIHS NV+HRDLKPSN+L+++ C +K+CDFGL R           A+ E D  G       LTEYVATRWYRAPEI+L S  YTKS+D+WSVGCILAE++  + +F G   L+Q+  I+  L  PS++D+  I +   R+ L  +  KP   +N++FP   D  A DL+  +L FNP KR TVE+AL H Y+E+++DP  E + +     P     +L  D  + KL ++I ++ A  +A  Q 
Sbjct:   55 RYTDLQYIGEGAYGMVCSAFDNVNKIRVAIKKI-SPFEHQTYCQRTLREIKILLRFR-HENIIGINDILRARRIDYMRDVYIVQDLMETDLYKLLKTQQL-SNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARI----------ADPEHDHTG------FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQDDLNCIINMKARNYLQSLPQKPKIPWNKLFP-KADNKALDLLDRMLTFNPIKRITVEEALAHPYLEQYYDPTDEPVAEE----PFTFNMELD-DLPKEKLKELIFEETARFQANYQG 391          
BLAST of Mitogen-activated protein kinase vs. Ensembl Cavefish
Match: mapk1 (mitogen-activated protein kinase 1 [Source:NCBI gene;Acc:103047585])

HSP 1 Score: 261.151 bits (666), Expect = 5.076e-81
Identity = 142/316 (44.94%), Postives = 202/316 (63.92%), Query Frame = 3
Query:   69 RYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKA---DNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDP 1007
            RY   + IG GAYG+V  A D+ +   VA+KKI   F+++T  QRT REI  L  F  H NII++ ++ +A   D  +D+Y+V +LM++DL+ ++K  +L  + H  Y +YQIL+ +KYIHS NV+HRDLKPSN+LL++ C +K+CDFGL R           A+ + D  G       LTEYVATRWYRAPEI+L S  YTKS+D+WSVGCILAE++  + +F G   L+Q+  I+  L  PS+ED+  I +   R+ L  +  +    +N +FP N D  A DL+  +L FNP KR  VE+AL H Y+E+++DP
Sbjct:   35 RYTNLSYIGEGAYGMVCSAYDRDNKVRVAIKKI-SPFEHQTYCQRTLREIKILLRFK-HENIISINDIIRAPSIDQMKDVYIVQDLMETDLYKLLKTQHL-SNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARV----------ADPDHDHTG------FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRCKVPWNRLFP-NADPKALDLLDKMLTFNPHKRIEVEEALAHPYLEQYYDP 330          
BLAST of Mitogen-activated protein kinase vs. Ensembl Cavefish
Match: mapk1 (mitogen-activated protein kinase 1 [Source:NCBI gene;Acc:103047585])

HSP 1 Score: 261.536 bits (667), Expect = 1.083e-80
Identity = 143/320 (44.69%), Postives = 204/320 (63.75%), Query Frame = 3
Query:   69 RYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKA---DNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEI 1019
            RY   + IG GAYG+V  A D+ +   VA+KKI   F+++T  QRT REI  L  F  H NII++ ++ +A   D  +D+Y+V +LM++DL+ ++K  +L  + H  Y +YQIL+ +KYIHS NV+HRDLKPSN+LL++ C +K+CDFGL R           A+ + D  G       LTEYVATRWYRAPEI+L S  YTKS+D+WSVGCILAE++  + +F G   L+Q+  I+  L  PS+ED+  I +   R+ L  +  +    +N +FP N D  A DL+  +L FNP KR  VE+AL H Y+E+++DP  E+
Sbjct:   35 RYTNLSYIGEGAYGMVCSAYDRDNKVRVAIKKI-SPFEHQTYCQRTLREIKILLRFK-HENIISINDIIRAPSIDQMKDVYIVQDLMETDLYKLLKTQHL-SNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARV----------ADPDHDHTG------FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRCKVPWNRLFP-NADPKALDLLDKMLTFNPHKRIEVEEALAHPYLEQYYDPTDEV 334          
BLAST of Mitogen-activated protein kinase vs. Ensembl Cavefish
Match: zgc:171775 (mitogen-activated protein kinase 12-like [Source:NCBI gene;Acc:103042110])

HSP 1 Score: 236.884 bits (603), Expect = 7.753e-72
Identity = 126/354 (35.59%), Postives = 203/354 (57.34%), Query Frame = 3
Query:   57 NIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADND----RDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPIND---ECQLSIDEYRSKLY 1097
            ++  RY   N IG GAYG V  AID+K+ E VA+KK++  F++   A+R +RE+  L+    H N+I L+NV   D+     +  YLV   +  DL +++K+  L + V   Y+ YQ+L+ +KYIHS  +IHRDLKP+N+ +D NC +K+ DFGL R                      + +  +T YV TRWYRAPE++     YT++VD+WS GCILAE++ G+ LF G+ S++Q+  I+     P+   ++ ++S+  RS +  +  +  K F ++FP  +D    D+++  L  +P  RFT +  L H Y+ +FHDPE E        PP +D     +L+++E++S ++
Sbjct:   20 DVPDRYTSLNSIGSGAYGTVCSAIDQKTKEKVAIKKLYRPFQSLIHAKRAYRELRLLRHIQ-HDNVICLLNVFTPDSSLETFQTFYLVMPFVAQDLGHIMKKRRLSERV-IVYLFYQLLRGLKYIHSAGIIHRDLKPNNLAVDENCELKILDFGLAR----------------------HAEMEMTGYVVTRWYRAPEVIFNWMHYTQTVDIWSAGCILAEMITGQVLFPGNDSMDQLNMILELTGTPNSSLVQKMQSKDARSYVQSLPVQKKKDFRKVFP-TMDPCTVDVLEKTLMLDPESRFTAKDGLSHPYLNEFHDPENE-----PESPPYDDSFESLELAVNEWKSLIH 343          
BLAST of Mitogen-activated protein kinase vs. Ensembl Sea Lamprey
Match: mapk15 (mitogen-activated protein kinase 15 [Source:ZFIN;Acc:ZDB-GENE-050522-307])

HSP 1 Score: 445.277 bits (1144), Expect = 2.101e-150
Identity = 257/606 (42.41%), Postives = 376/606 (62.05%), Query Frame = 3
Query:   36 MTNEVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQ-RTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQKKAE--KEARTQARRPNEEIKSLRXXXXXXXXXXXENAMIMEQKIASRANYDIAFGRTTHQRPPPPKN--------NHASNQSNNPLIGMKAFLTKTENTKIDNSRSRLSHSAFQRDDGNSR----NETSFQKKSFGS----DVEQKRPSRNVMTCSKE---------ASNPVILRDLH---STSISATGNKVSMQSRPASAQHVRSNSATFGRKQFDNAKN---HSNMRSTLGSYSQTYGTVSSS 1751
            M  +++S+I+ +YDIK R+G G  GIVWK +D+K+G+ VA+KKIFDAF+N+TDAQ RTFREI FLQ+F  HPNII L NV +ADND+DIYLVF+ MD+DLH VI++GN+LK VHK YI YQ+LKA KYIHSGNVIHRD KPSNVLLD  C VKLCDFGL RSL QI               D   DP LTEYVATRWYRAPEILL S +YTK VD+WSVGCI+ E++LGKA+F G+S+LNQIE+I+S +P+PS+ED+ +IKSEY  S+L + + +  +    + P N    A DL+K LL FNP KR T E+AL H Y+ +FH+P+ E+ +D+++V P++D+ +LS+ EYR+KLY++I ++K +  K  +   ++P                     A  + QK      + +AF     ++P   ++         H ++    P +G+   +    + K   S + ++H+A Q    + R    +E + +  + GS      +++R +++   C ++         A N +++R+        +S +G  ++ + + AS +  R+    F RK F+ AKN     + ++ +GSYSQ+YGT++ S
Sbjct:    2 MNTDIDSHILLKYDIKKRLGKGELGIVWKGVDRKNGDVVAIKKIFDAFRNQTDAQQRTFREIIFLQEFGDHPNIINLRNVLRADNDKDIYLVFDFMDTDLHAVIRKGNILKDVHKAYITYQLLKATKYIHSGNVIHRDQKPSNVLLDGECFVKLCDFGLARSLKQIR--------------DEPGDPALTEYVATRWYRAPEILLASPRYTKGVDMWSVGCIVGEMLLGKAIFPGTSTLNQIERIMSVIPQPSKEDVLAIKSEYGGSVLEK-MGRQRQSLESLLP-NAPPNALDLLKRLLVFNPEKRLTAEEALGHPYVAQFHNPQTELAVDYDVV-PVDDDTRLSVAEYRNKLYELILERKMDVRKHRKDDQKQP--------------------AASQVAQK-----QHHVAF-HDAQKQPAASQDAQKQHAAVGHQASSRGAPGLGVSCGVP-LASPKGKASVNPITHAADQERPSHWRRTRQSEPTGKSGTGGSVAPLAAKEEREAKSAPACREKSLAQQHRANAGNRMLMREEARELDLGMSVSGAPLNQRGQSAS-RDTRAAGTRFSRKVFEGAKNVGAAGDPKAAMGSYSQSYGTINQS 562          
BLAST of Mitogen-activated protein kinase vs. Ensembl Sea Lamprey
Match: mapk15 (mitogen-activated protein kinase 15 [Source:ZFIN;Acc:ZDB-GENE-050522-307])

