DnaJ homolog subfamily C member 2

Overview
NameDnaJ homolog subfamily C member 2
Smed IDSMED30008111
Length (bp)1889
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DnaJ homolog subfamily C member 2 (SMED30008111) t-SNE clustered cells

Violin plots show distribution of expression levels for DnaJ homolog subfamily C member 2 (SMED30008111) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DnaJ homolog subfamily C member 2 (SMED30008111) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DnaJ homolog subfamily C member 2 (SMED30008111) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008111

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30008111h1SMcG0011900 dd_Smed_v4_1353_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008111h1SMcG0011900 dd_Smed_v4_1353_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30008111h1SMcG0011900 dd_Smed_v4_1353_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30008111h1SMcG0011900 dd_Smed_v4_1353_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008111h1SMcG0011900 dd_Smed_v4_1353_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30008111h1SMcG0011900 dd_Smed_v4_1353_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008111h1SMcG0011900 Contig48201uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008111h1SMcG0011900 Contig48201newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Human
Match: DNAJC2 (DnaJ heat shock protein family (Hsp40) member C2 [Source:HGNC Symbol;Acc:HGNC:13192])

HSP 1 Score: 327.405 bits (838), Expect = 3.494e-103
Identity = 218/541 (40.30%), Postives = 322/541 (59.52%), Query Frame = 3
Query:  219 LQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRIIKYNAQRXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEMNNLKKQKDVLKNRQKAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLNEKVLDASKSIEN--KSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAH-QPGLGIKEKQVVQRAKLLKNDD---------SVLKKEAAAHNFVTKADLTINEGLKNVKISDVSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            L++LDP+DWK QDHYAVL L  +R  A+Q  IK A++  +L HHPDK K      ++ +NDYFTCITKA+++L D V R +++SVDP FD+ +P+  ++K++FF+ FTPVF+RN+RWS  + VP LGD N+   +V  FY+FW +F SWREFSYLD+E K +A+CR+ERR+I+K N+  R ++  EE  RI ++V  A + DPRI K+  + KA+KE EKKAKAE K + + A EK  + E E     + + + +++ +    KK+KD+ K   K E++KLR   +T+N+       F++N     + ++ +MM  VE LC ++++  L  LNE L + T+E   A L+K  E++NE++    +  E   + A+ N+E S      G K W+ +  Q LIKA+N  P GT  RW  IA YMN H   G+    K V+ +AK L+  D             K    H  V +AD        N   S+  +      + WT  EQK LE ALK+ P + P RW+KI+E V  R+KK+C+ R+
Sbjct:   76 LKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTCITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKDNFFEVFTPVFERNSRWSNKKNVPKLGDMNSSFEDVDIFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQNRATRAQRKKEEMNRIRTLVDNAYSCDPRIKKFKEEEKAKKEAEKKAKAEAKRKEQEAKEKQRQAELEAARLAKEKEEEEVRQQALLAKKEKDIQKKAIKKERQKLRNSCKTWNH-------FSDN-----EAERVKMMEEVEKLCDRLELASLQCLNETLTSCTKEVGKAALEKQIEEINEQIRKEKEEAEARMRQASKNTEKSTGGGGNGSKNWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTAKDVIGKAKSLQKLDPHQKDDINKKAFDKFKKEHGVVPQAD--------NATPSERFEGPYTDFTPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRTKKDCMKRY 596          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Human
Match: DNAJC2 (DnaJ heat shock protein family (Hsp40) member C2 [Source:HGNC Symbol;Acc:HGNC:13192])

HSP 1 Score: 208.764 bits (530), Expect = 2.405e-63
Identity = 94/176 (53.41%), Postives = 132/176 (75.00%), Query Frame = 3
Query:  219 LQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGN 746
            L++LDP+DWK QDHYAVL L  +R  A+Q  IK A++  +L HHPDK K      ++ +NDYFTCITKA+++L D V R +++SVDP FD+ +P+  ++K++FF+ FTPVF+RN+RWS  + VP LGD N+   +V  FY+FW +F SWREFSYLD+E K +A+CR+ERR+I+K N
Sbjct:    2 LKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTCITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKDNFFEVFTPVFERNSRWSNKKNVPKLGDMNSSFEDVDIFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQN 177          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Human
Match: DNAJC2 (DnaJ heat shock protein family (Hsp40) member C2 [Source:HGNC Symbol;Acc:HGNC:13192])

HSP 1 Score: 220.705 bits (561), Expect = 2.639e-63
Identity = 105/205 (51.22%), Postives = 149/205 (72.68%), Query Frame = 3
Query:  219 LQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRI 833
            L++LDP+DWK QDHYAVL L  +R  A+Q  IK A++  +L HHPDK K      ++ +NDYFTCITKA+++L D V R +++SVDP FD+ +P+  ++K++FF+ FTPVF+RN+RWS  + VP LGD N+   +V  FY+FW +F SWREFSYLD+E K +A+CR+ERR+I+K N+  R ++  EE  RI ++V  A + DPRI
Sbjct:   76 LKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTCITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKDNFFEVFTPVFERNSRWSNKKNVPKLGDMNSSFEDVDIFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQNRATRAQRKKEEMNRIRTLVDNAYSCDPRI 280          

HSP 2 Score: 96.6709 bits (239), Expect = 2.714e-20
Identity = 65/189 (34.39%), Postives = 92/189 (48.68%), Query Frame = 3
Query: 1275 EKLNEKVLDASKSIENK--SAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAHQP-GLGIKEKQVVQRAKLLKNDDS---------VLKKEAAAHNFVTKADLTINEGLKNVKISDVSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            E++NE++    +  E +   A+ N+E S      G K W+ +  Q LIKA+N  P GT  RW  IA YMN H   G+    K V+ +AK L+  D             K    H  V +AD        N   S+  +      + WT  EQK LE ALK+ P + P RW+KI+E V  R+KK+C+ R+
Sbjct:  363 EEINEQIRKEKEEAEARMRQASKNTEKSTGGGGNGSKNWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTAKDVIGKAKSLQKLDPHQKDDINKKAFDKFKKEHGVVPQAD--------NATPSERFEGPYTDFTPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRTKKDCMKRY 543          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Human
Match: DNAJC2 (DnaJ heat shock protein family (Hsp40) member C2 [Source:HGNC Symbol;Acc:HGNC:13192])

HSP 1 Score: 176.792 bits (447), Expect = 1.456e-50
Identity = 92/205 (44.88%), Postives = 133/205 (64.88%), Query Frame = 3
Query:  219 LQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRI 833
            L++LDP+DWK QDHYAVL L  +R  A+Q  IK A++  +L HHPDK K      ++ +NDYFTCITKA+++L D V R +++SVDP FD+ +P+  ++K++FF+ FTPVF+RN+R+                           +F SWREFSYLD+E K +A+CR+ERR+I+K N+  R ++  EE  RI ++V  A + DPRI
Sbjct:   65 LKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTCITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKDNFFEVFTPVFERNSRY---------------------------NFDSWREFSYLDEEEKEKAECRDERRWIEKQNRATRAQRKKEEMNRIRTLVDNAYSCDPRI 242          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Human
Match: DNAJC2 (DnaJ heat shock protein family (Hsp40) member C2 [Source:HGNC Symbol;Acc:HGNC:13192])

HSP 1 Score: 82.8037 bits (203), Expect = 7.500e-18
Identity = 37/69 (53.62%), Postives = 48/69 (69.57%), Query Frame = 3
Query:  219 LQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKA 425
            L++LDP+DWK QDHYAVL L  +R  A+Q  IK A++  +L HHPDK K      ++ +NDYFTCITK 
Sbjct:   76 LKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTCITKG 144          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Celegans
Match: dnj-11 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:Q94216])

HSP 1 Score: 256.529 bits (654), Expect = 6.349e-77
Identity = 208/557 (37.34%), Postives = 309/557 (55.48%), Query Frame = 3
Query:  174 IEKYIFDDIHENHE-YLQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLK-DQVSRISYDSVDPEFDDDIPTLRD-SKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRIIKYNAQRXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEMNNLKKQKDVLKNRQKAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLNEKVLDASKSI-ENKSAANNSELSGIINKCGDKE-WTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAHQ---PGLGIK-EKQVVQRAKLLKNDDSVLKKEAAAHNFVTKADLTINEGLKNVKISDVSQ----PAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            + K +FD  +E +E YL  LDP D K QDHY VL L K+R  A+ + I+  YR+++L HHPDK K R    E E  +YFTCITKA++ +    V R ++DSVD +F+D IP  +  +  +F+    PVFQ N+RWS  +PVP LG  +    +V  FY+FW +F SWREFSYLD+E K + + R ERR ++K NK ER+++  EE+KRI  +V +A   DPRIIK+  +++A+K++ K+ K     E + A ++  RE++E   +++ E   K K+E    KK++D+ K     ++++L+KLA+   ++           E   D  K   M  +E +C+   +D L +L EK+E+ +    +       E L ++   A  +I E+K+  N         K  DKE WT E  Q L+KA N  PPGT  RW  IA+Y+N H+    GL  K EKQV+++ K ++                            NVK+   +Q     A+  + +W+  EQK+LE A+K   SSDP RW+KIS  V T+SKK CI RF
Sbjct:   70 LRKDLFDADNEKYEKYLMKLDPNDCKNQDHYKVLGLSKLRWQATSDEIRFCYRQKVLKHHPDKKKHRGIVMEKE--EYFTCITKAYEQVGMSDVKRQAFDSVDHKFNDIIPNEKSINHNNFYNELAPVFQLNSRWSNIKPVPELGKSDATREDVENFYDFWFNFQSWREFSYLDEEDKERGEDRYERREMEKQNKAERERRRKEEAKRIRKLVDIAYAKDPRIIKFKKEQQAKKDKAKEDKQRAIREKQEAIDREKREKEEAEAKQKEEADRKAKEEREREKKERDIAKKAMSQQRKRLKKLADEAGHWT----------ENPRD--KLTEMERIERICIGFTVDQLRELCEKVESLSIASEIQTALTDAEILKKEAAGAKVTITEDKNKEN--------EKQADKETWTSEEIQLLVKASNTFPPGTVERWVQIADYINEHRKDSTGLPPKTEKQVIKQCKAVQT--------------------------MNVKLPSTTQNQLGTALPDEDVWSATEQKTLEDAIKKHKSSDPERWEKISTEVGTKSKKACIRRF 578          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Celegans
Match: dnj-17 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:O62360])

HSP 1 Score: 75.8702 bits (185), Expect = 2.631e-14
Identity = 65/222 (29.28%), Postives = 102/222 (45.95%), Query Frame = 3
Query:  258 HYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYD--------SVDPEFDDDIPTL------------RDSKEDFFKFFTPVF------QRNARWSKTQPVPMLGDENTPIAEVLR-FYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRIIKY 842
            HY VL +++   +A  + IK+ YRK  L  HPDK   R+ +C  +    F  +  A+D+L D   R  YD          + +F++    L             + K  FF  +  VF      + +A    T   P  GD++T + + +  FY FW  FS+ R F++LD    +QA  R E R ID+ NK  R     E +++I ++V   +  DPR+  Y
Sbjct:    4 HYEVLEVER---DADDDKIKKNYRKLALKWHPDKNPDRIEECTQQ----FRLLQAAYDVLSDPREREFYDRHRESILKGKNTDFEEQSTDLFPYFTASCYQGYENDKNGFFTVYRKVFNILVSEEYDAYNDSTIVYPEFGDKDTDLEQTVNGFYGFWSSFSTTRSFAWLDHYDITQASNRFESRQIDQENKKFRDVGKQERNEQIRNLVAFVRKRDPRVKAY 218          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Fly
Match: CG10565 (gene:FBgn0037051 transcript:FBtr0305502)

HSP 1 Score: 280.411 bits (716), Expect = 3.249e-85
Identity = 201/584 (34.42%), Postives = 303/584 (51.88%), Query Frame = 3
Query:  216 YLQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCED--ENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRIIKYNAQRXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEMNNLKKQKDVLKNRQKAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLNEKVLDASKSIENKSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAHQP--GLGIKEKQVVQRAKLLKNDD---SVLKKEAAAHNFV----------TKADLTINEGLKNVKISDVSQPAVDSKS--------------------------------------IWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILR 1802
            YL+SLDP++WK+QDHYAVL L K+R  AS++ +++AYR+ +L HHPDK   R  K E+  +++DYFTCITKA+++L     R S+DSVDPEFDD +P+  D   D+F  F   F  N RWS+   VP  G  +    EV RFYNFW DF SWREFSYLD+E K +   R+ERR+I+K N+  R K+  EE  RI S+V LA  ND RI ++  + K  K   K+AK +     +  A++A+RE     E+ E   Q +++      ++QK +LK     E++ LR   +   Y+               D  + + M   E +C    + +L  LN+ +E+   E  VA L+  ++K+  ++ + +++   K A++ +   G+     ++ W+ E  Q LIKA+N  P GT  RW+ IA ++N H P   + +  + V+ +AK L+N D   S LK +A    F           T  D+T+ E        ++ Q  VD K+                                       WT  EQ  LE A+K+ P++ P RWD I+  +  RSKK+C+ R
Sbjct:   63 YLKSLDPKEWKDQDHYAVLGLGKLRYEASEDDVRRAYRRMVLLHHPDK---RKAKGEEVIQDDDYFTCITKAYEILGTSKPRRSFDSVDPEFDDSLPSQNDIDNDYFGVFNKFFTLNGRWSEKPHVPSFGQVDAKREEVERFYNFWYDFKSWREFSYLDEEDKEKGQDRDERRWIEKENRAARIKRKKEEMSRIRSLVDLAYNNDKRIQRFKQEEKDRKAAAKRAKMDAAQAQKAEADRAIREAALAKEKAEKAEQKRIEQIRIEREQQKKLLKK----ERKTLRDKVKDCKYYA------------KNDKDQLKHMEGTEKICETFNLAELQALNKAMESKGRESFVAALQTAEQKIAAELEEINQTQAKKLASSAATPKGVKEVKKNELWSNENVQLLIKAVNLFPAGTAQRWDVIATFINQHSPDNTVLVNARDVLNKAKALQNTDHSKSSLKTQANDAAFASFEKSKKDVQTCKDITLGEETAQASKENLKQNGVDHKANNQSTKQNGTAPAPANPTAAPAPVPATNGSTGGGAASKTWTKEEQALLEQAIKTYPTTTPDRWDCIAACIPNRSKKDCLRR 627          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Fly
Match: CG10565 (gene:FBgn0037051 transcript:FBtr0078323)

