Mitochondrial import receptor subunit TOM20 homolog

Overview
NameMitochondrial import receptor subunit TOM20 homolog
Smed IDSMED30008103
Length (bp)1040
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mitochondrial import receptor subunit TOM20 homolog (SMED30008103) t-SNE clustered cells

Violin plots show distribution of expression levels for Mitochondrial import receptor subunit TOM20 homolog (SMED30008103) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mitochondrial import receptor subunit TOM20 homolog (SMED30008103) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mitochondrial import receptor subunit TOM20 homolog (SMED30008103) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008103

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30008103h1SMcG0006198 SmedASXL_001938SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
muscle cellSMED30008103h1SMcG0006198 dd_Smed_v4_2684_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30008103h1SMcG0006198 dd_Smed_v4_2684_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Human
Match: TOMM20 (translocase of outer mitochondrial membrane 20 [Source:HGNC Symbol;Acc:HGNC:20947])

HSP 1 Score: 84.7297 bits (208), Expect = 2.257e-19
Identity = 60/133 (45.11%), Postives = 88/133 (66.17%), Query Frame = 2
Query:  113 LVMSSKYIVAVGAGVAFISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQV 511
            +V  +  I A   G  FI YCIYFD KRRS P+FK +LRE+RK QK  K +  +  LPD+ +  A Q+FFLE+I+ G++ ++ G  E+G+  L  A++VCG PQ LL+V +QTL P  + MLL+ LP + +++
Sbjct:    1 MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRI 133          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Human
Match: TOMM20L (translocase of outer mitochondrial membrane 20 like [Source:HGNC Symbol;Acc:HGNC:33752])

HSP 1 Score: 73.559 bits (179), Expect = 2.954e-15
Identity = 46/109 (42.20%), Postives = 66/109 (60.55%), Query Frame = 2
Query:  167 SYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLP 493
             YCIY + KRR  P FK++LR+KR+ + +   + +   L D   N   QE FL+++R G+  +S G    GIQ L  AL VC  P+ LLKVF+ TL P+ ++MLL  +P
Sbjct:   24 GYCIYLNRKRRGDPAFKRRLRDKRRAEPQKAEE-QGTQLWDPTKNKKLQELFLQEVRMGELWLSRGEHRMGIQHLGNALLVCEQPRELLKVFKHTLPPKVFEMLLHKIP 131          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Celegans
Match: tomm-20 (Mitochondrial import receptor subunit TOM20 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q19766])

HSP 1 Score: 83.9593 bits (206), Expect = 5.378e-19
Identity = 51/140 (36.43%), Postives = 83/140 (59.29%), Query Frame = 2
Query:  125 SKYIVAVG-AGVAFISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXI-RIP------TLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQVDEL 520
            S  ++A G AG AF+ YCIYFD+KR + PD+K K+R+KR+ Q        R P        PD+ +    Q FFL++++ G++ M++G  +EG   +A A+ +CG  Q LL +F+QTL    +  ++  LP  +E++ E+
Sbjct:   11 SNVVLAAGIAGAAFLGYCIYFDHKRINAPDYKDKIRQKRRAQAGAGGMAPRRPAAAGNDAAPDVTDPSQMQRFFLQEVQLGEELMAAGNVDEGAVHIANAVMLCGESQQLLSIFQQTLSEDQFRAVVQQLPSTRERLAEM 150          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Fly
Match: Tom20 (gene:FBgn0036928 transcript:FBtr0332719)

HSP 1 Score: 81.2629 bits (199), Expect = 4.087e-18
Identity = 52/134 (38.81%), Postives = 85/134 (63.43%), Query Frame = 2
Query:  113 LVMSSKYIVAVGAGVA---FISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKE 505
            ++  +K  + + AGVA   FI YCIYFD KRRS P++KKK+RE+R+  K+         +P++N++ A + +FL++I+ G+  ++ G  E G++ LA A+ VCG P  LL+V + +L  Q + ML+    KM+E
Sbjct:    1 MIEMNKTAIGIAAGVAGTLFIGYCIYFDKKRRSDPEYKKKVRERRRRNKKTGTAK--SGVPNLNDHEAIERYFLQEIQLGETLIARGDFESGVEHLANAIVVCGQPARLLQVLQSSLPAQVFAMLIV---KMQE 129          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Fly
Match: Tom20 (gene:FBgn0036928 transcript:FBtr0074903)