HSP 1 Score: 427.557 bits (1098), Expect = 4.911e-144
Identity = 209/356 (58.71%), Postives = 271/356 (76.12%), Query Frame = 3
Query:   36 MTNEVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQ-RTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYD 1100
            M  +++S+I+ +YDIK R+G G  GIVWK +D+K+G+ VA+KKIFDAF+N+TDAQ RTFREI FLQ+F  HPNII L NV +ADND+DIYLVF+ MD+DLH VI++GN+LK VHK YI YQ+LKA KYIHSGNVIHRD KPSNVLLD  C VKLCDFGL RSL QI               D   DP LTEYVATRWYRAPEILL S +YTK VD+WSVGCI+ E++LGKA+F G+S+LNQIE+I+S +P+PS+ED+ +IKSEY  S+L + + +  +    + P N    A DL+K LL FNP KR T E+AL H Y+ +FH+P+ E+ +D+++V P++D+ +LS+ EYR+KLY+
Sbjct:    1 MNTDIDSHILLKYDIKKRLGKGELGIVWKGVDRKNGDVVAIKKIFDAFRNQTDAQQRTFREIIFLQEFGDHPNIINLRNVLRADNDKDIYLVFDFMDTDLHAVIRKGNILKDVHKAYITYQLLKATKYIHSGNVIHRDQKPSNVLLDGECFVKLCDFGLARSLKQIR--------------DEPGDPALTEYVATRWYRAPEILLASPRYTKGVDMWSVGCIVGEMLLGKAIFPGTSTLNQIERIMSVIPQPSKEDVLAIKSEYGGSVLEK-MGRQRQSLESLLP-NAPPNALDLLKRLLVFNPEKRLTAEEALGHPYVAQFHNPQTELAVDYDVV-PVDDDTRLSVAEYRNKLYE 339          
BLAST of Mitogen-activated protein kinase vs. Ensembl Sea Lamprey
Match: mapk1 (mitogen-activated protein kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030722-2])

HSP 1 Score: 266.929 bits (681), Expect = 6.870e-84
Identity = 152/354 (42.94%), Postives = 217/354 (61.30%), Query Frame = 3
Query:   69 RYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKA---DNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQKKA 1121
            RY   + IG GAYG+V  A D      VA+KKI   F+++T  QRT REI  L  F  H NII + ++ +A   D  +D+Y+V +LM++DL+ ++K G  L + H  Y +YQIL+ +KYIHS NV+HRDLKPSN+LL++ C +K+CDFGL R           A+ + D  G       LTEYVATRWYRAPEI+L S  YTKS+D+WSVGCILAE++  + LF G   L+Q+  I+  L  PS+ED++ I +   R+ L  +  K    +N +FP   D  A DL+  +L FNP +R TVE+AL H Y+E+++DP  E + +     P   + +L  D  + +L +MI ++ A
Sbjct:   35 RYTSLSYIGEGAYGMVCAAFDNVKLVRVAIKKI-SPFEHQTYCQRTLREIKILLRFK-HENIIGINDILRASTIDQMKDVYIVQDLMETDLYKLLK-GQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARV----------ADPDHDHTG------FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPLFPGKHYLDQLNHILGILGSPSQEDLDCIINMKARNYLQSLPPKAKVPWNRLFP-KADSKALDLLDKMLTFNPHRRITVEEALAHPYLEQYYDPSDEPVAEE----PFRFDMELD-DLPKERLKEMIFEETA 363          
BLAST of Mitogen-activated protein kinase vs. Ensembl Sea Lamprey
Match: mapk14a (mitogen-activated protein kinase 14a [Source:NCBI gene;Acc:65237])

HSP 1 Score: 224.942 bits (572), Expect = 5.369e-68
Identity = 119/333 (35.74%), Postives = 195/333 (58.56%), Query Frame = 3
Query:   42 NEVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDR----DIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGS----SSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELE 1016
            N+    + +RY     +G GAYG V  ++D K+G  VA+KK+   F++   A+RT+RE+  L+    H N+I L++V   ++      D+YLV +LM +DL+N++K   L    H ++++YQIL+ +KYIHS  +IHRDLKPSN+ ++ +C +K+ DFGL R                      + D  +T YVATRWYRAPEI+L    Y ++VD+WSVGCI+AE++ G+ LF G+    S +NQ+ KI+     P +  ++ ++S+  R+ +  + Y   + F ++F    + +  DL++ +L  +  +R T  +AL H Y  ++HDP+ E
Sbjct:   15 NKTVWEVPRRYVNLTSVGSGAYGSVCSSLDTKTGMKVAVKKLSRPFQSVIHAKRTYRELRLLKHMK-HENVIGLMDVFTPNSSLEEFDDLYLVTDLMGADLNNIVKCQKLTDD-HVQFLVYQILRGLKYIHSAGIIHRDLKPSNLAVNEDCELKILDFGLAR----------------------HADDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDRILSDINQLVKILQLTGTPPQYLIDRMQSKEARNYIQSLPYTQKRDFKDVF-LGANPLVVDLLERMLVLDTDQRITAAEALVHQYFAQYHDPDDE 322          
BLAST of Mitogen-activated protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000729.1 (pep scaffold:Pmarinus_7.0:GL477416:20288:37329:-1 gene:ENSPMAG00000000656.1 transcript:ENSPMAT00000000729.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 218.779 bits (556), Expect = 5.088e-65
Identity = 135/366 (36.89%), Postives = 202/366 (55.19%), Query Frame = 3
Query:   60 IIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINV----RKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQV-----------AFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDP-ELEI----IMDHEIVPPINDECQLSIDEYRSKLY 1097
            ++KRY     IG GA GIV  A D     NVA+KK+   F+N+T A+R +RE+  ++  + H NII L NV    +  +  +D+YLV ELMD++L  VI+    L      Y+IYQ+L  +K++HS  +IHRDLKPSN+++ S+CT+K+ DFGL R+                          +T YV TR+YRAPE++LG   YT++VD+WSVGC+L E++  + LF G   ++Q  KI+  L  P  E M+ ++      + N+  Y  G  F ++FP  +              A DL+  +L  +P KR  V+QAL H YI  ++DP E+E     I D ++     DE + SIDE++  +Y
Sbjct:   22 VLKRYQNLKPIGSGAQGIVCAAYDIMQNRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVN-HKNIICLFNVFTPQKSLEEFQDVYLVMELMDANLCQVIQME--LDHERMSYLIYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTA--------------------GNSFMMTPYVVTRYYRAPEVILG-MGYTENVDIWSVGCVLGEMIRHRILFPGKDYIDQWNKIIEQLGTPMAEFMKKLQPTVRNYVENRPKYA-GYSFEKLFPDVLFPADSENNRLKASQARDLLSKMLVIDPAKRINVDQALAHPYINIWYDPSEVEAPPPKIYDKQL-----DEREHSIDEWKELIY 357          
BLAST of Mitogen-activated protein kinase vs. Ensembl Yeast
Match: FUS3 (Mitogen-activated serine/threonine protein kinase involved in mating; phosphoactivated by Ste7p; substrates include Ste12p, Far1p, Bni1p, Sst2p; inhibits invasive growth during mating by phosphorylating Tec1p, promoting its; inhibits recruitment of Ste5p, Cdc42p-mediated asymmetry and mating morphogenesis [Source:SGD;Acc:S000000112])