HSP 1 Score: 280.411 bits (716), Expect = 3.249e-85
Identity = 201/584 (34.42%), Postives = 303/584 (51.88%), Query Frame = 3
Query:  216 YLQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCED--ENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRIIKYNAQRXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEMNNLKKQKDVLKNRQKAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLNEKVLDASKSIENKSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAHQP--GLGIKEKQVVQRAKLLKNDD---SVLKKEAAAHNFV----------TKADLTINEGLKNVKISDVSQPAVDSKS--------------------------------------IWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILR 1802
            YL+SLDP++WK+QDHYAVL L K+R  AS++ +++AYR+ +L HHPDK   R  K E+  +++DYFTCITKA+++L     R S+DSVDPEFDD +P+  D   D+F  F   F  N RWS+   VP  G  +    EV RFYNFW DF SWREFSYLD+E K +   R+ERR+I+K N+  R K+  EE  RI S+V LA  ND RI ++  + K  K   K+AK +     +  A++A+RE     E+ E   Q +++      ++QK +LK     E++ LR   +   Y+               D  + + M   E +C    + +L  LN+ +E+   E  VA L+  ++K+  ++ + +++   K A++ +   G+     ++ W+ E  Q LIKA+N  P GT  RW+ IA ++N H P   + +  + V+ +AK L+N D   S LK +A    F           T  D+T+ E        ++ Q  VD K+                                       WT  EQ  LE A+K+ P++ P RWD I+  +  RSKK+C+ R
Sbjct:   63 YLKSLDPKEWKDQDHYAVLGLGKLRYEASEDDVRRAYRRMVLLHHPDK---RKAKGEEVIQDDDYFTCITKAYEILGTSKPRRSFDSVDPEFDDSLPSQNDIDNDYFGVFNKFFTLNGRWSEKPHVPSFGQVDAKREEVERFYNFWYDFKSWREFSYLDEEDKEKGQDRDERRWIEKENRAARIKRKKEEMSRIRSLVDLAYNNDKRIQRFKQEEKDRKAAAKRAKMDAAQAQKAEADRAIREAALAKEKAEKAEQKRIEQIRIEREQQKKLLKK----ERKTLRDKVKDCKYYA------------KNDKDQLKHMEGTEKICETFNLAELQALNKAMESKGRESFVAALQTAEQKIAAELEEINQTQAKKLASSAATPKGVKEVKKNELWSNENVQLLIKAVNLFPAGTAQRWDVIATFINQHSPDNTVLVNARDVLNKAKALQNTDHSKSSLKTQANDAAFASFEKSKKDVQTCKDITLGEETAQASKENLKQNGVDHKANNQSTKQNGTAPAPANPTAAPAPVPATNGSTGGGAASKTWTKEEQALLEQAIKTYPTTTPDRWDCIAACIPNRSKKDCLRR 627          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Zebrafish
Match: dnajc2 (DnaJ (Hsp40) homolog, subfamily C, member 2 [Source:NCBI gene;Acc:403080])

HSP 1 Score: 311.227 bits (796), Expect = 3.486e-97
Identity = 214/539 (39.70%), Postives = 308/539 (57.14%), Query Frame = 3
Query:  219 LQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRIIKYNAQRXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEMNNLKKQKDVLKNRQKAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLN---EKVLDASKSIENKSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAH-QPGLGIKEKQVVQRAKLLKNDDSVLKKEAAAHNFV------TKADLTINEGLKNVKISDVSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            L++LDP+DWK QDHYAVL L  +R  A+Q+ IK A++  +L HHPDK K    +  + +NDYFTCITKA ++L D V R ++DSVDP FD+ +PT  + KE+FF+ F PVF+RNARWS  +  P LG   +   +V  FY+FW +F SWREFSYLD+E K +A+CR+ERR+I+K N+  R ++  EE  RI ++V  A   DPRI K+  + KA KE EKKAK E K   +   E+A ++++E     + +++   +      KK+K+  K   K E++KLR   ++ NYF        +N   S+      MM  VE LC ++++  L  LNE L    +E   A L+K  +++N   +K  DA   ++ + AA  SE S       ++ W+ E  Q LIKA+N  P GT  RW  IA YMN H   G+    K V+ +AK L+  D   K E     F       +    T++  + + +   V   A  + + WT  EQK LE ALK+ P S   RW++ISE V  RSKK+C+ R+
Sbjct:   73 LKTLDPKDWKNQDHYAVLGLAHVRYKATQKQIKAAHKAMVLKHHPDKRKAAGEQIVEGDNDYFTCITKAIEILSDPVKRRAFDSVDPTFDNAVPTKAEGKENFFEVFAPVFERNARWSVKKHFPSLGTMESSFEDVDNFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQNRASRAQRKKEEMNRIRTLVDTAYNADPRIKKFKEEEKARKESEKKAKVEAKKREQEEKERARQQQEEAARLLKEQQEEAARQAAQQAKKEKEAQKKAIKKERQKLRMTCKSQNYFT-------DNEADSV-----RMMEEVEKLCDRLELISLQTLNEALSAGNKEQSKAALEKQVQEVNMQLQKEKDA--ELQAQQAARGSEHSSAAGGQNNRGWSEEDLQLLIKAVNLFPAGTNARWEVIANYMNQHSSSGVRRTAKDVINKAKTLQKLDPHQKDEINRKAFEKFKKEHSAVPPTVDNAMPSERFDAVG--ADSNAAAWTTEEQKLLEQALKTYPVSTAERWERISEAVPGRSKKDCMKRY 595          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Zebrafish
Match: dnajc2 (DnaJ (Hsp40) homolog, subfamily C, member 2 [Source:NCBI gene;Acc:403080])

HSP 1 Score: 101.679 bits (252), Expect = 7.192e-24
Identity = 74/211 (35.07%), Postives = 105/211 (49.76%), Query Frame = 3
Query: 1203 LTQLNEKLENATEEDIVAILKKTDEKLN---EKVLDASKSIENKSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAHQP-GLGIKEKQVVQRAKLLKNDDSVLKKEAAAHNF------VTKADLTINEGLKNVKISDVSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            L  LNE L    +E   A L+K  +++N   +K  DA   ++ + AA  SE S       ++ W+ E  Q LIKA+N  P GT  RW  IA YMN H   G+    K V+ +AK L+  D   K E     F       +    T++  + + +   V   A  + + WT  EQK LE ALK+ P S   RW++ISE V  RSKK+C+ R+
Sbjct:    2 LQTLNEALSAGNKEQSKAALEKQVQEVNMQLQKEKDAE--LQAQQAARGSEHSSAAGGQNNRGWSEEDLQLLIKAVNLFPAGTNARWEVIANYMNQHSSSGVRRTAKDVINKAKTLQKLDPHQKDEINRKAFEKFKKEHSAVPPTVDNAMPSERFDAVG--ADSNAAAWTTEEQKLLEQALKTYPVSTAERWERISEAVPGRSKKDCMKRY 208          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Zebrafish
Match: dnajc21 (DnaJ heat shock protein family (Hsp40) member C21 [Source:NCBI gene;Acc:336984])

HSP 1 Score: 58.5362 bits (140), Expect = 1.464e-8
Identity = 62/223 (27.80%), Postives = 95/223 (42.60%), Query Frame = 3
Query:  258 HYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYD---------SVDPEFDDDIPTL------------RDSKEDFFKFFTPVFQRNARWSKTQP---------VPMLGDENTPIAEVLR-FYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRI 833
            HY VL +K+   +AS + +K+AYRK  L  HPDK    L   ED   + F  I  A+D+L D   R  YD          V  E+ DD   L             D ++ F+  +  VF+      K             P  G+  +    V+  FY +W  F + + F++ ++    QA  R E+R ++K NK  R K   E S+ +  +V   +  D R+
Sbjct:    4 HYEVLGVKR---DASDDDLKKAYRKLALKWHPDKN---LDNAEDAA-EQFKLIQAAYDVLSDPQERAWYDNHREALLKGGVSGEYQDDSIDLVQFFTVTCYFGYGDDEKGFYAVYRNVFESIVMEEKEHSKDEEDEEDEFPSFGESESDYDTVVHLFYGYWQSFCTRKNFAWKEEYDTRQASNRWEKRAMEKENKKTRDKARKEHSELVRQLVAFVRKRDKRV 219          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Zebrafish
Match: dnajc1 (DnaJ (Hsp40) homolog, subfamily C, member 1 [Source:ZFIN;Acc:ZDB-GENE-061103-529])

HSP 1 Score: 50.447 bits (119), Expect = 5.566e-6
Identity = 20/47 (42.55%), Postives = 33/47 (70.21%), Query Frame = 3
Query: 1665 SKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            ++ +WT  +QK LE+AL+  P     RWDKI+++V  ++K+EC+ RF
Sbjct:  465 AEDVWTQNQQKLLELALQQYPRGTTERWDKIAKVVPGKTKEECMCRF 511          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Zebrafish
Match: dnajc7 (DnaJ (Hsp40) homolog, subfamily C, member 7 [Source:ZFIN;Acc:ZDB-GENE-040426-2483])

HSP 1 Score: 49.6766 bits (117), Expect = 8.339e-6
Identity = 36/104 (34.62%), Postives = 55/104 (52.88%), Query Frame = 3
Query:  228 LDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFF 539
            L+ +  K +D+Y VL + K   NA+++ IK+AYRK+ L HHPD+      + + E    F  + +AF +L D   +  YDS     DDD+    D+   F  FF
Sbjct:  401 LELKKSKRKDYYKVLGVDK---NATEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTVLSDPKKKTRYDSGHDLEDDDMNMDFDANNIFKAFF 501          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Xenopus
Match: net1 (neuroepithelial cell transforming 1 [Source:Xenbase;Acc:XB-GENE-487220])

HSP 1 Score: 221.861 bits (564), Expect = 2.424e-63
Identity = 106/210 (50.48%), Postives = 151/210 (71.90%), Query Frame = 3
Query:  204 ENHEYLQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRI 833
            E    L++LDP+DWK QDHYAVL LK +R  A+Q  IK A++  +L HHPDK K    +  + +NDYFTCITKA+++L D + R +++S+DP FD+ IP+  + K++FF  F+PVF+RN+RWS  + +P LGD N+ I EV  FY+FW +F SWREFSYLD+E K +A+CR+ERR+I+K N+  R ++  EE  RI ++V  A ++DPRI
Sbjct:   69 EEFPLLKTLDPKDWKNQDHYAVLGLKNLRYKATQRQIKAAHKAMVLKHHPDKRKAAGEQIVEGDNDYFTCITKAYEILSDPIKRRAFNSIDPTFDNSIPSKSEGKDNFFDAFSPVFERNSRWSNKKNIPKLGDMNSCIEEVDGFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQNRAARAQRKKEEMIRIRTLVDNAYSSDPRI 278          

HSP 2 Score: 88.1965 bits (217), Expect = 1.339e-17
Identity = 83/261 (31.80%), Postives = 131/261 (50.19%), Query Frame = 3
Query: 1041 KAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLNEKVLDASKSIEN--KSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAHQ-PGLGIKEKQVVQRAKLLKNDDSVLKKEAAAHNF--VTKADLTINEGLKNVKISD-VSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            K E+++LR   + +NYF       ++N  +S+     +MM  +E LC ++++  L  LNE L  +++E+  + ++K   ++N ++    +  E   K +   +E S I    G K W+ +  Q LIKA+N         W  IA YMN H   G+    K V+ +AK L+  D   K +     F    K    + + + N   S+    PA D  S WT  EQK LE ALK+ P + P RW+KI+E V  RSKK+C+ R+
Sbjct:  348 KKERQRLRTSCKNWNYF-------SDNEAESV-----KMMEEIEKLCDRLELASLQSLNESLAVSSKEEGKSAVEKQIAEVNAQLKREKEQEEARMKQSTKGAENSAIGGGSGSKSWSEDDLQLLIKAVNLIGG-----W-VIANYMNLHSISGIKRTSKDVINKAKSLQKLDPQQKDDINKKAFDKFKKEHRVVPQSVDNAVPSERFEGPAADM-SPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRSKKDCMKRY 589          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Xenopus
Match: net1 (neuroepithelial cell transforming 1 [Source:Xenbase;Acc:XB-GENE-487220])

HSP 1 Score: 221.861 bits (564), Expect = 2.661e-63
Identity = 106/210 (50.48%), Postives = 151/210 (71.90%), Query Frame = 3
Query:  204 ENHEYLQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRI 833
            E    L++LDP+DWK QDHYAVL LK +R  A+Q  IK A++  +L HHPDK K    +  + +NDYFTCITKA+++L D + R +++S+DP FD+ IP+  + K++FF  F+PVF+RN+RWS  + +P LGD N+ I EV  FY+FW +F SWREFSYLD+E K +A+CR+ERR+I+K N+  R ++  EE  RI ++V  A ++DPRI
Sbjct:   69 EEFPLLKTLDPKDWKNQDHYAVLGLKNLRYKATQRQIKAAHKAMVLKHHPDKRKAAGEQIVEGDNDYFTCITKAYEILSDPIKRRAFNSIDPTFDNSIPSKSEGKDNFFDAFSPVFERNSRWSNKKNIPKLGDMNSCIEEVDGFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQNRAARAQRKKEEMIRIRTLVDNAYSSDPRI 278          