HSP 1 Score: 81.2629 bits (199), Expect = 4.087e-18
Identity = 52/134 (38.81%), Postives = 85/134 (63.43%), Query Frame = 2
Query:  113 LVMSSKYIVAVGAGVA---FISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKE 505
            ++  +K  + + AGVA   FI YCIYFD KRRS P++KKK+RE+R+  K+         +P++N++ A + +FL++I+ G+  ++ G  E G++ LA A+ VCG P  LL+V + +L  Q + ML+    KM+E
Sbjct:    1 MIEMNKTAIGIAAGVAGTLFIGYCIYFDKKRRSDPEYKKKVRERRRRNKKTGTAK--SGVPNLNDHEAIERYFLQEIQLGETLIARGDFESGVEHLANAIVVCGQPARLLQVLQSSLPAQVFAMLIV---KMQE 129          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Fly
Match: tomboy20 (gene:FBgn0037828 transcript:FBtr0082316)

HSP 1 Score: 62.7734 bits (151), Expect = 8.737e-12
Identity = 37/122 (30.33%), Postives = 66/122 (54.10%), Query Frame = 2
Query:  134 IVAVGAGVAFISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKM 499
            ++A  +G+ F+ YC+YFD +RRS PDF  K +   +  + +   ++      M+     + +F+ QI  G+  +++G  E G++ L  A+ VCG P  LL++ + TL     D+  + L KM
Sbjct:   10 VLAAISGILFMGYCVYFDKQRRSDPDF--KRKLHERRIQRSLASVKSTASVSMSERDV-EVYFMTQIHKGETLITNGDVEAGVEHLINAILVCGQPSKLLQLLQSTL---PMDIFTTMLIKM 125          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Zebrafish
Match: tomm20b (translocase of outer mitochondrial membrane 20b [Source:NCBI gene;Acc:436971])

HSP 1 Score: 83.9593 bits (206), Expect = 3.253e-19
Identity = 60/134 (44.78%), Postives = 90/134 (67.16%), Query Frame = 2
Query:  113 LVMSSKYIVAVGAGVA-FISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQV 511
            ++  S   +A G G A F+ YCIYFD KRRS P++K KLRE+RK QK  + K  +  LPD+ +  A Q+FFLE+I+ G++ ++ G  E+G+  L  A++VCG PQ LL+V +QTL P  + MLL+ LP + +++
Sbjct:    1 MMGGSSSRIAAGLGAALFVGYCIYFDRKRRSDPNYKNKLRERRKKQKAAQEKAGLSRLPDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRI 134          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Zebrafish
Match: tomm20a (translocase of outer mitochondrial membrane 20 [Source:ZFIN;Acc:ZDB-GENE-040426-1976])

HSP 1 Score: 82.4185 bits (202), Expect = 1.092e-18
Identity = 58/126 (46.03%), Postives = 87/126 (69.05%), Query Frame = 2
Query:  137 VAVGA-GVAFISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQV 511
            VA+G  G  FI YCIYFD KRRS P+F+ KLRE+RK Q+  + K  +  LPD+ +  A Q+FFL++I+ G++ ++ G  E+G+  L  A++VCG PQ LL+V +QTL P  + MLL+ LP + +++
Sbjct:    8 VALGVCGALFIGYCIYFDRKRRSDPNFRTKLRERRKKQRTAQDKSGLAQLPDLKDAAAVQKFFLDEIQLGEELLAQGDYEQGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRM 133          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Zebrafish
Match: tomm20a (translocase of outer mitochondrial membrane 20 [Source:ZFIN;Acc:ZDB-GENE-040426-1976])

HSP 1 Score: 82.4185 bits (202), Expect = 1.098e-18
Identity = 58/126 (46.03%), Postives = 87/126 (69.05%), Query Frame = 2
Query:  137 VAVGA-GVAFISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQV 511
            VA+G  G  FI YCIYFD KRRS P+F+ KLRE+RK Q+  + K  +  LPD+ +  A Q+FFL++I+ G++ ++ G  E+G+  L  A++VCG PQ LL+V +QTL P  + MLL+ LP + +++
Sbjct:    9 VALGVCGALFIGYCIYFDRKRRSDPNFRTKLRERRKKQRTAQDKSGLAQLPDLKDAAAVQKFFLDEIQLGEELLAQGDYEQGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRM 134          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Zebrafish
Match: tomm20b (translocase of outer mitochondrial membrane 20b [Source:NCBI gene;Acc:436971])

HSP 1 Score: 59.6918 bits (143), Expect = 2.436e-10
Identity = 43/111 (38.74%), Postives = 65/111 (58.56%), Query Frame = 2
Query:  113 LVMSSKYIVAVGAGVA-FISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVF 442
            ++  S   +A G G A F+ YCIYFD KRRS P++K KLRE+RK QK  + K  +  LPD+ +  A Q+FFLE+I+ G++ ++  A  +  +       V G P ++   F
Sbjct:    1 MMGGSSSRIAAGLGAALFVGYCIYFDRKRRSDPNYKNKLRERRKKQKAAQEKAGLSRLPDLKDAEAVQKFFLEEIQLGEELLAQ-AYRQRSEHQRRRHRVAGTPAAVRHHF 110          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Xenopus
Match: fyn (FYN proto-oncogene, Src family tyrosine kinase [Source:Xenbase;Acc:XB-GENE-6053489])