HSP 1 Score: 259.61 bits (662), Expect = 1.565e-81
Identity = 140/341 (41.06%), Postives = 207/341 (60.70%), Query Frame = 3
Query:   36 MTNEVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKAD---NDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRP-SEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPP 1046
            M   +  NI   + +K+ +G GAYG+V  A  K +GE VA+KKI + F     A RT REI  L+ F  H NIIT+ N+++ D   N  ++Y++ ELM +DLH VI    +L   H +Y IYQ L+AVK +H  NVIHRDLKPSN+L++SNC +K+CDFGL R + +  + + +   +  G         +TEYVATRWYRAPE++L S KY++++D+WS GCILAE+ L + +F G    +Q+  I   +  P S+ D+  I+S   R  +  +   P     ++FP  V+    DL++ +L F+P KR T ++ALEH Y++ +HDP  E   + E +PP
Sbjct:    1 MPKRIVYNISSDFQLKSLLGEGAYGVVCSATHKPTGEIVAIKKI-EPFDKPLFALRTLREIKILKHFK-HENIITIFNIQRPDSFENFNEVYIIQELMQTDLHRVIS-TQMLSDDHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLINSNCDLKVCDFGLARIIDESAADNSEPTGQQSG---------MTEYVATRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIGTPHSDNDLRCIESPRAREYIKSLPMYPAAPLEKMFP-RVNPKGIDLLQRMLVFDPAKRITAKEALEHPYLQTYHDPNDE--PEGEPIPP 326          
BLAST of Mitogen-activated protein kinase vs. Ensembl Yeast
Match: SLT2 (Serine/threonine MAP kinase; coordinates expression of all 19S regulatory particle assembly-chaperones (RACs) to control proteasome abundance; involved in regulating maintenance of cell wall integrity, cell cycle progression, nuclear mRNA retention in heat shock, septum assembly; required for mitophagy, pexophagy; affects recruitment of mitochondria to phagophore assembly site; plays role in adaptive response of cells to cold; regulated by the PKC1-mediated signaling pathway [Source:SGD;Acc:S000001072])

HSP 1 Score: 258.84 bits (660), Expect = 1.377e-79
Identity = 136/332 (40.96%), Postives = 201/332 (60.54%), Query Frame = 3
Query:   30 FKMTNEVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGEN--VALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLIN---VRKADND-RDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDP 1007
            FK+ N+ + ++ KR+ +   IG GAYGIV  A   ++ E+  VA+KK+ + F      +R+ RE+  L+ F GH NI  L +   V   D     +YL  ELM+ D+H +IK G  L   H +   YQIL  +KYIHS +V+HRDLKP N+L++++C +K+CDFGL R      S +P  N +            LTEYVATRWYRAPEI+L    YTK++D+WS GCILAE + GK +F G   +NQ+ +I+  L  P +E +  I S+  +  ++Q+ + P   F  ++P N +  A DL++ +L F+P+KR TV++ALEH Y+  +HDP
Sbjct:   10 FKVFNQ-DFSVDKRFQLIKEIGHGAYGIVCSARFAEAAEDTTVAIKKVTNVFSKTLLCKRSLRELKLLRHFRGHKNITCLYDMDIVFYPDGSINGLYLYEELMECDMHQIIKSGQPLTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGY----SENPVENSQF-----------LTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGKPIFKGKDYVNQLNQILQVLGTPPDETLRRIGSKNVQDYIHQLGFIPKVPFVNLYP-NANSQALDLLEQMLAFDPQKRITVDEALEHPYLSIWHDP 324          
BLAST of Mitogen-activated protein kinase vs. Ensembl Yeast
Match: KSS1 (Mitogen-activated protein kinase (MAPK); involved in signal transduction pathways that control filamentous growth and pheromone response; regulates septum assembly, and may directly phosphorylate Bni4p; the KSS1 gene is nonfunctional in S288C strains and functional in W303 strains [Source:SGD;Acc:S000003272])

HSP 1 Score: 249.21 bits (635), Expect = 2.588e-77
Identity = 144/347 (41.50%), Postives = 200/347 (57.64%), Query Frame = 3
Query:   36 MTNEVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLIN-VRKADNDR--DIYLVFELMDSDLHNVIKRGN----LLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFP-ANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPIN 1052
            M   +  +I  +Y + + IG GAYG V  AI K SG  VA+KKI   F  +    RT REI  L+ F  H NII++++ VR    D+   +YLV ELM++DL  VI   N     L   H +Y  YQIL+A+K IHS  VIHRD+KPSN+LL+SNC +K+CDFGL R L         ++   + L  F     +TEYVATRWYRAPEI+L   +YT ++D+WS GCILAE++ GK LF G    +Q+  I+  L  PS ED   IKS+  +  +  +  +P   +  ++   +++    DL+  +LQFNP KR +  +AL H Y+  +HDP      D    PP+N
Sbjct:    1 MARTITFDIPSQYKLVDLIGEGAYGTVCSAIHKPSGIKVAIKKI-QPFSKKLFVTRTIREIKLLRYFHEHENIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGFSTLSDDHVQYFTYQILRALKSIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLAS-------SSDSRETLVGF-----MTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILEVLGTPSFEDFNQIKSKRAKEYIANLPMRPPLPWETVWSKTDLNPDMIDLLDKMLQFNPDKRISAAEALRHPYLAMYHDPS-----DEPEYPPLN 329          
BLAST of Mitogen-activated protein kinase vs. Ensembl Yeast
Match: HOG1 (Mitogen-activated protein kinase involved in osmoregulation; controls global reallocation of RNAPII during osmotic shock; mediates recruitment/activation of RNAPII at Hot1p-dependent promoters; binds calmodulin; stimulates antisense transcription to activate CDC28; defines novel S-phase checkpoint with Mrc1p that prevent replication/transcription conflicts; nuclear form represses pseudohyphal growth; autophosphorylates; protein abundance increases under DNA replication stress [Source:SGD;Acc:S000004103])

HSP 1 Score: 234.187 bits (596), Expect = 6.955e-71
Identity = 133/349 (38.11%), Postives = 194/349 (55.59%), Query Frame = 3
Query:   60 IIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMI 1106
            I  RY+  N +G+GA+G+V  A D  + + VA+KKI   F     A+RT+RE+  L+    H N+I L ++  +  + DIY V EL  +DLH +++   L K    +Y +YQIL+ +KY+HS  VIHRDLKPSN+L++ NC +K+CDFGL R                        DP +T YV+TR+YRAPEI+L   KY   VD+WS GCI AE++ GK LF G   ++Q   I   L  P ++ + +I SE     +  + ++    F+E F   V+  A DL++ +L F+P+KR T   AL H Y   +HDP  E + D +     ND   L +D +R  +Y  I
Sbjct:   19 ITNRYNDLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTAVLAKRTYRELKLLKHLR-HENLICLQDIFLSPLE-DIYFVTELQGTDLHRLLQTRPLEKQF-VQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLARI----------------------QDPQMTGYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVINTICSENTLKFVTSLPHRDPIPFSERF-KTVEPDAVDLLEKMLVFDPKKRITAADALAHPYSAPYHDPTDEPVADAKFDWHFND-ADLPVDTWRVMMYSEI 340          
BLAST of Mitogen-activated protein kinase vs. Ensembl Yeast
Match: KDX1 (Protein kinase; implicated in Slt2p mitogen-activated (MAP) kinase signaling pathway; interacts with numerous components in the mating pheromone and CWI MAPK pathways; associates with Rlm1p; KDX1 has a paralog, SLT2, that arose from the whole genome duplication [Source:SGD;Acc:S000001644])