HSP 2 Score: 109.768 bits (273), Expect = 1.733e-24
Identity = 87/261 (33.33%), Postives = 135/261 (51.72%), Query Frame = 3
Query: 1041 KAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLNEKVLDASKSIEN--KSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAHQ-PGLGIKEKQVVQRAKLLKNDDSVLKKEAAAHNF--VTKADLTINEGLKNVKISD-VSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            K E+++LR   + +NYF       ++N  +S+     +MM  +E LC ++++  L  LNE L  +++E+  + ++K   ++N ++    +  E   K +   +E S I    G K W+ +  Q LIKA+N  P GT  RW  IA YMN H   G+    K V+ +AK L+  D   K +     F    K    + + + N   S+    PA D  S WT  EQK LE ALK+ P + P RW+KI+E V  RSKK+C+ R+
Sbjct:  348 KKERQRLRTSCKNWNYF-------SDNEAESV-----KMMEEIEKLCDRLELASLQSLNESLAVSSKEEGKSAVEKQIAEVNAQLKREKEQEEARMKQSTKGAENSAIGGGSGSKSWSEDDLQLLIKAVNLFPAGTNARWEVIANYMNLHSISGIKRTSKDVINKAKSLQKLDPQQKDDINKKAFDKFKKEHRVVPQSVDNAVPSERFEGPAADM-SPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRSKKDCMKRY 595          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Xenopus
Match: net1 (neuroepithelial cell transforming 1 [Source:Xenbase;Acc:XB-GENE-487220])

HSP 1 Score: 220.705 bits (561), Expect = 3.576e-63
Identity = 106/210 (50.48%), Postives = 151/210 (71.90%), Query Frame = 3
Query:  204 ENHEYLQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRI 833
            E    L++LDP+DWK QDHYAVL LK +R  A+Q  IK A++  +L HHPDK K    +  + +NDYFTCITKA+++L D + R +++S+DP FD+ IP+  + K++FF  F+PVF+RN+RWS  + +P LGD N+ I EV  FY+FW +F SWREFSYLD+E K +A+CR+ERR+I+K N+  R ++  EE  RI ++V  A ++DPRI
Sbjct:   49 EEFPLLKTLDPKDWKNQDHYAVLGLKNLRYKATQRQIKAAHKAMVLKHHPDKRKAAGEQIVEGDNDYFTCITKAYEILSDPIKRRAFNSIDPTFDNSIPSKSEGKDNFFDAFSPVFERNSRWSNKKNIPKLGDMNSCIEEVDGFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQNRAARAQRKKEEMIRIRTLVDNAYSSDPRI 258          

HSP 2 Score: 73.9442 bits (180), Expect = 4.044e-13
Identity = 82/270 (30.37%), Postives = 125/270 (46.30%), Query Frame = 3
Query: 1041 KAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENAT-----------EEDIVAILKKTDEKLNEKVLDASKSIENKSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAHQ-PGLGIKEKQVVQRAKLLKNDDSVLKKEAAAHNF--VTKADLTINEGLKNVKISD-VSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            K E+++LR   + +NYF       ++N  +S+     +MM  +E LC ++++     L   L + T             ++ A LK+  E+   ++  ++K  EN         S I    G K W+ +  Q LIKA+N         W  IA YMN H   G+    K V+ +AK L+  D   K +     F    K    + + + N   S+    PA D  S WT  EQK LE ALK+ P + P RW+KI+E V  RSKK+C+ R+
Sbjct:  328 KKERQRLRTSCKNWNYF-------SDNEAESV-----KMMEEIEKLCDRLELASNMLLFLLLTSQTCILFYSAYMFQIAEVNAQLKREKEQEEARMKQSTKGAEN---------SAIGGGSGSKSWSEDDLQLLIKAVNLIGG-----W-VIANYMNLHSISGIKRTSKDVINKAKSLQKLDPQQKDDINKKAFDKFKKEHRVVPQSVDNAVPSERFEGPAADM-SPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRSKKDCMKRY 569          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Xenopus
Match: net1 (neuroepithelial cell transforming 1 [Source:Xenbase;Acc:XB-GENE-487220])

HSP 1 Score: 221.09 bits (562), Expect = 4.293e-63
Identity = 106/210 (50.48%), Postives = 151/210 (71.90%), Query Frame = 3
Query:  204 ENHEYLQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRI 833
            E    L++LDP+DWK QDHYAVL LK +R  A+Q  IK A++  +L HHPDK K    +  + +NDYFTCITKA+++L D + R +++S+DP FD+ IP+  + K++FF  F+PVF+RN+RWS  + +P LGD N+ I EV  FY+FW +F SWREFSYLD+E K +A+CR+ERR+I+K N+  R ++  EE  RI ++V  A ++DPRI
Sbjct:   69 EEFPLLKTLDPKDWKNQDHYAVLGLKNLRYKATQRQIKAAHKAMVLKHHPDKRKAAGEQIVEGDNDYFTCITKAYEILSDPIKRRAFNSIDPTFDNSIPSKSEGKDNFFDAFSPVFERNSRWSNKKNIPKLGDMNSCIEEVDGFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQNRAARAQRKKEEMIRIRTLVDNAYSSDPRI 278          

HSP 2 Score: 73.1738 bits (178), Expect = 7.214e-13
Identity = 82/270 (30.37%), Postives = 125/270 (46.30%), Query Frame = 3
Query: 1041 KAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENAT-----------EEDIVAILKKTDEKLNEKVLDASKSIENKSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAHQ-PGLGIKEKQVVQRAKLLKNDDSVLKKEAAAHNF--VTKADLTINEGLKNVKISD-VSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            K E+++LR   + +NYF       ++N  +S+     +MM  +E LC ++++     L   L + T             ++ A LK+  E+   ++  ++K  EN         S I    G K W+ +  Q LIKA+N         W  IA YMN H   G+    K V+ +AK L+  D   K +     F    K    + + + N   S+    PA D  S WT  EQK LE ALK+ P + P RW+KI+E V  RSKK+C+ R+
Sbjct:  348 KKERQRLRTSCKNWNYF-------SDNEAESV-----KMMEEIEKLCDRLELASNMLLFLLLTSQTCILFYSAYMFQIAEVNAQLKREKEQEEARMKQSTKGAEN---------SAIGGGSGSKSWSEDDLQLLIKAVNLIGG-----W-VIANYMNLHSISGIKRTSKDVINKAKSLQKLDPQQKDDINKKAFDKFKKEHRVVPQSVDNAVPSERFEGPAADM-SPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRSKKDCMKRY 589          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Xenopus
Match: net1 (neuroepithelial cell transforming 1 [Source:Xenbase;Acc:XB-GENE-487220])

HSP 1 Score: 220.705 bits (561), Expect = 6.083e-63
Identity = 106/210 (50.48%), Postives = 151/210 (71.90%), Query Frame = 3
Query:  204 ENHEYLQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRI 833
            E    L++LDP+DWK QDHYAVL LK +R  A+Q  IK A++  +L HHPDK K    +  + +NDYFTCITKA+++L D + R +++S+DP FD+ IP+  + K++FF  F+PVF+RN+RWS  + +P LGD N+ I EV  FY+FW +F SWREFSYLD+E K +A+CR+ERR+I+K N+  R ++  EE  RI ++V  A ++DPRI
Sbjct:   68 EEFPLLKTLDPKDWKNQDHYAVLGLKNLRYKATQRQIKAAHKAMVLKHHPDKRKAAGEQIVEGDNDYFTCITKAYEILSDPIKRRAFNSIDPTFDNSIPSKSEGKDNFFDAFSPVFERNSRWSNKKNIPKLGDMNSCIEEVDGFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQNRAARAQRKKEEMIRIRTLVDNAYSSDPRI 277          

HSP 2 Score: 73.559 bits (179), Expect = 5.314e-13
Identity = 82/270 (30.37%), Postives = 125/270 (46.30%), Query Frame = 3
Query: 1041 KAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENAT-----------EEDIVAILKKTDEKLNEKVLDASKSIENKSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAHQ-PGLGIKEKQVVQRAKLLKNDDSVLKKEAAAHNF--VTKADLTINEGLKNVKISD-VSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            K E+++LR   + +NYF       ++N  +S+     +MM  +E LC ++++     L   L + T             ++ A LK+  E+   ++  ++K  EN         S I    G K W+ +  Q LIKA+N         W  IA YMN H   G+    K V+ +AK L+  D   K +     F    K    + + + N   S+    PA D  S WT  EQK LE ALK+ P + P RW+KI+E V  RSKK+C+ R+
Sbjct:  347 KKERQRLRTSCKNWNYF-------SDNEAESV-----KMMEEIEKLCDRLELASNMLLFLLLTSQTCILFYSAYMFQIAEVNAQLKREKEQEEARMKQSTKGAEN---------SAIGGGSGSKSWSEDDLQLLIKAVNLIGG-----W-VIANYMNLHSISGIKRTSKDVINKAKSLQKLDPQQKDDINKKAFDKFKKEHRVVPQSVDNAVPSERFEGPAADM-SPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRSKKDCMKRY 588          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Mouse
Match: Dnajc2 (DnaJ heat shock protein family (Hsp40) member C2 [Source:MGI Symbol;Acc:MGI:99470])

HSP 1 Score: 318.161 bits (814), Expect = 1.282e-100
Identity = 212/534 (39.70%), Postives = 323/534 (60.49%), Query Frame = 3
Query:  219 LQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRIIKYNAQRXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEMNNLKKQKDVLKNRQKAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLNEKVLDASKSIEN--KSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAH-QPGLGIKEKQVVQRAKLLKNDDSVLKKEAAAHNF--VTKADLTINEGLKNVKISDVSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            L++LDP+DWK QDHYAVL L  +R  A+Q  IK A++  +L HHPDK K      ++ +NDYFTCITKA+++L D V R +++SVDP FD+ +P+  ++K++FF+ F+PVF+RN+RWS  + VP LGD N+   +V  FY+FW +F SWREFSYLD+E K +A+CR+ER++I+K N+  R ++  EE  RI ++V  A + DPRI K+  + KA+KE EKKAKAE + + + A EK  + E E +   + + + +++ +    KK+KD+ K   K E++KLR   +++N+       F++N     +  + +MM  VE LC ++++  L  LNE L ++T E   A L+K  E++NE++    +  +   + A+ N+E S   +  G K W+ +  Q LIKA+N  P GT  RW  IA YMN H   G+    K V+ +AK L+  D   K +     F    K     ++            P +DS + WT  EQK LE ALK+ P + P RW+KI+E V  R+KK+C+ R+
Sbjct:    2 LKTLDPKDWKNQDHYAVLGLGHVRYTATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTCITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKDNFFQVFSPVFERNSRWSNKKNVPKLGDMNSSFEDVDAFYSFWYNFDSWREFSYLDEEEKEKAECRDERKWIEKQNRATRAQRKKEEMNRIRTLVDNAYSCDPRIKKFKEEEKAKKEAEKKAKAEARRKEQEAKEKQRQAELEAVRLAKEKEEEEVRQQALLAKKEKDIQKKAIKKERQKLRNSCKSWNH-------FSDN-----EADRVKMMEEVEKLCDRLELASLQGLNEILASSTREVGKAALEKQIEEVNEQMRREKEEADARMRQASKNAEKSTGGSGSGSKNWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTAKDVISKAKSLQKLDPHQKDDINKKAFDKFKKEHGVASQADSAAPSERFEGPCIDS-TPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRTKKDCMRRY 522          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Mouse
Match: Dnajc2 (DnaJ heat shock protein family (Hsp40) member C2 [Source:MGI Symbol;Acc:MGI:99470])

HSP 1 Score: 318.161 bits (814), Expect = 1.077e-99
Identity = 212/534 (39.70%), Postives = 323/534 (60.49%), Query Frame = 3
Query:  219 LQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRIIKYNAQRXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEMNNLKKQKDVLKNRQKAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLNEKVLDASKSIEN--KSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAH-QPGLGIKEKQVVQRAKLLKNDDSVLKKEAAAHNF--VTKADLTINEGLKNVKISDVSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            L++LDP+DWK QDHYAVL L  +R  A+Q  IK A++  +L HHPDK K      ++ +NDYFTCITKA+++L D V R +++SVDP FD+ +P+  ++K++FF+ F+PVF+RN+RWS  + VP LGD N+   +V  FY+FW +F SWREFSYLD+E K +A+CR+ER++I+K N+  R ++  EE  RI ++V  A + DPRI K+  + KA+KE EKKAKAE + + + A EK  + E E +   + + + +++ +    KK+KD+ K   K E++KLR   +++N+       F++N     +  + +MM  VE LC ++++  L  LNE L ++T E   A L+K  E++NE++    +  +   + A+ N+E S   +  G K W+ +  Q LIKA+N  P GT  RW  IA YMN H   G+    K V+ +AK L+  D   K +     F    K     ++            P +DS + WT  EQK LE ALK+ P + P RW+KI+E V  R+KK+C+ R+
Sbjct:   76 LKTLDPKDWKNQDHYAVLGLGHVRYTATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTCITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKDNFFQVFSPVFERNSRWSNKKNVPKLGDMNSSFEDVDAFYSFWYNFDSWREFSYLDEEEKEKAECRDERKWIEKQNRATRAQRKKEEMNRIRTLVDNAYSCDPRIKKFKEEEKAKKEAEKKAKAEARRKEQEAKEKQRQAELEAVRLAKEKEEEEVRQQALLAKKEKDIQKKAIKKERQKLRNSCKSWNH-------FSDN-----EADRVKMMEEVEKLCDRLELASLQGLNEILASSTREVGKAALEKQIEEVNEQMRREKEEADARMRQASKNAEKSTGGSGSGSKNWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTAKDVISKAKSLQKLDPHQKDDINKKAFDKFKKEHGVASQADSAAPSERFEGPCIDS-TPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRTKKDCMRRY 596          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Mouse
Match: Dnajc2 (DnaJ heat shock protein family (Hsp40) member C2 [Source:MGI Symbol;Acc:MGI:99470])