HSP 1 Score: 82.0333 bits (201), Expect = 2.580e-18
Identity = 58/135 (42.96%), Postives = 89/135 (65.93%), Query Frame = 2
Query:  110 LLVMSSKYIVAVGA-GVAFISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQV 511
            ++V+     +A G  G  F+ YCIYFD KRRS P+FK +LREKR+ QK  K +     LPD+ +  A Q+FFLE+I+ G++ ++ G  E+G+  L  A+++CG PQ LL+V +QTL P  + MLL+ LP + +++
Sbjct:    1 MVVVGKTSAIAAGVCGALFLGYCIYFDRKRRSDPNFKNRLREKRRKQKIAKERAGQSRLPDLKDAEAVQKFFLEEIQLGEELLAQGDFEKGVDHLTNAIAICGQPQQLLQVLQQTLPPPVFQMLLTKLPTINQRI 135          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Xenopus
Match: fyn (FYN proto-oncogene, Src family tyrosine kinase [Source:Xenbase;Acc:XB-GENE-6053489])

HSP 1 Score: 80.8777 bits (198), Expect = 8.425e-18
Identity = 61/136 (44.85%), Postives = 89/136 (65.44%), Query Frame = 2
Query:  110 LLVMSSKYIVAVGA-GVAFISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQVD 514
            ++V+     +A G  G  F+ YCIYFD KRRS P+FK +LREKR+ QK  K +     LPD+ +  A Q+FFLE+I+ G++ ++ G  E+G+  L  A+++CG PQ LL+V +QTL P  + MLL+ LP +  QVD
Sbjct:    1 MVVVGKTSAIAAGVCGALFLGYCIYFDRKRRSDPNFKNRLREKRRKQKIAKERAGQSRLPDLKDAEAVQKFFLEEIQLGEELLAQGDFEKGVDHLTNAIAICGQPQQLLQVLQQTLPPPVFQMLLTKLPTI-NQVD 135          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Xenopus
Match: fyn (FYN proto-oncogene, Src family tyrosine kinase [Source:Xenbase;Acc:XB-GENE-6053489])

HSP 1 Score: 80.4925 bits (197), Expect = 1.456e-17
Identity = 58/133 (43.61%), Postives = 87/133 (65.41%), Query Frame = 2
Query:  110 LLVMSSKYIVAVGA-GVAFISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKE 505
            ++V+     +A G  G  F+ YCIYFD KRRS P+FK +LREKR+ QK  K +     LPD+ +  A Q+FFLE+I+ G++ ++ G  E+G+  L  A+++CG PQ LL+V +QTL P  + MLL+ LP + +
Sbjct:    1 MVVVGKTSAIAAGVCGALFLGYCIYFDRKRRSDPNFKNRLREKRRKQKIAKERAGQSRLPDLKDAEAVQKFFLEEIQLGEELLAQGDFEKGVDHLTNAIAICGQPQQLLQVLQQTLPPPVFQMLLTKLPTINQ 133          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Mouse
Match: Tomm20 (translocase of outer mitochondrial membrane 20 [Source:MGI Symbol;Acc:MGI:1915202])

HSP 1 Score: 84.3445 bits (207), Expect = 2.189e-19
Identity = 60/133 (45.11%), Postives = 88/133 (66.17%), Query Frame = 2
Query:  113 LVMSSKYIVAVGAGVAFISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQV 511
            +V  +  I A   G  FI YCIYFD KRRS P+FK +LRE+RK QK  K +  +  LPD+ +  A Q+FFLE+I+ G++ ++ G  E+G+  L  A++VCG PQ LL+V +QTL P  + MLL+ LP + +++
Sbjct:    1 MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRI 133          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Mouse
Match: Tomm20l (translocase of outer mitochondrial membrane 20-like [Source:MGI Symbol;Acc:MGI:1922516])