HSP 1 Score: 226.483 bits (576), Expect = 4.852e-68
Identity = 121/319 (37.93%), Postives = 187/319 (58.62%), Query Frame = 3
Query:   66 KRYDIKNRIGVGAYGIVWKAIDKKSGE--NVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITL----INVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHD 1004
            K + +  +IG G++ ++  +   +S E  +VA++KI +AF N+   +RT RE+  L+   GHPNI+ L    I          +YL  ELM+ DL  +I+    L+  H +  IYQIL A+KYIHS NV+H DLKP N+L++S+C +K+C+FGL+ S       + + +K  DG         +  Y+ + WY+APEILL   + TK+VD+WS GCILAE++  K +F G   ++ +  I+  L  P EE ++ I S+   + + Q    PG+ F  I P   +  A +L+K +L+F+P+KR TVE ALEH Y+  +HD
Sbjct:   21 KHFHLTGKIGRGSHSLICSSTYTESNEETHVAIRKIPNAFGNKLSCKRTLRELKLLRHLRGHPNIVWLFDTDIVFYPNGALNGVYLYEELMECDLSQIIRSEQRLEDAHFQSFIYQILCALKYIHSANVLHCDLKPKNLLVNSDCQLKICNFGLSCS-------YSENHKVNDGF--------IKGYITSIWYKAPEILLNYQECTKAVDIWSTGCILAELLGRKPMFEGKDYVDHLNHILQILGTPPEETLQEIASQKVYNYIFQFGNIPGRSFESILPG-ANPEALELLKKMLEFDPKKRITVEDALEHPYLSMWHD 323          
BLAST of Mitogen-activated protein kinase vs. Ensembl Nematostella
Match: EDO39421 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA30])

HSP 1 Score: 410.609 bits (1054), Expect = 2.924e-140
Identity = 197/331 (59.52%), Postives = 254/331 (76.74%), Query Frame = 3
Query:   36 MTNEVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRW-YRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIF---PANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELE 1016
            M+ +++S+I K+Y+IK R+G GAYGIVWKAID+++GE VA+KKIFDAF+N+TDAQRTFREI FLQ+F  H N++ L+NV KADND+DIYLVFE MD+DLHNVIKRGN+LK +HK YI+YQ+LKA K+IHSGNVIHRDLKPSN+LLDS C  K+CDFGL RS+  I          T   G    DP+LT+YVATR   RAPEILL S +YTK VD+WS+GCIL E++LGK LF GSS+LNQIEKI++++  PS +D++SIKS Y  S+L+++  KP +   ++    P++    A DL+  LLQFNP KR T E+AL H Y+ +FH+PE E
Sbjct:    1 MSADIDSHITKKYEIKKRLGKGAYGIVWKAIDRRTGEVVAVKKIFDAFRNQTDAQRTFREICFLQEFGDHENVVKLMNVIKADNDKDIYLVFEYMDTDLHNVIKRGNILKDIHKRYIMYQLLKATKFIHSGNVIHRDLKPSNLLLDSECFAKICDFGLARSVSNI----------TQEAG----DPSLTDYVATRGILRAPEILLASPRYTKGVDMWSIGCILGELLLGKPLFPGSSTLNQIEKIMTSIAPPSRQDVDSIKSHYSTSVLDRMACKPKRSLADVLNTAPSD----AIDLLNKLLQFNPDKRLTAEEALSHPYVARFHNPEEE 313          
BLAST of Mitogen-activated protein kinase vs. Ensembl Nematostella
Match: EDO37435 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFQ0])

HSP 1 Score: 281.567 bits (719), Expect = 1.256e-89
Identity = 147/320 (45.94%), Postives = 210/320 (65.62%), Query Frame = 3
Query:   57 NIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINV---RKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDP 1007
            ++  RY   N IG GAYG+V   +D  +GE +A+KKI   F+++T  QRT REI  L  F  H NII ++++    +A++ +DIY+V  LM++D++ ++K   L  + H  Y +YQIL+ +KYIHS NV+HRDLKPSN+LL++ C +K+CDFGL R           A+ + D  G       LTEYVATRWYRAPEI+L S  Y+K++D+WSVGCILAE++  + LF G   L+Q+  I++ L  P  +D+  IK+E  RS L  + YKP   F ++F +N D  A DL++NLL FNP KR TVE+AL H Y+E+++DP
Sbjct:   16 DVAPRYTNLNYIGEGAYGMVVAGVDNTTGERIAIKKI-SPFEHQTYCQRTLREIKILSRFK-HENIIGILDIIRAPRAEDMKDIYIVQPLMETDMYKLLKTQRL-SNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARI----------ADPDHDHTG------FLTEYVATRWYRAPEIMLNSKGYSKAIDIWSVGCILAEMLANRPLFPGKHYLDQLNLILNVLGSPIADDLLCIKNEKARSYLQSLPYKPKTPFIKLF-SNADAKALDLIENLLAFNPNKRITVEEALAHPYLEQYYDP 315          
BLAST of Mitogen-activated protein kinase vs. Ensembl Nematostella
Match: EDO40573 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6R5])

HSP 1 Score: 254.218 bits (648), Expect = 1.354e-78
Identity = 134/329 (40.73%), Postives = 204/329 (62.01%), Query Frame = 3
Query:   42 NEVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKA----DNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELE 1016
             E++  +  RY +   IG GAYG+V  A+D ++G  VA+KKI  AF   T A+RT RE+  L+ F  H NII + ++ K     D   D+Y+V +LM+SDLH +I     L + H  Y +YQIL+ +KYIHS  V+HRDLKPSN+L++ N  +K+ DFG+ R L       P   K             +TEYVATRWYRAPE++L   +Y++++D+WSVGCILAE++  + LF G++ LNQ++ I+S    PS+  +E + +E  ++ LNQ+ +K    F + FP    + A +L+  +LQ +P++R TVE AL+H +++++H  E E
Sbjct:   13 TEIKFVVDARYKLIETIGNGAYGVVCSAMDTRTGAKVAVKKISRAFDVLTTARRTHRELKILRHFK-HDNIICIRDILKPPVNLDEFDDVYVVLDLMESDLHRIIHTDQPLTTEHVRYFLYQILRGLKYIHSAKVLHRDLKPSNLLVNENAELKIGDFGMARGLCS----SPLEQKRF-----------MTEYVATRWYRAPELMLSLNEYSEAIDMWSVGCILAEMIGRRPLFPGANYLNQLQMILSVTGTPSQNFIERMGAERVKTYLNQLPHKDPVPFEKFFPKAHPE-AINLLSQMLQLDPKERITVENALQHPFLKEYHSEEDE 324          
BLAST of Mitogen-activated protein kinase vs. Ensembl Nematostella
Match: EDO46881 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNM4])

HSP 1 Score: 221.09 bits (562), Expect = 3.533e-66
Identity = 131/363 (36.09%), Postives = 203/363 (55.92%), Query Frame = 3
Query:   60 IIKRYDIKNRIGVGAYGIVWKAI------DKKSGEN-VALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKA----DNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPIN---DECQLSIDEYRSKLYDMI 1106
            + ++Y   + IG GAYG V  +           G N VA+KK+   F++   A+RT+RE+  L+    H N+I+L++V       ++ +D+Y+V ELM SDL N I R   L   H ++++YQIL+ +KYIHS  VIHRDLKPSN+ ++ +C +K+ DFGL R                       TD  +T YVATRWYRAPEI+L    Y ++VD+WSVGCI+AE++  K LF G+  ++Q+ KI+  + +PS++ ++ I SE  R+ + Q+       F+E F    + +A DL++ +L  +   R T  +AL H Y+  + DP      D       +   DE +LSI+ +R+ +Y  I
Sbjct:   20 VPRKYQELSPIGTGAYGQVCSSTITEPDPTNPDGPNTVAIKKLSRPFQSTMHAKRTYRELKLLRHMR-HENVISLLDVFTTASAFEHFQDVYMVTELMGSDL-NGILRFQKLSDEHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELKILDFGLARM----------------------TDAEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTSKTLFPGNDHIDQLTKIMQLVGKPSDDFLQKIDSESARNYIAQMPDYRKTPFDEYF-VGANPLAVDLLEKMLNLDTDHRITAVEALSHPYLASYADPN-----DEPTCSTFDDSFDEKELSIEGWRALVYQEI 352          
BLAST of Mitogen-activated protein kinase vs. Ensembl Nematostella
Match: EDO30527 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0K0])