HSP 1 Score: 317.775 bits (813), Expect = 1.448e-99
Identity = 212/534 (39.70%), Postives = 323/534 (60.49%), Query Frame = 3
Query:  219 LQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRIIKYNAQRXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEMNNLKKQKDVLKNRQKAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLNEKVLDASKSIEN--KSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAH-QPGLGIKEKQVVQRAKLLKNDDSVLKKEAAAHNF--VTKADLTINEGLKNVKISDVSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            L++LDP+DWK QDHYAVL L  +R  A+Q  IK A++  +L HHPDK K      ++ +NDYFTCITKA+++L D V R +++SVDP FD+ +P+  ++K++FF+ F+PVF+RN+RWS  + VP LGD N+   +V  FY+FW +F SWREFSYLD+E K +A+CR+ER++I+K N+  R ++  EE  RI ++V  A + DPRI K+  + KA+KE EKKAKAE + + + A EK  + E E +   + + + +++ +    KK+KD+ K   K E++KLR   +++N+       F++N     +  + +MM  VE LC ++++  L  LNE L ++T E   A L+K  E++NE++    +  +   + A+ N+E S   +  G K W+ +  Q LIKA+N  P GT  RW  IA YMN H   G+    K V+ +AK L+  D   K +     F    K     ++            P +DS + WT  EQK LE ALK+ P + P RW+KI+E V  R+KK+C+ R+
Sbjct:   76 LKTLDPKDWKNQDHYAVLGLGHVRYTATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTCITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKDNFFQVFSPVFERNSRWSNKKNVPKLGDMNSSFEDVDAFYSFWYNFDSWREFSYLDEEEKEKAECRDERKWIEKQNRATRAQRKKEEMNRIRTLVDNAYSCDPRIKKFKEEEKAKKEAEKKAKAEARRKEQEAKEKQRQAELEAVRLAKEKEEEEVRQQALLAKKEKDIQKKAIKKERQKLRNSCKSWNH-------FSDN-----EADRVKMMEEVEKLCDRLELASLQGLNEILASSTREVGKAALEKQIEEVNEQMRREKEEADARMRQASKNAEKSTGGSGSGSKNWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTAKDVISKAKSLQKLDPHQKDDINKKAFDKFKKEHGVASQADSAAPSERFEGPCIDS-TPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRTKKDCMRRY 596          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Mouse
Match: Dnajc2 (DnaJ heat shock protein family (Hsp40) member C2 [Source:MGI Symbol;Acc:MGI:99470])

HSP 1 Score: 138.658 bits (348), Expect = 2.287e-37
Identity = 59/116 (50.86%), Postives = 87/116 (75.00%), Query Frame = 3
Query:  219 LQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNAR 566
            L++LDP+DWK QDHYAVL L  +R  A+Q  IK A++  +L HHPDK K      ++ +NDYFTCITKA+++L D V R +++SVDP FD+ +P+  ++K++FF+ F+PVF+RN+R
Sbjct:   76 LKTLDPKDWKNQDHYAVLGLGHVRYTATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTCITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKDNFFQVFSPVFERNSR 191          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Mouse
Match: Dnajc21 (DnaJ heat shock protein family (Hsp40) member C21 [Source:MGI Symbol;Acc:MGI:1925371])

HSP 1 Score: 61.2326 bits (147), Expect = 2.238e-9
Identity = 60/221 (27.15%), Postives = 94/221 (42.53%), Query Frame = 3
Query:  258 HYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYD---------SVDPEFDDDIPTL------------RDSKEDFFKFFTPVFQRNARW-------SKTQPVPMLGDENTPIAEVLR-FYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRI 833
            HY  L    +R +AS+E +K+AYRK  L  HPDK          E  + F  I  A+D+L D   R  YD          +D E+ DD   L             D +  F+  +  VF+  A+           +  P  GD  +    V+  FY  W  F + + FS+ ++    QA  R E+R ++K NK  R +   E+++ +  +V   +  D R+
Sbjct:    4 HYEAL---GVRRDASEEELKKAYRKLALRWHPDKNLDNAA----EAAEQFKLIQAAYDVLSDPQERAWYDNHREALLKGGLDGEYQDDSLDLLHYFTVTCYSGYGDDERGFYAVYRVVFELIAKEELECMSEGDVEDFPTFGDSQSDYDTVVHPFYAHWQSFCTQKNFSWKEEYDTRQASNRWEKRAMEKENKKIRDRARKEKNELVRQLVAFIRKRDKRV 217          
BLAST of DnaJ homolog subfamily C member 2 vs. UniProt/SwissProt
Match: sp|Q1RMH9|DNJC2_BOVIN (DnaJ homolog subfamily C member 2 OS=Bos taurus OX=9913 GN=DNAJC2 PE=2 SV=1)

HSP 1 Score: 333.183 bits (853), Expect = 1.220e-104
Identity = 216/541 (39.93%), Postives = 322/541 (59.52%), Query Frame = 3
Query:  219 LQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRIIKYNAQRXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEMNNLKKQKDVLKNRQKAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLNEKVLDASKSIEN--KSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAH-QPGLGIKEKQVVQRAKLLKNDD---------SVLKKEAAAHNFVTKADLTINEGLKNVKISDVSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            L++LDP+DWK QDHYAVL L  +R  A+Q  IK A++  +L HHPDK K      ++ +NDYFTCITKA+++L D V R +++SVDP FD+ +P+  ++K++FF+ F+PVF+RN+RWS  + VP LGD N+   +V  FY+FW +F SWREFSYLD+E K +A+CR+ERR+I+K N+  R ++  EE  RI ++V  A + DPRI K+  + KA+KE EKKAKA+ K + + A EK  + E E     + + + +++ +    KK+KD+ K   K E++KLR L +T+N+F  +            + ++ +MM  VE LC ++++  L  LNE L ++T+E   A L+K  E++NE++    +  E   + A+ N+E S      G K W+ +  Q LIKA+N  P GT  RW  IA YMN H   G+    K V+ +AK L+  D             K    H  V +AD        N   S+  +      + WT  EQK LE ALK+ P + P RW+KI+E V  R+KK+C+ R+
Sbjct:   76 LKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTCITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKDNFFEVFSPVFERNSRWSNKKNVPKLGDMNSSFEDVDAFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQNRATRAQRKKEEMNRIRTLVDNAYSCDPRIKKFKEEEKAKKEAEKKAKADAKRKEQEAKEKQRQAELEAARLAKEKEEEEVRQQALLAKKEKDIQKKAIKKERQKLRNLCKTWNHFSDS------------EAERVKMMEEVEKLCDRLELSSLQCLNETLTSSTKEVGKAALEKQIEEINEQIRKEKEEAEARMRQASKNAEKSAGGGGNGSKHWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTAKDVIGKAKSLQKLDPHQKDDINKKAFDKFKKEHGVVPQAD--------NATPSERFEGPCTDFTPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRTKKDCMKRY 596          
BLAST of DnaJ homolog subfamily C member 2 vs. UniProt/SwissProt
Match: sp|Q99543|DNJC2_HUMAN (DnaJ homolog subfamily C member 2 OS=Homo sapiens OX=9606 GN=DNAJC2 PE=1 SV=4)

HSP 1 Score: 327.405 bits (838), Expect = 1.678e-102
Identity = 218/541 (40.30%), Postives = 322/541 (59.52%), Query Frame = 3
Query:  219 LQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRIIKYNAQRXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEMNNLKKQKDVLKNRQKAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLNEKVLDASKSIEN--KSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAH-QPGLGIKEKQVVQRAKLLKNDD---------SVLKKEAAAHNFVTKADLTINEGLKNVKISDVSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            L++LDP+DWK QDHYAVL L  +R  A+Q  IK A++  +L HHPDK K      ++ +NDYFTCITKA+++L D V R +++SVDP FD+ +P+  ++K++FF+ FTPVF+RN+RWS  + VP LGD N+   +V  FY+FW +F SWREFSYLD+E K +A+CR+ERR+I+K N+  R ++  EE  RI ++V  A + DPRI K+  + KA+KE EKKAKAE K + + A EK  + E E     + + + +++ +    KK+KD+ K   K E++KLR   +T+N+       F++N     + ++ +MM  VE LC ++++  L  LNE L + T+E   A L+K  E++NE++    +  E   + A+ N+E S      G K W+ +  Q LIKA+N  P GT  RW  IA YMN H   G+    K V+ +AK L+  D             K    H  V +AD        N   S+  +      + WT  EQK LE ALK+ P + P RW+KI+E V  R+KK+C+ R+
Sbjct:   76 LKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTCITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKDNFFEVFTPVFERNSRWSNKKNVPKLGDMNSSFEDVDIFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQNRATRAQRKKEEMNRIRTLVDNAYSCDPRIKKFKEEEKAKKEAEKKAKAEAKRKEQEAKEKQRQAELEAARLAKEKEEEEVRQQALLAKKEKDIQKKAIKKERQKLRNSCKTWNH-------FSDN-----EAERVKMMEEVEKLCDRLELASLQCLNETLTSCTKEVGKAALEKQIEEINEQIRKEKEEAEARMRQASKNTEKSTGGGGNGSKNWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTAKDVIGKAKSLQKLDPHQKDDINKKAFDKFKKEHGVVPQAD--------NATPSERFEGPYTDFTPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRTKKDCMKRY 596          
BLAST of DnaJ homolog subfamily C member 2 vs. UniProt/SwissProt
Match: sp|Q4R8H2|DNJC2_MACFA (DnaJ homolog subfamily C member 2 OS=Macaca fascicularis OX=9541 GN=DNAJC2 PE=2 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 5.120e-102
Identity = 217/541 (40.11%), Postives = 322/541 (59.52%), Query Frame = 3
Query:  219 LQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRIIKYNAQRXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEMNNLKKQKDVLKNRQKAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLNEKVLDASKSIEN--KSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAH-QPGLGIKEKQVVQRAKLLKNDD---------SVLKKEAAAHNFVTKADLTINEGLKNVKISDVSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            L++LDP+DWK QDHYAVL L  +R  A+Q  IK A++  +L HHPDK K      ++ +NDYFTCITKA+++L D V R +++SVDP FD+ +P+  ++K++FF+ F+PVF+RN+RWS  + VP LGD N+   +V  FY+FW +F SWREFSYLD+E K +A+CR+ERR+I+K N+  R ++  EE  RI ++V  A + DPRI K+  + KA+KE EKKAKAE K + + A EK  + E E     + + + +++ +    KK+KD+ K   K E++KLR   +T+N+       F++N     + ++ +MM  VE LC ++++  L  LNE L + T+E   A L+K  E++NE++    +  E   + A+ N+E S      G K W+ +  Q LIKA+N  P GT  RW  IA YMN H   G+    K V+ +AK L+  D             K    H  V +AD        N   S+  +      + WT  EQK LE ALK+ P + P RW+KI+E V  R+KK+C+ R+
Sbjct:   76 LKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTCITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKDNFFEVFSPVFERNSRWSNKKNVPKLGDMNSSFEDVDIFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQNRATRAQRKKEEMNRIRTLVDNAYSCDPRIKKFKEEEKAKKEAEKKAKAEAKRKEQEAKEKQRQAELEAARLAKEKEEEEVRQQALLAKKEKDLQKKAIKKERQKLRNSCKTWNH-------FSDN-----EAERVKMMEEVEKLCDRLELASLQCLNETLTSCTKEVGKAALEKQIEEINEQIRKEKEEAEAHMRQASKNTEKSAGGGGNGSKNWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTAKDVIGKAKSLQKLDPHQKDDINKKAFDKFKKEHGVVPQAD--------NAAPSERFEGPYTDFTPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRTKKDCMKRY 596          
BLAST of DnaJ homolog subfamily C member 2 vs. UniProt/SwissProt
Match: sp|P54103|DNJC2_MOUSE (DnaJ homolog subfamily C member 2 OS=Mus musculus OX=10090 GN=Dnajc2 PE=1 SV=2)