HSP 1 Score: 62.003 bits (149), Expect = 2.919e-11
Identity = 39/126 (30.95%), Postives = 66/126 (52.38%), Query Frame = 2
Query:  167 SYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQVDELTKKQEKFS 544
            SYC+Y D++R   P F+++L++KR+  +          L D       QE+F  +++ G  C+  G    G + L  AL VC  P+ LL  F++TL P+ + MLL  +P + +Q++E  +  E   
Sbjct:   24 SYCVYLDWRRHRDPAFRRRLQDKRRAGQPKAQAP-ARQLWDPVKKEELQEYFFREVQMGKLCLIRGERGMGFEHLTNALLVCEQPKELLMFFKKTLPPEVFQMLLDKIPLICQQLEETCRSTEHLK 148          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. UniProt/SwissProt
Match: sp|Q5RA31|TOM20_PONAB (Mitochondrial import receptor subunit TOM20 homolog OS=Pongo abelii OX=9601 GN=TOMM20 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.084e-18
Identity = 60/133 (45.11%), Postives = 88/133 (66.17%), Query Frame = 2
Query:  113 LVMSSKYIVAVGAGVAFISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQV 511
            +V  +  I A   G  FI YCIYFD KRRS P+FK +LRE+RK QK  K +  +  LPD+ +  A Q+FFLE+I+ G++ ++ G  E+G+  L  A++VCG PQ LL+V +QTL P  + MLL+ LP + +++
Sbjct:    1 MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRI 133          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. UniProt/SwissProt
Match: sp|Q15388|TOM20_HUMAN (Mitochondrial import receptor subunit TOM20 homolog OS=Homo sapiens OX=9606 GN=TOMM20 PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.084e-18
Identity = 60/133 (45.11%), Postives = 88/133 (66.17%), Query Frame = 2
Query:  113 LVMSSKYIVAVGAGVAFISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQV 511
            +V  +  I A   G  FI YCIYFD KRRS P+FK +LRE+RK QK  K +  +  LPD+ +  A Q+FFLE+I+ G++ ++ G  E+G+  L  A++VCG PQ LL+V +QTL P  + MLL+ LP + +++
Sbjct:    1 MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRI 133          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. UniProt/SwissProt
Match: sp|A6H7B1|TOM20_BOVIN (Mitochondrial import receptor subunit TOM20 homolog OS=Bos taurus OX=9913 GN=TOMM20 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.084e-18
Identity = 60/133 (45.11%), Postives = 88/133 (66.17%), Query Frame = 2
Query:  113 LVMSSKYIVAVGAGVAFISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQV 511
            +V  +  I A   G  FI YCIYFD KRRS P+FK +LRE+RK QK  K +  +  LPD+ +  A Q+FFLE+I+ G++ ++ G  E+G+  L  A++VCG PQ LL+V +QTL P  + MLL+ LP + +++
Sbjct:    1 MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRI 133          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. UniProt/SwissProt
Match: sp|Q62760|TOM20_RAT (Mitochondrial import receptor subunit TOM20 homolog OS=Rattus norvegicus OX=10116 GN=Tomm20 PE=1 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 1.532e-18
Identity = 60/133 (45.11%), Postives = 88/133 (66.17%), Query Frame = 2
Query:  113 LVMSSKYIVAVGAGVAFISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQV 511
            +V  +  I A   G  FI YCIYFD KRRS P+FK +LRE+RK QK  K +  +  LPD+ +  A Q+FFLE+I+ G++ ++ G  E+G+  L  A++VCG PQ LL+V +QTL P  + MLL+ LP + +++
Sbjct:    1 MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRI 133          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. UniProt/SwissProt
Match: sp|Q9DCC8|TOM20_MOUSE (Mitochondrial import receptor subunit TOM20 homolog OS=Mus musculus OX=10090 GN=Tomm20 PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.532e-18
Identity = 60/133 (45.11%), Postives = 88/133 (66.17%), Query Frame = 2
Query:  113 LVMSSKYIVAVGAGVAFISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQV 511
            +V  +  I A   G  FI YCIYFD KRRS P+FK +LRE+RK QK  K +  +  LPD+ +  A Q+FFLE+I+ G++ ++ G  E+G+  L  A++VCG PQ LL+V +QTL P  + MLL+ LP + +++
Sbjct:    1 MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRI 133          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. TrEMBL