HSP 1 Score: 209.534 bits (532), Expect = 2.954e-61
Identity = 118/313 (37.70%), Postives = 179/313 (57.19%), Query Frame = 3
Query:   90 IGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKA---DNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDM-ESIKSEYCRSILNQIIYKPGKKFNEIFPAN-VDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIE----KFH 1001
            IG GA+G+VW   D ++G+ VALKK+   F+N T ++R +RE+  L     H N+I+ I++      D   +IY+V ELM SDLH +I     L + H +  +YQIL+ +KY+ S  ++HRD+KP N+L++SNC +K+CDFGL R     ES+                   +T+ V T++YR+PE+L GST YT++VD+WSVGCI AE++  K LF   S + Q+ +I+  L  P  ED+ ++  SE     + Q  +KP    +    +N     A  L+  +L FNP KR +   AL H Y++    +FH
Sbjct:   45 IGYGAFGVVWSVTDPRNGKRVALKKMPKVFQNITSSRRAYRELRMLCTLK-HDNVISAIDIVHPGHIDLFHEIYVVSELMQSDLHKIIVSPQPLTADHVKVFLYQILRGLKYLDSAKILHRDIKPGNLLVNSNCLLKICDFGLARLEEPDESV------------------IMTQEVVTQYYRSPELLTGSTHYTQAVDIWSVGCIFAELLSRKILFQAQSPVQQLNQIIDLLGTPCLEDLSKAGSSEGATKYILQRPHKPPALASLYNLSNQATHEAVHLLCRMLVFNPNKRISCIDALSHPYLDEGRLRFH 338          
BLAST of Mitogen-activated protein kinase vs. Ensembl Medaka
Match: mapk15 (mitogen-activated protein kinase 15 [Source:NCBI gene;Acc:101164415])

HSP 1 Score: 466.463 bits (1199), Expect = 2.133e-157
Identity = 211/362 (58.29%), Postives = 287/362 (79.28%), Query Frame = 3
Query:   39 TNEVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQKKAE 1124
             +E+E +I  +YDIK R+G GAYGIVWK +D+K+GE VA+KKIFDAF+N TDAQRTFREI FLQ+F  HPNI+ LINV +A+ND+DIYL+FE MD+DLH VIK+G+LLK +HK Y++YQ+ KA+KY+HSGNVIHRD KPSNVLLD++C VKLCDFGL RSL+Q++              + + +P LTEYVATRWYRAPEILLGST+YTK VD+WS+GC+L E++LGKALF G+S++NQIEKI+SA+P PS +DM +IKSEY  S++ +++ KP     ++ P +V   A +LVK+LL FNP KR T EQAL+H Y+ +FH+P  E  +++++V P++D+ QLS+ +YR+KLY+M+ + K++
Sbjct:   10 VSEMEEHIFHKYDIKKRLGKGAYGIVWKGVDRKTGETVAVKKIFDAFRNSTDAQRTFREIMFLQEFGDHPNIVKLINVLRAENDKDIYLIFEYMDTDLHTVIKKGSLLKDIHKRYVMYQLFKAIKYLHSGNVIHRDQKPSNVLLDTDCVVKLCDFGLARSLNQVQ--------------EDSVNPALTEYVATRWYRAPEILLGSTRYTKGVDMWSLGCVLGEMLLGKALFPGTSTINQIEKIMSAIPHPSPDDMFAIKSEYGSSVIQRMLLKPQVPLEDLLPPSVPHDALNLVKSLLVFNPEKRLTAEQALQHPYVARFHNPAKEPSLNYDVVLPVDDDVQLSVVQYRNKLYEMMLEWKSK 357          
BLAST of Mitogen-activated protein kinase vs. Ensembl Medaka
Match: mapk15 (mitogen-activated protein kinase 15 [Source:NCBI gene;Acc:101164415])

HSP 1 Score: 466.463 bits (1199), Expect = 2.133e-157
Identity = 211/362 (58.29%), Postives = 287/362 (79.28%), Query Frame = 3
Query:   39 TNEVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQKKAE 1124
             +E+E +I  +YDIK R+G GAYGIVWK +D+K+GE VA+KKIFDAF+N TDAQRTFREI FLQ+F  HPNI+ LINV +A+ND+DIYL+FE MD+DLH VIK+G+LLK +HK Y++YQ+ KA+KY+HSGNVIHRD KPSNVLLD++C VKLCDFGL RSL+Q++              + + +P LTEYVATRWYRAPEILLGST+YTK VD+WS+GC+L E++LGKALF G+S++NQIEKI+SA+P PS +DM +IKSEY  S++ +++ KP     ++ P +V   A +LVK+LL FNP KR T EQAL+H Y+ +FH+P  E  +++++V P++D+ QLS+ +YR+KLY+M+ + K++
Sbjct:   10 VSEMEEHIFHKYDIKKRLGKGAYGIVWKGVDRKTGETVAVKKIFDAFRNSTDAQRTFREIMFLQEFGDHPNIVKLINVLRAENDKDIYLIFEYMDTDLHTVIKKGSLLKDIHKRYVMYQLFKAIKYLHSGNVIHRDQKPSNVLLDTDCVVKLCDFGLARSLNQVQ--------------EDSVNPALTEYVATRWYRAPEILLGSTRYTKGVDMWSLGCVLGEMLLGKALFPGTSTINQIEKIMSAIPHPSPDDMFAIKSEYGSSVIQRMLLKPQVPLEDLLPPSVPHDALNLVKSLLVFNPEKRLTAEQALQHPYVARFHNPAKEPSLNYDVVLPVDDDVQLSVVQYRNKLYEMMLEWKSK 357          
BLAST of Mitogen-activated protein kinase vs. Ensembl Medaka
Match: mapk3 (mitogen-activated protein kinase 1 [Source:NCBI gene;Acc:101159747])

HSP 1 Score: 265.774 bits (678), Expect = 1.801e-82
Identity = 144/316 (45.57%), Postives = 199/316 (62.97%), Query Frame = 3
Query:   69 RYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITL---INVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDP 1007
            RY   + IG GAYG+V  A+D  + + VA+KKI   F+++T  QRT REI  L  F+ H NII +   +  R  DN RD+Y+V  LM++DL+ ++K    L + H  Y +YQIL+ +KYIHS NV+HRDLKPSN+L+++ C +K+CDFGL R           A+ E D  G       LTEYVATRWYRAPEI+L S  Y+KS+D+WSVGCILAE++  K +F G   L+Q+  I+  L  PS+ED+ SI +   R+ L  +  KP     ++F    D  A DL+  +L FNP KR +VE AL H Y+E+++DP
Sbjct:   52 RYTNLSYIGEGAYGMVCSALDNLTNQRVAIKKI-SPFEHQTYCQRTLREIKILLRFN-HENIIGINDILRARHIDNMRDVYIVQTLMETDLYKLLK-SQRLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARI----------ADPEHDHTG------FLTEYVATRWYRAPEIMLNSKGYSKSIDIWSVGCILAEMLSNKPIFPGKHYLDQLNHILGVLGSPSQEDLNSIINVKARNYLQSLPEKPKVPLEKLF-VKADPKALDLLGRMLTFNPVKRISVEDALAHPYLEQYYDP 347          
BLAST of Mitogen-activated protein kinase vs. Ensembl Medaka
Match: mapk1 (mitogen-activated protein kinase 1 [Source:NCBI gene;Acc:101162905])

HSP 1 Score: 259.61 bits (662), Expect = 1.865e-80
Identity = 142/316 (44.94%), Postives = 201/316 (63.61%), Query Frame = 3
Query:   69 RYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKA---DNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDP 1007
            RY   + IG GAYG+V  A D+ +   VA+KKI   F+++T  QRT REI  L  F  H NII + ++ +A   +  +D+Y+V +LM++DL+ ++K  +L  + H  Y +YQIL+ +KYIHS NV+HRDLKPSN+LL++ C +K+CDFGL R           A+ + D  G       LTEYVATRWYRAPEI+L S  YTKS+D+WSVGCILAE++  + +F G   L+Q+  I+  L  PS+ED+  I +   R+ L  +  +    +N +FP N D  A DL+  +L FNP KR  VEQAL H Y+E+++DP
Sbjct:   33 RYSNLSYIGEGAYGMVCSAYDRDNKIRVAIKKI-SPFEHQTYCQRTLREIKILLRFK-HENIIGINDIIRAPSIEQMKDVYIVQDLMETDLYKLLKTQHL-SNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARV----------ADPDHDHTG------FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRCKVPWNRLFP-NADPKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDP 328          
BLAST of Mitogen-activated protein kinase vs. Ensembl Medaka
Match: mapk7 (mitogen-activated protein kinase 7 [Source:NCBI gene;Acc:101157651])