HSP 1 Score: 317.775 bits (813), Expect = 1.013e-98
Identity = 212/534 (39.70%), Postives = 323/534 (60.49%), Query Frame = 3
Query:  219 LQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRIIKYNAQRXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEMNNLKKQKDVLKNRQKAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLNEKVLDASKSIEN--KSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAH-QPGLGIKEKQVVQRAKLLKNDDSVLKKEAAAHNF--VTKADLTINEGLKNVKISDVSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            L++LDP+DWK QDHYAVL L  +R  A+Q  IK A++  +L HHPDK K      ++ +NDYFTCITKA+++L D V R +++SVDP FD+ +P+  ++K++FF+ F+PVF+RN+RWS  + VP LGD N+   +V  FY+FW +F SWREFSYLD+E K +A+CR+ER++I+K N+  R ++  EE  RI ++V  A + DPRI K+  + KA+KE EKKAKAE + + + A EK  + E E +   + + + +++ +    KK+KD+ K   K E++KLR   +++N+       F++N     +  + +MM  VE LC ++++  L  LNE L ++T E   A L+K  E++NE++    +  +   + A+ N+E S   +  G K W+ +  Q LIKA+N  P GT  RW  IA YMN H   G+    K V+ +AK L+  D   K +     F    K     ++            P +DS + WT  EQK LE ALK+ P + P RW+KI+E V  R+KK+C+ R+
Sbjct:   76 LKTLDPKDWKNQDHYAVLGLGHVRYTATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTCITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKDNFFQVFSPVFERNSRWSNKKNVPKLGDMNSSFEDVDAFYSFWYNFDSWREFSYLDEEEKEKAECRDERKWIEKQNRATRAQRKKEEMNRIRTLVDNAYSCDPRIKKFKEEEKAKKEAEKKAKAEARRKEQEAKEKQRQAELEAVRLAKEKEEEEVRQQALLAKKEKDIQKKAIKKERQKLRNSCKSWNH-------FSDN-----EADRVKMMEEVEKLCDRLELASLQGLNEILASSTREVGKAALEKQIEEVNEQMRREKEEADARMRQASKNAEKSTGGSGSGSKNWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTAKDVISKAKSLQKLDPHQKDDINKKAFDKFKKEHGVASQADSAAPSERFEGPCIDS-TPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRTKKDCMRRY 596          
BLAST of DnaJ homolog subfamily C member 2 vs. UniProt/SwissProt
Match: sp|Q7TQ20|DNJC2_RAT (DnaJ homolog subfamily C member 2 OS=Rattus norvegicus OX=10116 GN=Dnajc2 PE=1 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 1.126e-98
Identity = 211/534 (39.51%), Postives = 319/534 (59.74%), Query Frame = 3
Query:  219 LQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRIIKYNAQRXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEMNNLKKQKDVLKNRQKAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLNEKVLDASKSIEN--KSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAH-QPGLGIKEKQVVQRAKLLKNDDSVLKKEAAAHNF--VTKADLTINEGLKNVKISDVSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            L++LDP+DWK QDHYAVL L  +R  A+Q  IK A++  +L HHPDK K      ++ +NDYFTCITKA+++L D V R +++SVDP FD+ +P+  ++KE+FF+ F+PVF+RN+RWS  + VP LGD N+   +V  FY+FW +F SWREFSYLD+E K +A+CR+ER++I+K N+  R ++  EE  RI ++V  A + DPRI K+  + KA+KE EK+AKAE + + + A EK  + E E +   + + + +++ +    KK+K++ K   K E++KLR   + +N+       F++N     +  + +MM  VE LC ++++  L  LNE L ++T E   A L+K  E++NE +    +  +   + A+ N+E S   +  G K W+ +  Q LIKA+N  P GT  RW  IA YMN H   G+    K V+ +AK L+  D   K +     F    K      +            P +DS   WT  EQK LE ALK+ P + P RW+KI+E V  R+KK+C+ R+
Sbjct:   76 LKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKTMVLKHHPDKRKAAGEPIKEGDNDYFTCITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKENFFQVFSPVFERNSRWSNKKNVPKLGDMNSSFEDVDAFYSFWYNFDSWREFSYLDEEEKEKAECRDERKWIEKQNRATRAQRKKEEMNRIRTLVDNAYSCDPRIKKFKEEGKAKKEAEKRAKAEARRKEQEAKEKQRQAELEAVRLAKEKEEEEVRQQALLAKKEKEIQKKAIKKERQKLRNSCKNWNH-------FSDN-----EADRVKMMEEVEKLCDRLELASLQCLNEILASSTREVGKAALEKQIEEVNELMRKEKEEADARMRQASKNAEKSTGGSGSGSKNWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTAKDVIGKAKSLQKLDPHQKDDINKKAFDKFKKEHGVAPQADSAAPSERFEGPCIDS-IPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRTKKDCMRRY 596          
BLAST of DnaJ homolog subfamily C member 2 vs. TrEMBL
Match: A0A4W2GYJ2 (Uncharacterized protein OS=Bos indicus x Bos taurus OX=30522 GN=DNAJC2 PE=4 SV=1)

HSP 1 Score: 333.183 bits (853), Expect = 3.617e-102
Identity = 216/541 (39.93%), Postives = 322/541 (59.52%), Query Frame = 3
Query:  219 LQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRIIKYNAQRXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEMNNLKKQKDVLKNRQKAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLNEKVLDASKSIEN--KSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAH-QPGLGIKEKQVVQRAKLLKNDD---------SVLKKEAAAHNFVTKADLTINEGLKNVKISDVSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            L++LDP+DWK QDHYAVL L  +R  A+Q  IK A++  +L HHPDK K      ++ +NDYFTCITKA+++L D V R +++SVDP FD+ +P+  ++K++FF+ F+PVF+RN+RWS  + VP LGD N+   +V  FY+FW +F SWREFSYLD+E K +A+CR+ERR+I+K N+  R ++  EE  RI ++V  A + DPRI K+  + KA+KE EKKAKA+ K + + A EK  + E E     + + + +++ +    KK+KD+ K   K E++KLR L +T+N+F  +            + ++ +MM  VE LC ++++  L  LNE L ++T+E   A L+K  E++NE++    +  E   + A+ N+E S      G K W+ +  Q LIKA+N  P GT  RW  IA YMN H   G+    K V+ +AK L+  D             K    H  V +AD        N   S+  +      + WT  EQK LE ALK+ P + P RW+KI+E V  R+KK+C+ R+
Sbjct:   76 LKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTCITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKDNFFEVFSPVFERNSRWSNKKNVPKLGDMNSSFEDVDAFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQNRATRAQRKKEEMNRIRTLVDNAYSCDPRIKKFKEEEKAKKEAEKKAKADAKRKEQEAKEKQRQAELEAARLAKEKEEEEVRQQALLAKKEKDIQKKAIKKERQKLRNLCKTWNHFSDS------------EAERVKMMEEVEKLCDRLELSSLQCLNETLTSSTKEVGKAALEKQIEEINEQIRKEKEEAEARMRQASKNAEKSAGGGGNGSKHWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTAKDVIGKAKSLQKLDPHQKDDINKKAFDKFKKEHGVVPQAD--------NATPSERFEGPCTDFTPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRTKKDCMKRY 596          
BLAST of DnaJ homolog subfamily C member 2 vs. TrEMBL
Match: L8INR2 (DnaJ-like protein subfamily C member 2 OS=Bos mutus OX=72004 GN=M91_11964 PE=4 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 6.158e-102
Identity = 216/541 (39.93%), Postives = 322/541 (59.52%), Query Frame = 3
Query:  219 LQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRIIKYNAQRXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEMNNLKKQKDVLKNRQKAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLNEKVLDASKSIEN--KSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAH-QPGLGIKEKQVVQRAKLLKNDD---------SVLKKEAAAHNFVTKADLTINEGLKNVKISDVSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            L++LDP+DWK QDHYAVL L  +R  A+Q  IK A++  +L HHPDK K      ++ +NDYFTCITKA+++L D V R +++SVDP FD+ +P+  ++K++FF+ F+PVF+RN+RWS  + VP LGD N+   +V  FY+FW +F SWREFSYLD+E K +A+CR+ERR+I+K N+  R ++  EE  RI ++V  A + DPRI K+  + KA+KE EKKAKA+ K + + A EK  + E E     + + + +++ +    KK+KD+ K   K E++KLR L +T+N+F  +            + ++ +MM  VE LC ++++  L  LNE L ++T+E   A L+K  E++NE++    +  E   + A+ N+E S      G K W+ +  Q LIKA+N  P GT  RW  IA YMN H   G+    K V+ +AK L+  D             K    H  V +AD        N   S+  +      + WT  EQK LE ALK+ P + P RW+KI+E V  R+KK+C+ R+
Sbjct:   76 LKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTCITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKDNFFEVFSPVFERNSRWSNKKNVPKLGDMNSSFEDVDAFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQNRATRAQRKKEEMNRIRTLVDNAYSCDPRIKKFKEEEKAKKEAEKKAKADAKRKEQEAKEKQRQAELEAARLAKEKEEEEVRQQALLAKKEKDIQKKAIKKERQKLRNLCKTWNHFSDS------------EAERVKMMEEVEKLCDRLELASLQCLNETLTSSTKEVGKAALEKQIEEINEQIRKEKEEAEARMRQASKNAEKSAGGGGNGSKHWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTAKDVIGKAKSLQKLDPHQKDDINKKAFDKFKKEHGVVPQAD--------NATPSERFEGPCTDFTPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRTKKDCMKRY 596          
BLAST of DnaJ homolog subfamily C member 2 vs. TrEMBL
Match: A0A383ZQK9 (dnaJ homolog subfamily C member 2 isoform X2 OS=Balaenoptera acutorostrata scammoni OX=310752 GN=DNAJC2 PE=4 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 1.827e-101
Identity = 217/541 (40.11%), Postives = 323/541 (59.70%), Query Frame = 3
Query:  219 LQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRIIKYNAQRXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEMNNLKKQKDVLKNRQKAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLNEKVLDASKSIEN--KSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAH-QPGLGIKEKQVVQRAKLLKNDD---------SVLKKEAAAHNFVTKADLTINEGLKNVKISDVSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            L++LDP+DWK QDHYAVL L  +R  A+Q  IK A++  +L HHPDK K      ++ +NDYFTCITKA+++L D V R +++SVDP FD+ +P+  ++K++FF+ F+PVF+RN+RWS  + VP LGD N+   +V  FY+FW +F SWREFSYLD+E K +A+CR+ERR+I+K N+  R ++  EE  RI ++V  A + DPRI K+  + KA+KE EKKAKAE K + + A EK  + E E     + + + +++ +    KK+KD+ K   K E++KLR   +T+N+       F++N     + ++ +MM  VE LC ++++  L  LNE L ++T+E   A L+K  E++NE++    +  E   + A+ N+E S      G K W+ +  Q LIKA+N  P GT  RW  IA YMN H   G+    K V+ +AK L+  D             K    H  V +AD        N   S+  +      + WT  EQK LE ALK+ P + P RW+KI+E V  R+KK+C+ R+
Sbjct:    2 LKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTCITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKDNFFEVFSPVFERNSRWSNKKNVPKLGDRNSSFEDVDAFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQNRATRAQRKKEEMNRIRTLVDNAYSCDPRIKKFKEEEKAKKEAEKKAKAEAKRKEQEAKEKQRQAELEAARLAKEKEEEEVRQQALLAKKEKDIQKKAIKKERQKLRNSCKTWNH-------FSDN-----EAERVKMMEEVEKLCDRLELASLQCLNETLTSSTKEVGKAALEKQIEEINEQIRKEKEEAEARMRQASKNAEKSTGGGGNGSKHWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTAKDVIGKAKSLQKLDPHQKDDINKKAFDKFKKEHGVVCQAD--------NATPSERFEGPCTDFTPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRTKKDCMKRY 522          
BLAST of DnaJ homolog subfamily C member 2 vs. TrEMBL
Match: A0A2Y9FS09 (dnaJ homolog subfamily C member 2 isoform X2 OS=Physeter macrocephalus OX=9755 GN=DNAJC2 PE=4 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 3.393e-101
Identity = 217/541 (40.11%), Postives = 323/541 (59.70%), Query Frame = 3
Query:  219 LQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRIIKYNAQRXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEMNNLKKQKDVLKNRQKAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLNEKVLDASKSIEN--KSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAH-QPGLGIKEKQVVQRAKLLKNDD---------SVLKKEAAAHNFVTKADLTINEGLKNVKISDVSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            L++LDP+DWK QDHYAVL L  +R  A+Q  IK A++  +L HHPDK K      ++ +NDYFTCITKA+++L D V R +++SVDP FD+ +P+  ++K++FF+ F+PVF+RN+RWS  + VP LGD N+   +V  FY+FW +F SWREFSYLD+E K +A+CR+ERR+I+K N+  R ++  EE  RI ++V  A + DPRI K+  + KA+KE EKKAKAE K + + A EK  + E E     + + + +++ +    KK+KD+ K   K E++KLR   +T+N+       F++N     + ++ +MM  VE LC ++++  L  LNE L ++T+E   A L+K  E++NE++    +  E   + A+ N+E S      G K W+ +  Q LIKA+N  P GT  RW  IA YMN H   G+    K V+ +AK L+  D             K    H  V +AD        N   S+  +      + WT  EQK LE ALK+ P + P RW+KI+E V  R+KK+C+ R+
Sbjct:    2 LKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTCITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKDNFFEVFSPVFERNSRWSNKKNVPKLGDMNSSFEDVDAFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQNRATRAQRKKEEMNRIRTLVDNAYSCDPRIKKFKEEEKAKKEAEKKAKAEAKRKEQEAKEKQRQAELEAARLAKEKEEEEVRQQALLAKKEKDIQKKAIKKERQKLRNSCKTWNH-------FSDN-----EAERVKMMEEVEKLCDRLELASLQCLNETLTSSTKEVGKAALEKQIEEINEQIRKEKEEAEARMRQASKNAEKSTGGGGNGSKHWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTAKDVIGKAKSLQKLDPHQKDDINKKAFDKFKKEHGVVCQAD--------NATPSERFEGPCTDFTPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRTKKDCMKRY 522          
BLAST of DnaJ homolog subfamily C member 2 vs. TrEMBL
Match: A0A2Y9LKP4 (dnaJ homolog subfamily C member 2 isoform X2 OS=Delphinapterus leucas OX=9749 GN=DNAJC2 PE=4 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 4.068e-101
Identity = 217/541 (40.11%), Postives = 323/541 (59.70%), Query Frame = 3
Query:  219 LQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRIIKYNAQRXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEMNNLKKQKDVLKNRQKAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLNEKVLDASKSIEN--KSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAH-QPGLGIKEKQVVQRAKLLKNDD---------SVLKKEAAAHNFVTKADLTINEGLKNVKISDVSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            L++LDP+DWK QDHYAVL L  +R  A+Q  IK A++  +L HHPDK K      ++ +NDYFTCITKA+++L D V R +++SVDP FD+ +P+  ++K++FF+ F+PVF+RN+RWS  + VP LGD N+   +V  FY+FW +F SWREFSYLD+E K +A+CR+ERR+I+K N+  R ++  EE  RI ++V  A + DPRI K+  + KA+KE EKKAKAE K + + A EK  + E E     + + + +++ +    KK+KD+ K   K E++KLR   +T+N+       F++N     + ++ +MM  VE LC ++++  L  LNE L ++T+E   A L+K  E++NE++    +  E   + A+ N+E S      G K W+ +  Q LIKA+N  P GT  RW  IA YMN H   G+    K V+ +AK L+  D             K    H  V +AD        N   S+  +      + WT  EQK LE ALK+ P + P RW+KI+E V  R+KK+C+ R+
Sbjct:    2 LKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTCITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKDNFFEVFSPVFERNSRWSNKKNVPKLGDMNSSFEDVDAFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQNRATRAQRKKEEMNRIRTLVDNAYSCDPRIKKFKEEEKAKKEAEKKAKAEAKRKEQEAKEKQRQAELEAARLAKEKEEEEVRQQALLAKKEKDIQKKAIKKERQKLRNSCKTWNH-------FSDN-----EAERVKMMEEVEKLCDRLELASLQCLNETLTSSTKEVGKAALEKQIEEINEQIRKEKEEAEARMRQASKNAEKSTGGGGNGSKHWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTAKDVIGKAKSLQKLDPHQKDDINRKAFDKFKKEHGVVCQAD--------NATPSERFEGPCTDFTPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRTKKDCMKRY 522          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Cavefish
Match: dnajc2 (DnaJ heat shock protein family (Hsp40) member C2 [Source:NCBI gene;Acc:103027329])