Match: A7RJB2 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g83121 PE=3 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 8.573e-25
Identity = 60/132 (45.45%), Postives = 86/132 (65.15%), Query Frame = 2
Query:  119 MSSKYIVAVGAGVA---FISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKE 505
            MSS  I  V AGV    F++YCIYFDYKRRS PD+KKKL EKR  ++E         +PD+ +  A Q+FFLE+++ G+  ++ G  E  ++ L  A++VCG PQ LL+VF+QTL P  + ML+  + +MK+
Sbjct:    1 MSSSQIATVVAGVCGSMFLAYCIYFDYKRRSDPDYKKKLIEKRAQRQEADAADMQSRIPDLTDTAAVQKFFLEEVQIGEDLLTKGEYESAVKHLTNAVAVCGQPQQLLQVFKQTLPPAVFQMLIDNINQMKD 132          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. TrEMBL
Match: A0A448WFG9 (Uncharacterized protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS3932 PE=3 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.995e-24
Identity = 59/134 (44.03%), Postives = 83/134 (61.94%), Query Frame = 2
Query:  113 LVMSSKYIVAVGAGVAFISYCIYFDYKRRSHPDFXXXX-XXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQV 511
            ++  +  I A GAG   ++YCIYFD+KRRSHPDF+ KL +++R+     K  I +P L D N   A Q FFLEQ++ G+  ++ GA EEG+Q  ALA +VCG P  LL++   TL P  + +L   LP  + QV
Sbjct:    1 MLKEAGVIAAFGAGFCLVAYCIYFDHKRRSHPDFRAKLIKKRRQQALAAKKTIDLPCLSDQN---AVQRFFLEQVQSGEVALNMGAIEEGVQHFALAAAVCGQPGHLLQLLRTTLPPPVFSLLAKALPDARAQV 131          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. TrEMBL
Match: J9Q434 (Mitochondrial inmport receptor subunit TOM20 OS=Ostrea edulis OX=37623 PE=2 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 3.052e-24
Identity = 60/128 (46.88%), Postives = 88/128 (68.75%), Query Frame = 2
Query:  128 KYIVAVGAGVAFISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIP-TLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQ 508
            KY VA GAG+ F+ YCIYFD KRRSHPDFKK+L+E+R++ K  K        LPD+ N  A Q+FF EQ++ G++ +++G  E  +  L+ A+ +CG PQ LL+V EQTL PQ + +L+  LP++ ++
Sbjct:   15 KYAVA-GAGLCFLGYCIYFDNKRRSHPDFKKRLKERRQHSKVGKSSKSGDIQLPDLQNQEAVQKFFFEQVQLGEELLAAGDVERAVDHLSNAVPLCGQPQQLLQVLEQTLPPQVFQLLVQKLPEVNKR 141          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. TrEMBL
Match: K1PSL3 (Mitochondrial import receptor subunit TOM20-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10024362 PE=3 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 1.486e-23
Identity = 60/128 (46.88%), Postives = 87/128 (67.97%), Query Frame = 2
Query:  128 KYIVAVGAGVAFISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPT-LPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQ 508
            KY VA GAG+ F+ YCIYFD KRR+HPDFKKKL+E+RK     K        LPD+ N  A Q+FF EQ++ G++ +++G  E  ++ L+ A+ +CG PQ LL+V EQTL PQ + +L+  LP++ ++
Sbjct:   15 KYAVA-GAGLCFLGYCIYFDNKRRNHPDFKKKLKERRKKSNSTKSSKTGSIQLPDLQNQEAVQKFFFEQVQLGEELLAAGDVENAVEHLSNAVPLCGQPQQLLQVLEQTLPPQVFQLLVQKLPEVNKR 141          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. TrEMBL
Match: A0A0D9S9U5 (Uncharacterized protein OS=Chlorocebus sabaeus OX=60711 PE=3 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.314e-23
Identity = 60/133 (45.11%), Postives = 86/133 (64.66%), Query Frame = 2
Query:  116 VMSSKYIVAVGA-GVAFISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQV 511
            +M     +A G  G  FI YCIYFD KRRS P+FK +LRE+RK QK  K +  +  LPD  +  A Q+FFLE+I+ G++ ++ G  E+G+  L  A+ VCG PQ LL+V +QTL P  + MLL+ LP + +++
Sbjct:    1 MMGRNSAIAAGVCGTLFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDFKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIVVCGQPQRLLQVLQQTLPPPVFQMLLTKLPTISQRI 133          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Cavefish
Match: tomm20b (mitochondrial import receptor subunit TOM20 homolog B [Source:NCBI gene;Acc:103040423])