HSP 1 Score: 271.552 bits (693), Expect = 9.134e-79
Identity = 135/330 (40.91%), Postives = 208/330 (63.03%), Query Frame = 3
Query:   45 EVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADND----RDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEII 1022
            +V+ ++ + YDI   IG GAYG+V  A  + +G+ VA+KKI +AF+  T+A+RT RE+  L+ F  H NII + ++ + +      + +Y+V +LM+SDLH +I     L   H  Y +YQ+L+ +KY+HS NVIHRDLKPSN+L++ NC +K+ DFG+ R L    S HP+ +              +TEYVATRWYRAPE+LL    Y+ ++DLWSVGCI AE++  K LF G   ++Q++ I+S L  P E  + +I++E  RS +  +  +     ++++P   +  A DL+  +L+F+PR+R  V +ALEH Y+ K+HDP+ E I
Sbjct:   56 DVKFDVGEEYDIIETIGTGAYGVVSSARRRDNGQQVAIKKISNAFEVVTNAKRTLRELKILKHFK-HDNIIAIKDILQPNLPHSAFKSVYVVLDLMESDLHQIIHSTQTLTPEHTRYFLYQLLRGLKYVHSANVIHRDLKPSNLLVNENCELKIGDFGMARGL----SSHPEESYS-----------FMTEYVATRWYRAPELLLSLNHYSLAIDLWSVGCIFAEMLGRKQLFPGKHYVHQLQLILSVLGTPPEGLISAIRAERVRSYVQSLPSRTAVPLSKLYP-QAEPDALDLLGAMLRFDPRQRIGVTEALEHPYLAKYHDPDDEPI 368          
BLAST of Mitogen-activated protein kinase vs. Planmine SMEST
Match: SMESG000081061.1 (SMESG000081061.1)

HSP 1 Score: 1190.25 bits (3078), Expect = 0.000e+0
Identity = 583/584 (99.83%), Postives = 584/584 (100.00%), Query Frame = 3
Query:   36 MTNEVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQKKAEKEARTQARRPNEEIKSLRXXXXXXXXXXXENAMIMEQKIASRANYDIAFGRTTHQRPPPPKNNHASNQSNNPLIGMKAFLTKTENTKIDNSRSRLSHSAFQRDDGNSRNETSFQKKSFGSDVEQKRPSRNVMTCSKEASNPVILRDLHSTSISATGNKVSMQSRPASAQHVRSNSATFGRKQFDNAKNHSNMRSTLGSYSQTYGTVSSSQLNNLYSRNCVR 1787
            MTNEVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQKKAEKEARTQARRPNEEIKSLRSTDNTDDNNSSENAMIMEQKIASRANYDIAFGRTTHQRPPPPKNNHASNQSNNPLIGMKAFLTKTENTKIDNSRSRLSHSAFQRDDGNSRNETSFQKKSFGSDVEQKRP+RNVMTCSKEASNPVILRDLHSTSISATGNKVSMQSRPASAQHVRSNSATFGRKQFDNAKNHSNMRSTLGSYSQTYGTVSSSQLNNLYSRNCVR
Sbjct:    1 MTNEVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQKKAEKEARTQARRPNEEIKSLRSTDNTDDNNSSENAMIMEQKIASRANYDIAFGRTTHQRPPPPKNNHASNQSNNPLIGMKAFLTKTENTKIDNSRSRLSHSAFQRDDGNSRNETSFQKKSFGSDVEQKRPNRNVMTCSKEASNPVILRDLHSTSISATGNKVSMQSRPASAQHVRSNSATFGRKQFDNAKNHSNMRSTLGSYSQTYGTVSSSQLNNLYSRNCVR 584          
BLAST of Mitogen-activated protein kinase vs. Planmine SMEST
Match: SMESG000033376.1 (SMESG000033376.1)

HSP 1 Score: 496.893 bits (1278), Expect = 3.358e-167
Identity = 227/370 (61.35%), Postives = 294/370 (79.46%), Query Frame = 3
Query:   36 MTNEVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYRSKLYDMITQKKAEKEARTQA 1145
            MTNEVES+I+++Y+IK R+G GAYGIVWK IDKKS E VALKKIFDAF+N+TDAQRTFREIAFL+ F GHPNII L NV KA+ND+DIYL FE M++DLHNVIKRGN+LK VHK+YI+YQ+LKA KY+HS NVIHRD KPSNVLLDS+C VKLCDFGL RSL + ++++P  N            P LTEYVATRWYRAPEIL+ S KYTK VD+WS+GCIL E++LGKALF G S++NQI+ I++ +P+P +ED+E++   Y  +++ ++  +P +  N++ P N D VA DL+  LLQFNP KR T+E+ALEH Y+++FH+   E+ M HE++PP++D+ QLS++EYRSKLY  I Q KA+K+AR +A
Sbjct:    1 MTNEVESHILEKYEIKKRLGKGAYGIVWKVIDKKSQEVVALKKIFDAFRNKTDAQRTFREIAFLKQFHGHPNIIKLYNVLKAENDKDIYLTFEFMETDLHNVIKRGNILKDVHKQYIMYQLLKATKYLHSANVIHRDQKPSNVLLDSDCFVKLCDFGLARSLSERDTMNPNPNL-----------PPLTEYVATRWYRAPEILMASHKYTKGVDMWSLGCILGEMILGKALFPGKSTMNQIDLIMTYIPKPEKEDIETMLKVYGATMVTKVNTRPRRTLNDLIP-NSDSVAMDLIIKLLQFNPDKRNTIEEALEHPYVKRFHNVAEELSMGHEVIPPVDDDIQLSVEEYRSKLYKFIMQNKAQKKARKRA 358          
BLAST of Mitogen-activated protein kinase vs. Planmine SMEST
Match: SMESG000001435.1 (SMESG000001435.1)

HSP 1 Score: 267.314 bits (682), Expect = 5.494e-84
Identity = 153/335 (45.67%), Postives = 207/335 (61.79%), Query Frame = 3
Query:   36 MTNEVESNIIK--------RYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINVRKADN---DRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDP 1007
            MT+EVE  +IK        RY   N IG GAYG+V  A D    E VA+KKI   F+ +T  QRT REI  L  F  H NII + ++  A++    +D+Y+V  LM++DL  ++K   L  + H  Y +YQIL+ +KYIHS NV+HRDLKPSN+LL++ C +K+CDFGL R           A+ E D  G       LTEYVATRWYRAPEI+L S  YTKS+D+WSVGCILAE++  K LF G   ++Q+  I+  L  P++ED++SI +   R  L Q+ YKP   +  ++P N D  A DL++ LL FNP  R  VE AL H Y+++++DP
Sbjct:    1 MTDEVE--VIKGQAFEVKPRYIDLNYIGEGAYGMVASAYDNIKKEKVAIKKI-SPFEYQTYCQRTLREIKILTRFK-HENIIDIRDIITANSINEMKDVYIVQCLMETDLFKLLKTQQL-SNDHTCYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARV----------ADPEHDHTG------LLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLNNKPLFPGKHYIDQLNLILGVLGSPNQEDLDSIVNLKARGYLQQLPYKPKVSWKSLYP-NADDQALDLIEKLLTFNPVNRIGVEDALAHPYLKQYYDP 313          
BLAST of Mitogen-activated protein kinase vs. Planmine SMEST
Match: SMESG000032743.1 (SMESG000032743.1)