HSP 1 Score: 304.294 bits (778), Expect = 1.282e-94
Identity = 212/539 (39.33%), Postives = 305/539 (56.59%), Query Frame = 3
Query:  219 LQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRIIKYNAQRXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEMNNLKKQKDVLKNRQKAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLNEKVLDASKSIENKSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAH-QPGLGIKEKQVVQRAKLLKNDDSVLKKEA---------AAHNFVTKADLTINEGLKNVKISDVSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            L++LDP+DWK QDHYAVL L  +R  A+Q+ IK A++  +L HHPDK K    +    +NDYFTCITKA ++L D V R ++DSVDP F++ +P+  + KE+FF+ F PVF+RNARWS  + VP LG       +V  FY+FW +F SWREFSYLD+E K +A+CR+ERR+I+K N+  R ++  EE  RI ++V  A + DPRI K+  + KA KE EKKA+AE K + +   E+A + E +       + + + K      KK+KD  K   K EK+KLR   +  NYFV +            + +  +MM  VE LC ++++  L  LNE L ++ +E+  + ++K  +++N ++    ++      +  S         G K W  E  Q LIKA+N  P GT  RW  IA YMN H   G+    K V+ +AK L+  D   K E            H  V     T++  + + +  DVS    DS + WT  EQK LE ALK+ P + P RWDKI+  V  RSKK+C+ R+
Sbjct:   73 LKTLDPKDWKNQDHYAVLGLAHVRYKATQKQIKAAHKAMVLKHHPDKRKAAGEQIVKGDNDYFTCITKAIEILSDPVKRRAFDSVDPTFENAVPSKAEGKENFFEVFAPVFERNARWSTKKHVPKLGSMEASFEDVDNFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQNRASRAQRKKEEMNRIRTLVDTAYSCDPRIKKFKEEEKARKESEKKARAEAKKKEQEEKERARQAELDAARLAREKEEEEAKQAAQLAKKEKDAQKKAIKKEKQKLRTTCKNCNYFVDS------------EAETVKMMEDVEKLCDRLELVRLQNLNEALASSNKEESRSAIEKQVQEVNAQIQREREAELKAHQSARSLDQASTGTGGGKGWNEEDLQLLIKAVNLFPAGTNARWEVIANYMNMHSSSGIKRTAKDVINKAKTLQKLDPHQKDEVNKKAFEKFKKEHAAVPP---TVDNAVPSERF-DVS----DS-TPWTTEEQKLLEQALKTYPVNTPERWDKIAAAVPGRSKKDCMKRY 590          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Cavefish
Match: dnajc2 (DnaJ heat shock protein family (Hsp40) member C2 [Source:NCBI gene;Acc:103027329])

HSP 1 Score: 303.523 bits (776), Expect = 2.368e-94
Identity = 212/539 (39.33%), Postives = 305/539 (56.59%), Query Frame = 3
Query:  219 LQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRIIKYNAQRXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEMNNLKKQKDVLKNRQKAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLNEKVLDASKSIENKSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAH-QPGLGIKEKQVVQRAKLLKNDDSVLKKEA---------AAHNFVTKADLTINEGLKNVKISDVSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            L++LDP+DWK QDHYAVL L  +R  A+Q+ IK A++  +L HHPDK K    +    +NDYFTCITKA ++L D V R ++DSVDP F++ +P+  + KE+FF+ F PVF+RNARWS  + VP LG       +V  FY+FW +F SWREFSYLD+E K +A+CR+ERR+I+K N+  R ++  EE  RI ++V  A + DPRI K+  + KA KE EKKA+AE K + +   E+A + E +       + + + K      KK+KD  K   K EK+KLR   +  NYFV +            + +  +MM  VE LC ++++  L  LNE L ++ +E+  + ++K  +++N ++    ++      +  S         G K W  E  Q LIKA+N  P GT  RW  IA YMN H   G+    K V+ +AK L+  D   K E            H  V     T++  + + +  DVS    DS + WT  EQK LE ALK+ P + P RWDKI+  V  RSKK+C+ R+
Sbjct:   73 LKTLDPKDWKNQDHYAVLGLAHVRYKATQKQIKAAHKAMVLKHHPDKRKAAGEQIVKGDNDYFTCITKAIEILSDPVKRRAFDSVDPTFENAVPSKAEGKENFFEVFAPVFERNARWSTKKHVPKLGSMEASFEDVDNFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQNRASRAQRKKEEMNRIRTLVDTAYSCDPRIKKFKEEEKARKESEKKARAEAKKKEQEEKERARQAELDAARLAREKEEEEAKQAAQLAKKEKDAQKKAIKKEKQKLRTTCKNCNYFVDS------------EAETVKMMEDVEKLCDRLELVRLQNLNEALASSNKEESRSAIEKQVQEVNAQIQREREAELKAHQSARSLDQASTGTGGGKGWNEEDLQLLIKAVNLFPAGTNARWEVIANYMNMHSSSGIKRTAKDVINKAKTLQKLDPHQKDEVNKKAFEKFKKEHAAVPP---TVDNAVPSERF-DVS----DS-TPWTTEEQKLLEQALKTYPVNTPERWDKIAAAVPGRSKKDCMKRY 590          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Cavefish
Match: dnajc21 (DnaJ heat shock protein family (Hsp40) member C21 [Source:NCBI gene;Acc:103035933])

HSP 1 Score: 56.6102 bits (135), Expect = 4.967e-8
Identity = 60/223 (26.91%), Postives = 97/223 (43.50%), Query Frame = 3
Query:  258 HYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYD---------SVDPEFDDDIPTL------------RDSKEDFFKFFTPVFQRNAR----WSKTQP-----VPMLGDENTPIAEVLR-FYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRI 833
            HY VL +++    A+ + +K+AYRK  L  HPDK  +      +E  + F  I  A+D++ D   R  YD          V  E+ DD   L             D ++ F+  +  +F+  A+     SK +       P  GD  +    V+  FY  W  F + + F++ ++    QA  R ERR ++K NK  R K   E S+ +  +V   +  D R+
Sbjct:    4 HYEVLGVQR---EATDDDVKKAYRKLALKWHPDKNLENA----EEAAEQFKLIQAAYDVISDPQERAWYDNHRDALLKGGVSGEYQDDSIDLVQYFTVTCYSGYGDDEKGFYTVYRNLFESIAKEEMEHSKEEDDECDDFPTFGDSESDYDTVVHLFYGCWQSFCTRKNFAWKEEYDTRQASNRWERRAMEKENKKTRDKARKERSELVRQLVAFVRKRDRRV 219          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Cavefish
Match: dnajc21 (DnaJ heat shock protein family (Hsp40) member C21 [Source:NCBI gene;Acc:103035933])

HSP 1 Score: 56.6102 bits (135), Expect = 4.967e-8
Identity = 60/223 (26.91%), Postives = 97/223 (43.50%), Query Frame = 3
Query:  258 HYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYD---------SVDPEFDDDIPTL------------RDSKEDFFKFFTPVFQRNAR----WSKTQP-----VPMLGDENTPIAEVLR-FYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRI 833
            HY VL +++    A+ + +K+AYRK  L  HPDK  +      +E  + F  I  A+D++ D   R  YD          V  E+ DD   L             D ++ F+  +  +F+  A+     SK +       P  GD  +    V+  FY  W  F + + F++ ++    QA  R ERR ++K NK  R K   E S+ +  +V   +  D R+
Sbjct:    4 HYEVLGVQR---EATDDDVKKAYRKLALKWHPDKNLENA----EEAAEQFKLIQAAYDVISDPQERAWYDNHRDALLKGGVSGEYQDDSIDLVQYFTVTCYSGYGDDEKGFYTVYRNLFESIAKEEMEHSKEEDDECDDFPTFGDSESDYDTVVHLFYGCWQSFCTRKNFAWKEEYDTRQASNRWERRAMEKENKKTRDKARKERSELVRQLVAFVRKRDRRV 219          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Cavefish
Match: dnajc1 (DnaJ heat shock protein family (Hsp40) member C1 [Source:NCBI gene;Acc:103033877])

HSP 1 Score: 51.6026 bits (122), Expect = 1.832e-6
Identity = 20/47 (42.55%), Postives = 33/47 (70.21%), Query Frame = 3
Query: 1665 SKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            S  +WT  +QK LE+AL+  P     RWD+I+++V  +SK+EC++R+
Sbjct:  462 SDDVWTQNQQKLLELALQQFPRGTAERWDRIAKVVPGKSKEECMIRY 508          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001704.1 (pep scaffold:Pmarinus_7.0:GL487204:33:3976:-1 gene:ENSPMAG00000001540.1 transcript:ENSPMAT00000001704.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.8246 bits (107), Expect = 4.156e-6
Identity = 47/165 (28.48%), Postives = 66/165 (40.00%), Query Frame = 3
Query:  258 HYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDS----------VDPEFDDD----IPTLRDSKEDFF----KFFTPVFQRNARWSKTQ---------PVPMLGDENTPIAEVLR-FYNFWDDFSSWR 668
            +Y VL + +   NAS E +K+AYR+  L  HPDK    +    +E  + F  I  A+D+L D   R  YD+             EF DD    +P    S    F    K F  V++        +           P  GD  +    V+  FY +W  FSS R
Sbjct:    4 YYEVLGVAR---NASDEELKKAYRRLALQWHPDKNADNV----EEATETFKLIQAAYDVLSDAQERAWYDAHREAILQGAMSGGEFSDDSLDLMPYFTASCYSGFGDDNKGFYTVYRSVFEEVAEEEFMEDDADDEFPSFGDAGSDYETVVHVFYAYWQSFSSRR 161          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Yeast
Match: ZUO1 (Ribosome-associated chaperone; zuotin functions in ribosome biogenesis and as a chaperone for nascent polypeptide chains in partnership with Ssz1p and SSb1/2; contains a DnaJ domain and functions as a J-protein partner for Ssb1p and Ssb2p; human gene DNAJC2 can partially complement yeast zuo1 null mutant [Source:SGD;Acc:S000003517])

HSP 1 Score: 135.576 bits (340), Expect = 6.726e-35
Identity = 80/208 (38.46%), Postives = 122/208 (58.65%), Query Frame = 3
Query:  213 EYLQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKE-DFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRI 833
            E L + D RDWK  D YA + L K+R  A++  I +A+RKQ++ +HPDK  Q       + + +F  I KAF+ L D   R  YDS D  F  D+P  +   + DF++ + PVF+  AR+SK  P+P LG++++   EV +FY FW  F SWR F +LD++    +  R+ +R+I++ NK  R KK   ++ R+  +V  A + DPRI
Sbjct:   83 EDLLTHDARDWKTADLYAAMGLSKLRFRATESQIIKAHRKQVVKYHPDK--QSAAGGSLDQDGFFKIIQKAFETLTDSNKRAQYDSCD--FVADVPPPKKGTDYDFYEAWGPVFEAEARFSKKTPIPSLGNKDSSKKEVEQFYAFWHRFDSWRTFEFLDEDVPDDSSNRDHKRYIERKNKAARDKKKTADNARLVKLVERAVSEDPRI 286          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Nematostella
Match: EDO46145 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQP4])