HSP 1 Score: 83.9593 bits (206), Expect = 2.541e-19
Identity = 59/126 (46.83%), Postives = 88/126 (69.84%), Query Frame = 2
Query:  137 VAVGAGVA-FISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQV 511
            +A G G A F+ YCIYFD KRRS P+FK+KLRE+RK QK  + +  +  LPD+ +  A Q+FFLE+I+ G++ ++ G  E+G+  L  A++VCG PQ LL+V +QTL P  + MLL+ LP + +++
Sbjct:    9 IAAGVGAALFVGYCIYFDRKRRSDPNFKRKLRERRKKQKAAQERAGLSRLPDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRI 134          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Cavefish
Match: tomm20a (mitochondrial import receptor subunit TOM20 homolog [Source:NCBI gene;Acc:103029137])

HSP 1 Score: 83.5741 bits (205), Expect = 4.053e-19
Identity = 58/134 (43.28%), Postives = 95/134 (70.90%), Query Frame = 2
Query:  116 VMSSKY-IVAVG-AGVAFISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQV 511
            +M+ +Y  +A+G +G  FI YCIYFD +RRSHPD+++KLRE+R+NQK  + K  +  LPD+ +  A Q+FFL++I+ G++ ++ G  E G+  L  A++VCG PQ LL+V +QTL P  + ML++ +P + +++
Sbjct:    1 MMAGRYGALALGLSGALFIGYCIYFDRRRRSHPDYRRKLRERRRNQKLAQEKSGLAKLPDLKDPAAVQQFFLDEIQLGEELLAQGDYENGVDHLTNAITVCGQPQQLLQVLQQTLPPPVFQMLITKVPTISQRL 134          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Sea Lamprey
Match: tomm20b (translocase of outer mitochondrial membrane 20b [Source:NCBI gene;Acc:436971])

HSP 1 Score: 80.8777 bits (198), Expect = 6.946e-19
Identity = 58/142 (40.85%), Postives = 88/142 (61.97%), Query Frame = 2
Query:  110 LLVMSSKYIVAVGAGVAFISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQVDELTKKQE 535
            ++   +  I A   G  FI YC+YFD KRRS PDFKKKLRE  ++    +    +  LPD+ +  A Q+FFL++I+ G++ +S G  E+G++ L  A++VCG PQ LL+V +QTL P  + MLL  LP + +++   +  QE
Sbjct:    1 MIASRTGAITAGICGAVFIGYCVYFDRKRRSDPDFKKKLRENGESGVCEERSGMV-KLPDIKDTEAVQKFFLQEIQLGEEMLSQGEFEQGVEHLTNAVAVCGQPQQLLQVLQQTLPPPVFQMLLQKLPTIGQRIVSRSTLQE 141          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Nematostella
Match: EDO48647 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJB2])

HSP 1 Score: 107.457 bits (267), Expect = 1.186e-28
Identity = 60/132 (45.45%), Postives = 86/132 (65.15%), Query Frame = 2
Query:  119 MSSKYIVAVGAGVA---FISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKE 505
            MSS  I  V AGV    F++YCIYFDYKRRS PD+KKKL EKR  ++E         +PD+ +  A Q+FFLE+++ G+  ++ G  E  ++ L  A++VCG PQ LL+VF+QTL P  + ML+  + +MK+
Sbjct:    1 MSSSQIATVVAGVCGSMFLAYCIYFDYKRRSDPDYKKKLIEKRAQRQEADAADMQSRIPDLTDTAAVQKFFLEEVQIGEDLLTKGEYESAVKHLTNAVAVCGQPQQLLQVFKQTLPPAVFQMLIDNINQMKD 132          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Nematostella
Match: EDO26196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCM3])

HSP 1 Score: 72.7886 bits (177), Expect = 1.991e-16
Identity = 30/75 (40.00%), Postives = 51/75 (68.00%), Query Frame = 2
Query:  281 LPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKE 505
            +PD+ +  A Q+FFLE+++ G+  ++ G  E  ++ L  A++VCG PQ LL+VF+QTL P  + ML+  + +MK+
Sbjct:    3 IPDLTDTAAVQKFFLEEVQIGEDLLTKGEYESAVKHLTNAVAVCGQPQQLLQVFKQTLPPAVFQMLIDNINQMKD 77          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Medaka
Match: tomm20b (mitochondrial import receptor subunit TOM20 homolog [Source:NCBI gene;Acc:101172049])

HSP 1 Score: 83.5741 bits (205), Expect = 3.676e-19
Identity = 58/134 (43.28%), Postives = 88/134 (65.67%), Query Frame = 2
Query:  119 MSSKYIVAVGAGVA---FISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQV 511
            M      A+ AGV    F+ YCIYFD KRRS P+FK +L+E+R+ QK  K +  +  LPD+ +  A Q+FFLE+I+ G++ ++ G  E+G+  L  A++VCG PQ LL+V +QTL P  + MLL+ LP + +++
Sbjct:    1 MMGSRTSAIAAGVCGALFVGYCIYFDRKRRSDPNFKNRLQERRRKQKAAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPSISQRI 134          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Medaka
Match: TOMM20 (mitochondrial import receptor subunit TOM20 homolog [Source:NCBI gene;Acc:101169311])

HSP 1 Score: 78.1814 bits (191), Expect = 3.321e-17
Identity = 53/126 (42.06%), Postives = 82/126 (65.08%), Query Frame = 2
Query:  134 IVAVGAGVAFISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQV 511
            +VA   G  F++YC YFD KRRS P FK+KLRE++  Q+   +   +   PD+ +  A Q+FFL++I  G++ +S G  E+G+  L  A++VCG PQ LL+V +QTL P  + MLL+ LP + +++
Sbjct:    9 VVAGVCGAVFVAYCFYFDRKRRSDPQFKQKLRERKLKQETCCVVSVLRNFPDLKDAEAVQKFFLKEIELGEELLSQGEFEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRI 134          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Medaka
Match: TOMM20 (mitochondrial import receptor subunit TOM20 homolog [Source:NCBI gene;Acc:101169311])