HSP 1 Score: 259.225 bits (661), Expect = 1.268e-80
Identity = 143/323 (44.27%), Postives = 199/323 (61.61%), Query Frame = 3
Query:   48 VESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNII---TLINVRKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDP 1007
            VE ++  RY     IG GAYG V  AID K   NVA+K+    F+++T  QRT+REI  L  F+ H NII    L+  ++    +D+Y+V  LM++DLH + K   L    H  Y +YQIL+ +KYIHS NVIHRDLKPSN+L++SNC +K+CDFGL+R            + E D  G       LTEYVATRWYRAPEI+L S  YTK++D+WSVGCILAE++ GK +F G   + Q+  I++ L  P EED   I +E  R  + + + K    + +++P N D+    +++ LL FNP KR TVEQAL   Y+ ++++P
Sbjct:   13 VEFDVGPRYGNFKFIGEGAYGQVVSAIDTKDNSNVAIKRT-SPFEHQTYCQRTYREIKILMHFN-HENIIDIRNLLTAKEMIEMKDLYIVQALMETDLHKLCKSQKL-SLEHICYFLYQILRGLKYIHSANVIHRDLKPSNLLVNSNCDLKICDFGLSRV----------NDPEHDHKG------ILTEYVATRWYRAPEIMLNSKGYTKAIDIWSVGCILAEMLNGKPIFPGKHYVEQLTLIITVLGYPCEEDKAWIVNEKARHFVEKFVTKMKTPWKQLYP-NADEQCITMLEGLLTFNPGKRLTVEQALAMPYLNQYYEP 315          
BLAST of Mitogen-activated protein kinase vs. Planmine SMEST
Match: SMESG000012868.1 (SMESG000012868.1)

HSP 1 Score: 258.84 bits (660), Expect = 1.740e-80
Identity = 139/317 (43.85%), Postives = 200/317 (63.09%), Query Frame = 3
Query:   69 RYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKNETDAQRTFREIAFLQDFSGHPNIITLINV----RKADNDRDIYLVFELMDSDLHNVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCTVKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAPEILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPRPSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQFNPRKRFTVEQALEHAYIEKFHDP 1007
            RY     IG GAYGIV  A D  + E+VA+K+I   F+++T  QRT+REI  L  F  H N+I + N+     K ++ +DIY+V  LMD+D++ +IK   L  + H  Y +YQIL+ VKYIHS NV+HRDLKPSN+L++SNC +K+CDFGL R                D + D N    LTEYVATRWYRAPE++L S  Y+K++D+WS+GCILAE++  K LF G   + Q++ I   L  P  ED   I +E  R+ + ++I  P + + E+FP N +    D++  LL FNP KR T ++AL+H Y++++++P
Sbjct:   20 RYTNLRFIGEGAYGIVVSATDNVTHEDVAIKRI-SPFEHQTFCQRTYREIKILLHFK-HENVIDIKNLLTPASKIEDIKDIYIVQSLMDTDMYKLIKDQKL-SNEHICYFLYQILRGVKYIHSANVLHRDLKPSNLLVNSNCDLKICDFGLARV--------------NDPVQDHNG--MLTEYVATRWYRAPEVMLNSKGYSKAMDMWSIGCILAEMLGCKPLFPGKHYVQQLKLIFDVLGSPDYEDKSWIVNEKARNFVEKLIDIPKRPWEELFP-NSEPFCLDILDQLLAFNPSKRLTADKALQHPYLQQYYEP 316          
The following BLAST results are available for this feature:
BLAST of Mitogen-activated protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAPK151.877e-13450.55mitogen-activated protein kinase 15 [Source:HGNC S... [more]
MAPK151.877e-13450.55mitogen-activated protein kinase 15 [Source:HGNC S... [more]
MAPK151.151e-10656.02mitogen-activated protein kinase 15 [Source:HGNC S... [more]
MAPK156.825e-10552.43mitogen-activated protein kinase 15 [Source:HGNC S... [more]
MAPK158.727e-10552.43mitogen-activated protein kinase 15 [Source:HGNC S... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk-159.575e-15154.47Mitogen-activated protein kinase 15 [Source:UniPr... [more]
mpk-12.283e-7940.38Mitogen-activated protein kinase mpk-1 [Source:Un... [more]
mpk-13.044e-7940.38Mitogen-activated protein kinase mpk-1 [Source:Un... [more]
mpk-23.213e-7538.58Mitogen-activated protein kinase [Source:UniProtK... [more]
F09C12.21.343e-7340.58Mitogen-activated protein kinase [Source:UniProtK... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Erk73.161e-12148.02gene:FBgn0052703 transcript:FBtr0302966[more]
Erk76.806e-11648.02gene:FBgn0052703 transcript:FBtr0071329[more]
Erk76.806e-11648.02gene:FBgn0052703 transcript:FBtr0302965[more]
rl3.892e-8446.20gene:FBgn0003256 transcript:FBtr0113703[more]
rl3.892e-8446.20gene:FBgn0003256 transcript:FBtr0113702[more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk153.756e-15959.29mitogen-activated protein kinase 15 [Source:ZFIN;A... [more]
mapk31.211e-8242.54mitogen-activated protein kinase 3 [Source:ZFIN;Ac... [more]
mapk13.011e-8044.94mitogen-activated protein kinase 1 [Source:ZFIN;Ac... [more]
mapk13.011e-8044.94mitogen-activated protein kinase 1 [Source:ZFIN;Ac... [more]
mapk13.011e-8044.94mitogen-activated protein kinase 1 [Source:ZFIN;Ac... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atxn71.413e-16644.67ataxin 7 [Source:Xenbase;Acc:XB-GENE-956283][more]
atxn71.368e-14959.37ataxin 7 [Source:Xenbase;Acc:XB-GENE-956283][more]
cdknx6.912e-8044.27cyclin-dependent kinase inhibitor xic1 [Source:Xen... [more]
cdknx9.383e-8044.94cyclin-dependent kinase inhibitor xic1 [Source:Xen... [more]
cdknx1.052e-7944.94cyclin-dependent kinase inhibitor xic1 [Source:Xen... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mapk157.952e-13350.27mitogen-activated protein kinase 15 [Source:MGI Sy... [more]
Mapk17.264e-8145.17mitogen-activated protein kinase 1 [Source:MGI Sym... [more]
Mapk17.264e-8145.17mitogen-activated protein kinase 1 [Source:MGI Sym... [more]
Mapk17.264e-8145.17mitogen-activated protein kinase 1 [Source:MGI Sym... [more]
Mapk33.931e-8044.38mitogen-activated protein kinase 3 [Source:MGI Sym... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q501Q9|MK15_XENLA3.525e-16543.72Mitogen-activated protein kinase 15 OS=Xenopus lae... [more]
sp|Q11179|MK15_CAEEL1.218e-14954.47Mitogen-activated protein kinase 15 OS=Caenorhabdi... [more]
sp|Q8TD08|MK15_HUMAN9.014e-13450.55Mitogen-activated protein kinase 15 OS=Homo sapien... [more]
sp|Q9Z2A6|MK15_RAT1.434e-13250.53Mitogen-activated protein kinase 15 OS=Rattus norv... [more]
sp|Q80Y86|MK15_MOUSE5.562e-13250.27Mitogen-activated protein kinase 15 OS=Mus musculu... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JU080.000e+047.06Mitogen-activated protein kinase OS=Lingula unguis... [more]
A0A210PNM31.214e-17246.08Mitogen-activated protein kinase OS=Mizuhopecten y... [more]
A0A433SZV93.410e-16945.57Mitogen-activated protein kinase OS=Elysia chlorot... [more]
A0A4S2MDY91.890e-16844.98Mitogen-activated protein kinase OS=Opisthorchis f... [more]
A0A4E0R9414.497e-16644.79Mitogen-activated protein kinase OS=Fasciola hepat... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk158.666e-16056.53mitogen-activated protein kinase 15 [Source:NCBI g... [more]
mapk36.859e-8342.54mitogen-activated protein kinase 1 [Source:NCBI ge... [more]
mapk15.076e-8144.94mitogen-activated protein kinase 1 [Source:NCBI ge... [more]
mapk11.083e-8044.69mitogen-activated protein kinase 1 [Source:NCBI ge... [more]
zgc:1717757.753e-7235.59mitogen-activated protein kinase 12-like [Source:N... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk152.101e-15042.41mitogen-activated protein kinase 15 [Source:ZFIN;A... [more]
mapk154.911e-14458.71mitogen-activated protein kinase 15 [Source:ZFIN;A... [more]
mapk16.870e-8442.94mitogen-activated protein kinase 1 [Source:ZFIN;Ac... [more]
mapk14a5.369e-6835.74mitogen-activated protein kinase 14a [Source:NCBI ... [more]
ENSPMAT00000000729.15.088e-6536.89pep scaffold:Pmarinus_7.0:GL477416:20288:37329:-1 ... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
FUS31.565e-8141.06Mitogen-activated serine/threonine protein kinase ... [more]
SLT21.377e-7940.96Serine/threonine MAP kinase; coordinates expressio... [more]
KSS12.588e-7741.50Mitogen-activated protein kinase (MAPK); involved ... [more]
HOG16.955e-7138.11Mitogen-activated protein kinase involved in osmor... [more]
KDX14.852e-6837.93Protein kinase; implicated in Slt2p mitogen-activa... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO394212.924e-14059.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374351.256e-8945.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405731.354e-7840.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468813.533e-6636.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO305272.954e-6137.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk152.133e-15758.29mitogen-activated protein kinase 15 [Source:NCBI g... [more]
mapk152.133e-15758.29mitogen-activated protein kinase 15 [Source:NCBI g... [more]
mapk31.801e-8245.57mitogen-activated protein kinase 1 [Source:NCBI ge... [more]
mapk11.865e-8044.94mitogen-activated protein kinase 1 [Source:NCBI ge... [more]
mapk79.134e-7940.91mitogen-activated protein kinase 7 [Source:NCBI ge... [more]
back to top
BLAST of Mitogen-activated protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081061.10.000e+099.83SMESG000081061.1[more]
SMESG000033376.13.358e-16761.35SMESG000033376.1[more]
SMESG000001435.15.494e-8445.67SMESG000001435.1[more]
SMESG000032743.11.268e-8044.27SMESG000032743.1[more]
SMESG000012868.11.740e-8043.85SMESG000012868.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008112 ID=SMED30008112|Name=Mitogen-activated protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1906bp
GTGATTATACTAGTAACAAATAAATTTAATTTAAAATGACAAATGAAGTA
GAATCAAATATAATTAAACGATACGATATTAAAAACAGAATTGGTGTTGG
AGCATATGGTATTGTTTGGAAAGCAATAGATAAGAAATCTGGAGAAAATG
TTGCTTTGAAAAAAATATTTGATGCCTTTAAAAATGAAACAGACGCTCAA
CGAACGTTCCGAGAAATAGCTTTTTTACAAGATTTTTCCGGCCATCCAAA
TATTATCACATTGATTAATGTCAGAAAAGCTGACAATGATCGCGATATTT
ATTTAGTATTTGAATTAATGGATTCCGATTTGCATAATGTTATCAAACGG
GGGAATTTATTAAAATCCGTTCATAAAGAGTATATTATTTATCAAATTTT
AAAGGCAGTGAAATATATTCATTCTGGAAATGTCATTCATAGAGATTTAA
AGCCGTCCAACGTTCTATTGGATAGTAATTGCACAGTGAAATTATGTGAT
TTCGGATTAACTCGATCACTGCATCAAATAGAATCACTTCATCCGAAGGC
CAACAAAGAAACAGATGGATTAGGCGACTTCAATACCGATCCGACATTAA
CTGAATACGTTGCTACTCGATGGTATCGAGCTCCTGAAATACTTCTTGGT
TCTACTAAATATACTAAATCGGTTGATCTCTGGAGCGTCGGATGCATTCT
AGCGGAAATTATGCTAGGCAAAGCACTATTCACAGGGTCTTCGTCATTGA
ATCAAATAGAGAAAATCGTCTCAGCTCTACCTCGGCCATCTGAAGAAGAC
ATGGAAAGCATCAAATCTGAATATTGTCGATCGATATTAAATCAGATCAT
CTACAAACCAGGGAAAAAGTTCAATGAAATATTTCCAGCTAATGTTGATC
AAGTGGCTTTTGATTTGGTAAAGAATTTACTCCAGTTCAATCCAAGGAAA
CGATTTACAGTTGAACAAGCTCTGGAACATGCTTATATTGAAAAATTTCA
TGACCCCGAGTTGGAAATAATAATGGATCACGAAATCGTACCGCCCATTA
ATGACGAATGTCAATTATCAATTGATGAATATCGTTCAAAACTTTATGAT
ATGATAACACAGAAAAAAGCTGAAAAAGAAGCACGAACTCAAGCAAGAAG
ACCTAATGAAGAAATTAAATCTTTACGATCAACTGACAATACCGATGACA
ACAATTCAAGTGAAAATGCGATGATAATGGAACAAAAAATTGCCAGCAGA
GCTAATTATGACATAGCGTTTGGGCGCACTACTCATCAGCGGCCACCACC
ACCAAAAAATAATCATGCGTCTAATCAGTCAAATAATCCCTTAATTGGTA
TGAAAGCATTTCTTACAAAAACAGAAAACACGAAAATTGATAACAGTAGA
AGTAGATTGTCTCATAGTGCTTTCCAAAGAGATGATGGTAATTCACGCAA
CGAAACAAGTTTCCAAAAGAAATCTTTTGGATCTGATGTGGAACAGAAGC
GCCCAAGTCGAAACGTCATGACTTGTTCCAAGGAAGCAAGTAATCCAGTG
ATTCTTCGTGATCTACACTCAACATCAATTTCAGCTACTGGAAACAAAGT
TAGTATGCAAAGTCGACCTGCTTCTGCTCAACATGTTCGATCAAACAGTG
CAACATTTGGTCGGAAACAATTCGACAACGCAAAAAATCATTCTAACATG
CGCTCGACCCTTGGAAGCTATTCTCAGACCTATGGTACTGTGAGCAGCAG
CCAACTGAACAATTTGTACAGTCGAAATTGTGTCCGATAAAGATTATCAT
GATTTTTGTTTTATTTTGTTGTCCTGGATTTCCAATGAATGCTTAAATTT
ATCTGCTTTGATATTTCGAATGATACATAAAAATTAATTAATTTTTTTGA
AAACCA
back to top