HSP 1 Score: 283.108 bits (723), Expect = 6.305e-87
Identity = 201/548 (36.68%), Postives = 307/548 (56.02%), Query Frame = 3
Query:  204 ENHEYLQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLR-DSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRIIKYNAQRXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEMNNLKKQKDVLKNRQKAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLNEKVLDASKSIEN--KSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAH-QPGLGIKEKQVVQRAKLLKNDD-----SVLKKEAAAHNFVTKADLTINEGLKNVK-----ISDVSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            E+  +L +LDP++WK QDHY V+ L K+R  AS++ IK+AY+K++L HHPDK     +     N D+FTC+TKA ++L ++  R +YDSVDP FDD +P++   SK +F++ F PV + NARWS T+PVP+LG EN+   EV +FY+FW DF SWREFSYLD+E K + + R+ERR+I+K N+  R+K+  EE KR+ ++V      DPRI K+  + K  K  EKKAK +         E+  +E  E     + + +   K++    KK+K+ LK   K E++ +R   + Y+YFV            + + +K E M +++ L   + ++ L    E +  A  +D     K   EK  + + D  K  E   K AA  ++    + +  D+EW+ E  Q L+KA+N  P GT  RW  IA+Y+N H + G   + K V+ + K LK  D     +V KK  A  +          E +  V+      +  S P    +  W+  +QK LE AL++IP+S P RWD+++E V  R+KKEC+ R+
Sbjct:   70 EDDAFLLTLDPKEWKNQDHYRVMGLTKLRHRASEDQIKKAYKKKVLQHHPDKQSGHKQTKPVLNEDFFTCLTKAHEILSNRTKRRAYDSVDPLFDDAVPSVNAQSKANFYETFGPVIESNARWSNTEPVPLLGHENSTFEEVDKFYSFWYDFDSWREFSYLDEEEKEKGENRDERRWIEKENRAMRQKRKKEEIKRLRTLVDNVYACDPRIKKFKEEEKERKLAEKKAKEDAAKAAAEEKERQRQEALEAERLAKEKEEQLAKEKATQAKKEKEKLKAAMKKERKSIRATCKNYDYFV------------TEEAEKIEEMQILDKLLEDLSLEGLQTFREDMNKAGNKDKA---KSVYEKQLQALKDRRKQDEESKKIAALRAKKEMEVKEEADQEWSDEQLQLLVKAVNLFPAGTVSRWRVIADYVNDHAKTGNKREPKHVIVKVKSLKKIDPTQIENVNKKAFAKFDLSHTQGKASEESVPTVRYELENAAAASAPPEKPEKPWSSDDQKLLEAALRAIPASTPERWDRVAESVPGRTKKECMKRY 602          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Nematostella
Match: EDO28118 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7D4])

HSP 1 Score: 92.0485 bits (227), Expect = 7.367e-22
Identity = 57/151 (37.75%), Postives = 83/151 (54.97%), Query Frame = 3
Query: 1377 KEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAH-QPGLGIKEKQVVQRAKLLKNDDSVLKKEAAAHNFVTKADLTINEGLKNVKISDVSQPAVDSKS-------IWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            +EW+ E  Q L+KA+N  P GT  RW  IA+Y+N H + G   + K V+ + K LK  D    +      F  K DL+  +G    K S+ S P V  +         W+  +QK LE AL++IP+S P RWD+++E V  R+KKEC+ R+
Sbjct:    1 QEWSDEQLQLLVKAVNLFPAGTVSRWRVIADYVNDHAKTGNKREPKHVIVKVKSLKKIDPTQIENVNKKAF-AKFDLSHTQG----KASEESVPTVRYERKLEMAILPWSSDDQKLLEAALRAIPASTPERWDRVAESVPGRTKKECMKRY 146          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Nematostella
Match: EDO46242 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQW8])

HSP 1 Score: 51.9878 bits (123), Expect = 3.051e-7
Identity = 35/141 (24.82%), Postives = 56/141 (39.72%), Query Frame = 3
Query: 1383 WTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAHQPGLGIKEKQVVQRAKLLKNDDSVLKKEAAAHNFVTKADLTINEGLKNVKISDVSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            WT E T  L +A+   P GT  RW  I++ +                                 +   VTK    I +G      ++ +    D  + W+  +QK LE+AL+  P + P RW  I+  V   +K++CI R+
Sbjct:  186 WTEEDTSLLSRAMAKFPGGTPKRWEKISQEL-------------------------------GKSLEMVTKQVKKIKQGYTVPGTANATSQGSDEATTWSQAQQKLLEIALQQFPKTTPDRWTCIARAVPGMTKEDCINRY 295          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Medaka
Match: dnajc2 (DnaJ heat shock protein family (Hsp40) member C2 [Source:NCBI gene;Acc:101155488])

HSP 1 Score: 278.1 bits (710), Expect = 1.180e-85
Identity = 197/533 (36.96%), Postives = 295/533 (55.35%), Query Frame = 3
Query:  219 LQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRIIKYNAQRXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEMNNLKKQKDVLKNRQKAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLNEKV-LDASKSIENKSAANNSE--LSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAHQPGLGIKEKQVVQRAKLLKNDDSVLKKEAAAHNFVTKADLTINEGLKNVKISDVSQPAVDSK-SIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            L++LDP+DWK QDHYAVL L  +R  A+Q  IK A++  +L HHPDK K    + ++ +NDYFTCITKA + L D + R ++DSVDP FD+ +P+  + KE+FF+ F+ VF+RN RWS  + VP LG  ++   EV  FY+FW +F SWREFSYLD+E K +A+CR+ERR+I+K N+  R ++  EE  RI ++V +A + DPRI K+  + KA KE EKKAKAE K   +   EKA + E E     + +   + +      KK+K++ K   K E++KLR   + ++YF               +    +MM  VE LC ++++  L  LNE L + ++E+  A +++  E++N ++  +    ++   AA ++E    G     G K W  +  Q LIKA+N  P GT  R+       NA            +   KLLK           A     K   ++   + N   S+    + +   + WT  EQK LE ALK+ P S P RW+KI+  V  R+KK+C+ R+
Sbjct:    2 LRTLDPKDWKNQDHYAVLGLPHLRYKATQRQIKAAHKAIVLKHHPDKRKAAGEQIQEGDNDYFTCITKAIETLSDPMKRRAFDSVDPTFDNSVPSKGEGKENFFEVFSSVFERNERWSTKKSVPKLGSPDSSFEEVDNFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQNRASRAQRKKEEMNRIRTLVDMAYSCDPRIKKFKEEEKARKESEKKAKAEAKKREQEEKEKARQAELEATRLAKEKEDEEARQAAVQAKKEKEIQKKAIKKERQKLRTFCKNWSYFADN------------EADGVKMMEEVEKLCERLELMSLQTLNETLASGSKEECKAAVERQVEEVNVQLQREREAEVQAMQAARSAEQGSGGGGGGGGGKGWNEDDLQLLIKAVNLFPAGTNARFKIHECLRNA-----------FLSDGKLLK-----------AFEKFKKEHTSVAPSIDNAAPSERFDASGEGNLAPWTTEEQKLLEQALKTYPVSTPERWEKIAAAVPGRTKKDCMKRY 500          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Medaka
Match: dnajc21 (DnaJ heat shock protein family (Hsp40) member C21 [Source:NCBI gene;Acc:101169715])

HSP 1 Score: 51.2174 bits (121), Expect = 2.380e-6
Identity = 56/224 (25.00%), Postives = 94/224 (41.96%), Query Frame = 3
Query:  258 HYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYD---------SVDPEFDDDIPTL------------RDSKEDFFKFFTPVFQ----------RNARWSKTQPVPMLGDENTPIAEVLR-FYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRI 833
            HY +L +K+   +A  + +K+AYRK  L  HPDK    L   E E  + F  I  A+D+L D   R  YD          +  +++DD   L             D ++ F+  +  +F+          R     + +  P  GD  +    V+  FY  W  F + + F++ ++    QA  R E+R ++K NK  R K   E +  +  +    +  D R+
Sbjct:    4 HYDILGVKR---DAGDDDLKKAYRKLALKWHPDKN---LDNAE-EAAEQFKLIQAAYDVLSDPQERAWYDNHRDALLKGGLSGDYEDDSIDLLQYFTVTCYSGYGDDEKGFYTVYRNLFESIVKKELEHRRMENEEEEEEFPSFGDSQSDYDTVVHEFYAHWQSFCTRKNFAWKEEYDTRQATNRWEKRAMEKENKKTRDKARKERNDLVRQLAAFVRKRDRRV 220          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Medaka
Match: dnajc1 (DnaJ heat shock protein family (Hsp40) member C1 [Source:NCBI gene;Acc:101162478])

HSP 1 Score: 51.2174 bits (121), Expect = 2.413e-6
Identity = 53/215 (24.65%), Postives = 82/215 (38.14%), Query Frame = 3
Query: 1284 NEKVLDASKSIENKSAANNSELS-GIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNA-----------------HQPGLGIKEKQVVQRAKLLKNDDSVLKKEAAAHNFVTKADLTI------NEG----LKNVKISDVSQPAVDSK-------------SIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            N ++ D + SIE      +  L  G  +K     WT E    L + +   P G+  RW  IA  +                   H PGL           K L   DSV           T+ D  +       EG    +++ +  D    AV+ +             S WT  +QK LE+AL+  P     RWD+I+++V  ++K+EC+ R+
Sbjct:  276 NYQMYDQATSIEEIEDQMDDWLQDGKASKKKASAWTEEEMSLLSRLMGKFPGGSPGRWEKIAHELGRSVTDVTAKVKQVKDNVNHTPGLVKFSDLKGHHGKPLPAHDSVPGVGVEQEQEETQKDAALPVRRRNKEGAEAKVRSRRQRDFDPNAVEREEAEPQDNVEKSHASTWTQNQQKLLELALQQFPRGTAERWDRIAKVVPGKTKEECVSRY 490          
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Medaka
Match: dnajc1 (DnaJ heat shock protein family (Hsp40) member C1 [Source:NCBI gene;Acc:101162478])

HSP 1 Score: 51.2174 bits (121), Expect = 2.686e-6
Identity = 53/215 (24.65%), Postives = 82/215 (38.14%), Query Frame = 3
Query: 1284 NEKVLDASKSIENKSAANNSELS-GIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNA-----------------HQPGLGIKEKQVVQRAKLLKNDDSVLKKEAAAHNFVTKADLTI------NEG----LKNVKISDVSQPAVDSK-------------SIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            N ++ D + SIE      +  L  G  +K     WT E    L + +   P G+  RW  IA  +                   H PGL           K L   DSV           T+ D  +       EG    +++ +  D    AV+ +             S WT  +QK LE+AL+  P     RWD+I+++V  ++K+EC+ R+
Sbjct:  276 NYQMYDQATSIEEIEDQMDDWLQDGKASKKKASAWTEEEMSLLSRLMGKFPGGSPGRWEKIAHELGRSVTDVTAKVKQVKDNVNHTPGLVKFSDLKGHHGKPLPAHDSVPGVGVEQEQEETQKDAALPVRRRNKEGAEAKVRSRRQRDFDPNAVEREEAEPQDNVEKSHASTWTQNQQKLLELALQQFPRGTAERWDRIAKVVPGKTKEECVSRY 490          
BLAST of DnaJ homolog subfamily C member 2 vs. Planmine SMEST
Match: SMESG000080160.1 (SMESG000080160.1)

HSP 1 Score: 1042.34 bits (2694), Expect = 0.000e+0
Identity = 567/569 (99.65%), Postives = 569/569 (100.00%), Query Frame = 3
Query:   99 MALLPYFIHPQILKVCDFNKLECFNIEKYIFDDIHENHEYLQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRIIKYNAQRXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEMNNLKKQKDVLKNRQKAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLNEKVLDASKSIENKSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAHQPGLGIKEKQVVQRAKLLKNDDSVLKKEAAAHNFVTKADLTINEGLKNVKISDVSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 1805
            MALLPYFIHPQ+LKVCDFNKLECFNIEKYIFDDIHENHEYLQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNKVERKKKSLEESKRINSMVLLAKTNDPRIIKYNAQRKAEKEEEKKAKAERKLEVRLAAEKALREEKERLEQEETERQLKLKDEMNNLKKQKD+LKNRQKAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLNEKVLDASKSIENKSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAHQPGLGIKEKQVVQRAKLLKNDDSVLKKEAAAHNFVTKADLTINEGLKNVKISDVSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF
Sbjct:    1 MALLPYFIHPQVLKVCDFNKLECFNIEKYIFDDIHENHEYLQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNKVERKKKSLEESKRINSMVLLAKTNDPRIIKYNAQRKAEKEEEKKAKAERKLEVRLAAEKALREEKERLEQEETERQLKLKDEMNNLKKQKDILKNRQKAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLNEKVLDASKSIENKSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKHRWNTIAEYMNAHQPGLGIKEKQVVQRAKLLKNDDSVLKKEAAAHNFVTKADLTINEGLKNVKISDVSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILRF 569          
BLAST of DnaJ homolog subfamily C member 2 vs. Planmine SMEST
Match: SMESG000011943.1 (SMESG000011943.1)

HSP 1 Score: 409.453 bits (1051), Expect = 3.732e-138
Identity = 245/406 (60.34%), Postives = 326/406 (80.30%), Query Frame = 3
Query:   99 MALLPYFIHPQILKVCDFNKLECFNIEKYIFDDIHENHEYLQSLDPRDWKEQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENNDYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPVFQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRIIKYNAQRXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEMNNLKKQKDVLKNRQKAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQKAEMMNLVESLCLKMQIDDLTQLNEKLEN-ATEEDIVAILKKTDEKLNEKVLDASKS 1313
            M ++ Y IHP I  +C   KL+CF++E +IFDD+ ENH+YLQ+LDPRDWK+QDHYAVLRL KIR  ASQELIK AYRKQLL+HHPDKGK+RL KC DENNDYFTCIT+AF+LLK++ +R SYDS DPEFDD+IPT R++K +F++ F PVFQRN+RWSK QPVP LG+EN+PI  V RFY FWD+FSSWREFSY D+E+ S+ D RE+RR+I+K N+ ERK+K + E+KRIN +V LAK NDPRIIK+NA RKA KE EKKAKA++KL V+LAAE+A+REEKER+E+EE ++++K+++E+ N +KQK+  KNR K EKRKLRKL+E++NY+V  LSK +NN  +S  + K EM+N++++LCLK+ +D++  LN  L+  AT E  + ++K ++ K+  K  +  KS
Sbjct:    1 MEIVSYNIHPTIANICKHFKLQCFDLESHIFDDLQENHQYLQTLDPRDWKDQDHYAVLRLSKIRRAASQELIKIAYRKQLLNHHPDKGKRRLTKCVDENNDYFTCITRAFELLKEESTRNSYDSCDPEFDDNIPTAREAKSNFYQVFLPVFQRNSRWSKIQPVPSLGNENSPIEAVNRFYTFWDNFSSWREFSYADEETSSKDDNREQRRYIEKENRAERKRKLIAETKRINKLVDLAKLNDPRIIKFNADRKAAKEAEKKAKADQKLAVKLAAEQAIREEKERIEKEEADKKIKIQEEIANNRKQKEAAKNRHKNEKRKLRKLSESHNYYVEVLSKSSNNSNRSPALMKLEMVNVIDTLCLKLSVDEIATLNVALDTAATIEGKIQLIKTSELKVVGKNTEILKS 406          
BLAST of DnaJ homolog subfamily C member 2 vs. Planmine SMEST
Match: SMESG000011588.1 (SMESG000011588.1)