HSP 1 Score: 77.411 bits (189), Expect = 5.543e-17
Identity = 53/126 (42.06%), Postives = 81/126 (64.29%), Query Frame = 2
Query:  134 IVAVGAGVAFISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQV 511
            +VA   G  F++YC YFD KRRS P FK+KLRE+R+    + +       PD+ +  A Q+FFL++I  G++ +S G  E+G+  L  A++VCG PQ LL+V +QTL P  + MLL+ LP + +++
Sbjct:    9 VVAGVCGAVFVAYCFYFDRKRRSDPQFKQKLRERRRKLNSSNINSGESKFPDLKDAEAVQKFFLKEIELGEELLSQGEFEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRI 134          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Medaka
Match: TOMM20 (mitochondrial import receptor subunit TOM20 homolog [Source:NCBI gene;Acc:101169311])

HSP 1 Score: 69.707 bits (169), Expect = 2.591e-14
Identity = 50/126 (39.68%), Postives = 78/126 (61.90%), Query Frame = 2
Query:  134 IVAVGAGVAFISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQV 511
            +VA   G  F++YC YFD KRRS P FK+KLRE++             +  ++ +  A Q+FFL++I  G++ +S G  E+G+  L  A++VCG PQ LL+V +QTL P  + MLL+ LP + +++
Sbjct:    9 VVAGVCGAVFVAYCFYFDRKRRSDPQFKQKLRERK-------------SYSNLKDAEAVQKFFLKEIELGEELLSQGEFEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRI 121          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Medaka
Match: TOMM20 (mitochondrial import receptor subunit TOM20 homolog [Source:NCBI gene;Acc:101169311])

HSP 1 Score: 53.5286 bits (127), Expect = 7.631e-9
Identity = 33/86 (38.37%), Postives = 50/86 (58.14%), Query Frame = 2
Query:  113 LVMSSKYIVAVGA-GVAFISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGA 367
            ++   K  V  G  G  F++YC YFD KRRS P FK+KLRE+R+    + +       PD+ +  A Q+FFL++I  G++ +S G 
Sbjct:    1 MISGGKSAVVAGVCGAVFVAYCFYFDRKRRSDPQFKQKLRERRRKLNSSNINSGESKFPDLKDAEAVQKFFLKEIELGEELLSQGG 86          
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Planmine SMEST
Match: SMESG000047476.1 (SMESG000047476.1)