protein sequence of SMED30008112-orf-1

>SMED30008112-orf-1 ID=SMED30008112-orf-1|Name=SMED30008112-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=585bp
MTNEVESNIIKRYDIKNRIGVGAYGIVWKAIDKKSGENVALKKIFDAFKN
ETDAQRTFREIAFLQDFSGHPNIITLINVRKADNDRDIYLVFELMDSDLH
NVIKRGNLLKSVHKEYIIYQILKAVKYIHSGNVIHRDLKPSNVLLDSNCT
VKLCDFGLTRSLHQIESLHPKANKETDGLGDFNTDPTLTEYVATRWYRAP
EILLGSTKYTKSVDLWSVGCILAEIMLGKALFTGSSSLNQIEKIVSALPR
PSEEDMESIKSEYCRSILNQIIYKPGKKFNEIFPANVDQVAFDLVKNLLQ
FNPRKRFTVEQALEHAYIEKFHDPELEIIMDHEIVPPINDECQLSIDEYR
SKLYDMITQKKAEKEARTQARRPNEEIKSLRSTDNTDDNNSSENAMIMEQ
KIASRANYDIAFGRTTHQRPPPPKNNHASNQSNNPLIGMKAFLTKTENTK
IDNSRSRLSHSAFQRDDGNSRNETSFQKKSFGSDVEQKRPSRNVMTCSKE
ASNPVILRDLHSTSISATGNKVSMQSRPASAQHVRSNSATFGRKQFDNAK
NHSNMRSTLGSYSQTYGTVSSSQLNNLYSRNCVR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR003527MAP_kinase_CS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0004707MAP kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0000165MAPK cascade
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 13..318
e-value: 1.8E-92
score: 323.2
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 13..318
e-value: 8.0E-68
score: 228.6
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 13..318
score: 47.439
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 95..344
e-value: 4.1E-134
score: 448.7
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 9..355
e-value: 4.1E-134
score: 448.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 450..473
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 362..392
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 362..383
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 474..493
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 449..493
NoneNo IPR availablePANTHERPTHR24055MITOGEN-ACTIVATED PROTEIN KINASEcoord: 20..419
NoneNo IPR availablePANTHERPTHR24055:SF79MITOGEN-ACTIVATED PROTEIN KINASE 15coord: 20..419
NoneNo IPR availableCDDcd07852STKc_MAPK15-likecoord: 5..357
e-value: 0.0
score: 601.47
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 133..145
IPR003527Mitogen-activated protein (MAP) kinase, conserved sitePROSITEPS01351MAPKcoord: 48..149
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 19..42
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 8..325