HSP 1 Score: 51.9878 bits (123), Expect = 1.294e-7
Identity = 33/61 (54.10%), Postives = 46/61 (75.41%), Query Frame = 3
Query:  672 FSYLDKESKSQADCREERRFIDKGNXXXXXXXXXXXXXXINSMVLLAKTNDPRIIKYNAQR 854
              + D+E+ S+ D RE+R++I+K N+ ERK K + E+KRIN +V LAK NDPRIIK+NA R
Sbjct:   59 LGHADEETSSKDDNREQRKYIEKENRAERKGKLIAETKRINKLVDLAKLNDPRIIKFNADR 119          
BLAST of DnaJ homolog subfamily C member 2 vs. Planmine SMEST
Match: SMESG000071133.1 (SMESG000071133.1)

HSP 1 Score: 49.2914 bits (116), Expect = 8.405e-6
Identity = 21/43 (48.84%), Postives = 29/43 (67.44%), Query Frame = 3
Query: 1674 IWTIGEQKSLEMALKSIPSSDPARWDKISEMVSTRSKKECILR 1802
            IWT  EQK LE A++S P+    RWD+I + + T+SK +CI R
Sbjct:  493 IWTQAEQKQLEEAMRSFPNGTTNRWDRIVQKIPTKSKAQCIDR 535          
The following BLAST results are available for this feature:
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAJC23.494e-10340.30DnaJ heat shock protein family (Hsp40) member C2 [... [more]
DNAJC22.405e-6353.41DnaJ heat shock protein family (Hsp40) member C2 [... [more]
DNAJC22.639e-6351.22DnaJ heat shock protein family (Hsp40) member C2 [... [more]
DNAJC21.456e-5044.88DnaJ heat shock protein family (Hsp40) member C2 [... [more]
DNAJC27.500e-1853.62DnaJ heat shock protein family (Hsp40) member C2 [... [more]
back to top
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dnj-116.349e-7737.34DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
dnj-172.631e-1429.28DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
back to top
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG105653.249e-8534.42gene:FBgn0037051 transcript:FBtr0305502[more]
CG105653.249e-8534.42gene:FBgn0037051 transcript:FBtr0078323[more]
back to top
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajc23.486e-9739.70DnaJ (Hsp40) homolog, subfamily C, member 2 [Sourc... [more]
dnajc27.192e-2435.07DnaJ (Hsp40) homolog, subfamily C, member 2 [Sourc... [more]
dnajc211.464e-827.80DnaJ heat shock protein family (Hsp40) member C21 ... [more]
dnajc15.566e-642.55DnaJ (Hsp40) homolog, subfamily C, member 1 [Sourc... [more]
dnajc78.339e-634.62DnaJ (Hsp40) homolog, subfamily C, member 7 [Sourc... [more]
back to top
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
net12.424e-6350.48neuroepithelial cell transforming 1 [Source:Xenbas... [more]
net12.661e-6350.48neuroepithelial cell transforming 1 [Source:Xenbas... [more]
net13.576e-6350.48neuroepithelial cell transforming 1 [Source:Xenbas... [more]
net14.293e-6350.48neuroepithelial cell transforming 1 [Source:Xenbas... [more]
net16.083e-6350.48neuroepithelial cell transforming 1 [Source:Xenbas... [more]
back to top
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnajc21.282e-10039.70DnaJ heat shock protein family (Hsp40) member C2 [... [more]
Dnajc21.077e-9939.70DnaJ heat shock protein family (Hsp40) member C2 [... [more]
Dnajc21.448e-9939.70DnaJ heat shock protein family (Hsp40) member C2 [... [more]
Dnajc22.287e-3750.86DnaJ heat shock protein family (Hsp40) member C2 [... [more]
Dnajc212.238e-927.15DnaJ heat shock protein family (Hsp40) member C21 ... [more]
back to top
BLAST of DnaJ homolog subfamily C member 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q1RMH9|DNJC2_BOVIN1.220e-10439.93DnaJ homolog subfamily C member 2 OS=Bos taurus OX... [more]
sp|Q99543|DNJC2_HUMAN1.678e-10240.30DnaJ homolog subfamily C member 2 OS=Homo sapiens ... [more]
sp|Q4R8H2|DNJC2_MACFA5.120e-10240.11DnaJ homolog subfamily C member 2 OS=Macaca fascic... [more]
sp|P54103|DNJC2_MOUSE1.013e-9839.70DnaJ homolog subfamily C member 2 OS=Mus musculus ... [more]
sp|Q7TQ20|DNJC2_RAT1.126e-9839.51DnaJ homolog subfamily C member 2 OS=Rattus norveg... [more]
back to top
BLAST of DnaJ homolog subfamily C member 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4W2GYJ23.617e-10239.93Uncharacterized protein OS=Bos indicus x Bos tauru... [more]
L8INR26.158e-10239.93DnaJ-like protein subfamily C member 2 OS=Bos mutu... [more]
A0A383ZQK91.827e-10140.11dnaJ homolog subfamily C member 2 isoform X2 OS=Ba... [more]
A0A2Y9FS093.393e-10140.11dnaJ homolog subfamily C member 2 isoform X2 OS=Ph... [more]
A0A2Y9LKP44.068e-10140.11dnaJ homolog subfamily C member 2 isoform X2 OS=De... [more]
back to top
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajc21.282e-9439.33DnaJ heat shock protein family (Hsp40) member C2 [... [more]
dnajc22.368e-9439.33DnaJ heat shock protein family (Hsp40) member C2 [... [more]
dnajc214.967e-826.91DnaJ heat shock protein family (Hsp40) member C21 ... [more]
dnajc214.967e-826.91DnaJ heat shock protein family (Hsp40) member C21 ... [more]
dnajc11.832e-642.55DnaJ heat shock protein family (Hsp40) member C1 [... [more]
back to top
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000001704.14.156e-628.48pep scaffold:Pmarinus_7.0:GL487204:33:3976:-1 gene... [more]
back to top
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ZUO16.726e-3538.46Ribosome-associated chaperone; zuotin functions in... [more]
back to top
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO461456.305e-8736.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281187.367e-2237.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462423.051e-724.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DnaJ homolog subfamily C member 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dnajc21.180e-8536.96DnaJ heat shock protein family (Hsp40) member C2 [... [more]
dnajc212.380e-625.00DnaJ heat shock protein family (Hsp40) member C21 ... [more]
dnajc12.413e-624.65DnaJ heat shock protein family (Hsp40) member C1 [... [more]
dnajc12.686e-624.65DnaJ heat shock protein family (Hsp40) member C1 [... [more]
back to top
BLAST of DnaJ homolog subfamily C member 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000080160.10.000e+099.65SMESG000080160.1[more]
SMESG000011943.13.732e-13860.34SMESG000011943.1[more]
SMESG000011588.11.294e-754.10SMESG000011588.1[more]
SMESG000071133.18.405e-648.84SMESG000071133.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008111 ID=SMED30008111|Name=DnaJ homolog subfamily C member 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1889bp
TAATTTAATAATATTTACTTTTATAGTTATAATAGCTAGGTCAAGATTTG
TTTTGTGCAGATATTTTATAATATATTTAAATCAAATTTATTCTATATAT
GGCATTATTACCATATTTCATACATCCTCAAATATTGAAAGTATGTGATT
TTAACAAATTAGAGTGCTTTAACATCGAGAAATATATTTTTGATGATATT
CACGAAAATCACGAGTACCTTCAATCACTTGACCCAAGAGATTGGAAGGA
GCAGGATCACTATGCAGTATTGCGTCTAAAAAAAATTCGCATTAATGCAT
CACAAGAGTTGATTAAGCAGGCTTATAGAAAACAATTATTAGATCATCAT
CCAGATAAAGGAAAACAACGTTTAAGAAAATGTGAAGATGAAAATAATGA
TTACTTTACATGCATTACTAAAGCTTTCGATTTGTTGAAAGATCAAGTTT
CTAGAATTTCTTATGATAGTGTTGATCCAGAATTTGATGATGATATACCA
ACATTACGGGACTCTAAAGAAGACTTTTTCAAGTTCTTCACTCCAGTTTT
CCAAAGAAATGCTCGCTGGTCTAAAACTCAACCAGTTCCAATGTTAGGAG
ATGAAAATACACCAATTGCAGAGGTTCTTCGTTTTTATAATTTTTGGGAT
GATTTTAGTTCTTGGAGAGAATTCAGCTATTTAGACAAAGAAAGCAAGTC
ACAAGCAGACTGTAGGGAAGAGAGACGTTTTATAGATAAAGGAAATAAAG
TTGAAAGAAAAAAGAAAAGCTTAGAAGAAAGCAAACGAATTAATAGTATG
GTTCTCTTAGCTAAGACTAATGATCCTAGAATTATTAAATATAATGCTCA
AAGGAAAGCTGAAAAGGAAGAAGAAAAAAAAGCCAAAGCTGAGCGCAAAT
TAGAAGTTAGATTGGCAGCTGAAAAAGCTTTGAGAGAAGAAAAGGAAAGA
TTAGAACAAGAAGAAACTGAACGCCAACTGAAACTAAAAGATGAAATGAA
TAATTTAAAGAAACAAAAGGATGTTCTCAAGAATCGCCAAAAAGCTGAAA
AAAGGAAATTGAGAAAACTGGCAGAAACTTATAATTATTTTGTTGGAGCT
TTGTCAAAATTCAACAATAATTTAGAAAAGTCTTTAGATATACAAAAAGC
TGAAATGATGAATCTTGTTGAATCTCTATGCTTAAAAATGCAAATCGATG
ACCTGACACAATTAAATGAGAAACTGGAAAATGCCACCGAAGAGGATATT
GTTGCTATTCTTAAAAAAACGGATGAAAAACTTAATGAAAAGGTTTTGGA
TGCTTCGAAGTCTATTGAAAACAAATCTGCAGCAAATAATTCAGAATTAT
CAGGAATCATTAATAAGTGTGGGGATAAGGAATGGACTTTTGAGCTCACT
CAATTTCTAATCAAGGCTATCAATTGCCATCCACCCGGTACAAAGCATCG
ATGGAACACGATTGCAGAGTACATGAATGCTCATCAACCGGGGCTCGGCA
TCAAAGAGAAACAAGTCGTTCAAAGAGCTAAATTATTGAAAAATGACGAT
TCAGTATTGAAGAAAGAAGCCGCAGCTCACAATTTCGTCACAAAAGCTGA
CTTGACAATAAATGAGGGATTAAAAAATGTCAAAATTTCCGACGTTTCCC
AGCCGGCTGTCGATTCGAAATCGATCTGGACAATTGGAGAGCAGAAATCA
TTGGAAATGGCATTGAAATCAATCCCGAGTAGTGATCCAGCACGGTGGGA
CAAAATCAGTGAAATGGTGTCCACGAGGTCCAAGAAAGAATGTATTCTTC
GATTTAAAGAATGCGCTGAGAAAATGAAGGCTAAAAAAGCTGCACAATAA
TGTTGTTTCACTTATTTAATATTTAAATAAATATCCTAT
back to top

protein sequence of SMED30008111-orf-1

>SMED30008111-orf-1 ID=SMED30008111-orf-1|Name=SMED30008111-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=584bp
MALLPYFIHPQILKVCDFNKLECFNIEKYIFDDIHENHEYLQSLDPRDWK
EQDHYAVLRLKKIRINASQELIKQAYRKQLLDHHPDKGKQRLRKCEDENN
DYFTCITKAFDLLKDQVSRISYDSVDPEFDDDIPTLRDSKEDFFKFFTPV
FQRNARWSKTQPVPMLGDENTPIAEVLRFYNFWDDFSSWREFSYLDKESK
SQADCREERRFIDKGNKVERKKKSLEESKRINSMVLLAKTNDPRIIKYNA
QRKAEKEEEKKAKAERKLEVRLAAEKALREEKERLEQEETERQLKLKDEM
NNLKKQKDVLKNRQKAEKRKLRKLAETYNYFVGALSKFNNNLEKSLDIQK
AEMMNLVESLCLKMQIDDLTQLNEKLENATEEDIVAILKKTDEKLNEKVL
DASKSIENKSAANNSELSGIINKCGDKEWTFELTQFLIKAINCHPPGTKH
RWNTIAEYMNAHQPGLGIKEKQVVQRAKLLKNDDSVLKKEAAAHNFVTKA
DLTINEGLKNVKISDVSQPAVDSKSIWTIGEQKSLEMALKSIPSSDPARW
DKISEMVSTRSKKECILRFKECAEKMKAKKAAQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003682chromatin binding
GO:0042393histone binding
GO:0061649ubiquitinated histone binding
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006325chromatin organization
GO:0045893positive regulation of transcription, DNA-templated
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR001623DnaJ_domain
IPR001005SANT/Myb
IPR032003RAC_head
IPR018253DnaJ_domain_CS
IPR017877Myb-like_dom
IPR009057Homeobox-like_sf