HSP 1 Score: 276.559 bits (706), Expect = 7.770e-94
Identity = 151/151 (100.00%), Postives = 151/151 (100.00%), Query Frame = 2
Query:  119 MSSKYIVAVGAGVAFISYCIYFDYKRRSHPDFXXXXXXXXXXXXXXXXXIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQVDELTKKQEKFSITITEEPLE 571
            MSSKYIVAVGAGVAFISYCIYFDYKRRSHPDFKKKLREKRKNQKENKMKIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQVDELTKKQEKFSITITEEPLE
Sbjct:    1 MSSKYIVAVGAGVAFISYCIYFDYKRRSHPDFKKKLREKRKNQKENKMKIRIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGNPQSLLKVFEQTLGPQAYDMLLSTLPKMKEQVDELTKKQEKFSITITEEPLE 151          
The following BLAST results are available for this feature:
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TOMM202.257e-1945.11translocase of outer mitochondrial membrane 20 [So... [more]
TOMM20L2.954e-1542.20translocase of outer mitochondrial membrane 20 lik... [more]
back to top
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tomm-205.378e-1936.43Mitochondrial import receptor subunit TOM20 homolo... [more]
back to top
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Tom204.087e-1838.81gene:FBgn0036928 transcript:FBtr0332719[more]
Tom204.087e-1838.81gene:FBgn0036928 transcript:FBtr0074903[more]
tomboy208.737e-1230.33gene:FBgn0037828 transcript:FBtr0082316[more]
back to top
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tomm20b3.253e-1944.78translocase of outer mitochondrial membrane 20b [S... [more]
tomm20a1.092e-1846.03translocase of outer mitochondrial membrane 20 [So... [more]
tomm20a1.098e-1846.03translocase of outer mitochondrial membrane 20 [So... [more]
tomm20b2.436e-1038.74translocase of outer mitochondrial membrane 20b [S... [more]
back to top
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
fyn2.580e-1842.96FYN proto-oncogene, Src family tyrosine kinase [So... [more]
fyn8.425e-1844.85FYN proto-oncogene, Src family tyrosine kinase [So... [more]
fyn1.456e-1743.61FYN proto-oncogene, Src family tyrosine kinase [So... [more]
back to top
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tomm202.189e-1945.11translocase of outer mitochondrial membrane 20 [So... [more]
Tomm20l2.919e-1130.95translocase of outer mitochondrial membrane 20-lik... [more]
back to top
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RA31|TOM20_PONAB1.084e-1845.11Mitochondrial import receptor subunit TOM20 homolo... [more]
sp|Q15388|TOM20_HUMAN1.084e-1845.11Mitochondrial import receptor subunit TOM20 homolo... [more]
sp|A6H7B1|TOM20_BOVIN1.084e-1845.11Mitochondrial import receptor subunit TOM20 homolo... [more]
sp|Q62760|TOM20_RAT1.532e-1845.11Mitochondrial import receptor subunit TOM20 homolo... [more]
sp|Q9DCC8|TOM20_MOUSE1.532e-1845.11Mitochondrial import receptor subunit TOM20 homolo... [more]
back to top
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A7RJB28.573e-2545.45Predicted protein OS=Nematostella vectensis OX=453... [more]
A0A448WFG91.995e-2444.03Uncharacterized protein OS=Protopolystoma xenopodi... [more]
J9Q4343.052e-2446.88Mitochondrial inmport receptor subunit TOM20 OS=Os... [more]
K1PSL31.486e-2346.88Mitochondrial import receptor subunit TOM20-like p... [more]
A0A0D9S9U52.314e-2345.11Uncharacterized protein OS=Chlorocebus sabaeus OX=... [more]
back to top
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tomm20b2.541e-1946.83mitochondrial import receptor subunit TOM20 homolo... [more]
tomm20a4.053e-1943.28mitochondrial import receptor subunit TOM20 homolo... [more]
back to top
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tomm20b6.946e-1940.85translocase of outer mitochondrial membrane 20b [S... [more]
back to top
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO486471.186e-2845.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO261961.991e-1640.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tomm20b3.676e-1943.28mitochondrial import receptor subunit TOM20 homolo... [more]
TOMM203.321e-1742.06mitochondrial import receptor subunit TOM20 homolo... [more]
TOMM205.543e-1742.06mitochondrial import receptor subunit TOM20 homolo... [more]
TOMM202.591e-1439.68mitochondrial import receptor subunit TOM20 homolo... [more]
TOMM207.631e-938.37mitochondrial import receptor subunit TOM20 homolo... [more]
back to top
BLAST of Mitochondrial import receptor subunit TOM20 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000047476.17.770e-94100.00SMESG000047476.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008103 ID=SMED30008103|Name=Mitochondrial import receptor subunit TOM20 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1040bp
CATTAATAAATGCTACGTATAAAGAATAAAATTAAAAATTTTTAAAACTA
ATTTATGGATAAAATTAGATATTGTTTGTTTTAAAAATTTCTTCATAGCA
GAATTTCAATTACTCGTAATGTCTTCAAAGTATATAGTTGCAGTAGGTGC
TGGTGTTGCATTCATTTCGTATTGTATATATTTTGATTATAAACGAAGAA
GTCATCCGGATTTTAAAAAGAAATTACGTGAAAAACGAAAGAATCAAAAG
GAAAATAAAATGAAAATAAGGATACCTACTCTACCTGATATGAACAATAA
TGTTGCAAGACAAGAATTCTTTCTCGAACAAATTCGTTTTGGAGATCAGT
GTATGTCTTCTGGAGCATGTGAAGAAGGTATTCAGAGATTAGCACTGGCT
TTAAGTGTTTGCGGTAATCCACAGAGCTTACTTAAAGTTTTTGAACAGAC
ATTAGGACCACAAGCATACGATATGCTTTTGAGTACTCTACCGAAAATGA
AAGAACAAGTTGATGAGTTAACTAAAAAACAAGAAAAATTTTCTATTACT
ATAACCGAAGAACCTTTGGAATAATCAAATAAATTAAATATTATTAAATC
GTGAAATATACATTTTAGCTGATTTAGTTTTGATATATTATGATGCAACT
GATAAAAAGATATGAAATTGCTCAGTTTAGAATTTCATTATTCATTGTGA
ATATCCCCAGGCGGTTTCTGACTACGGTTTCTGAATTATTTCGATAACAT
GTATATTAGTAGTTTGAATAAAGCGTAGTCCAACACTTCCTCAATCTAAT
TAATAATAATGTGGCACATATTTCAAGCCAATTTGTTCATTCAAATGTTG
ATGCATGACTCTTGGTTTTTTTTATATGTTCATGATATTGTGTGCAACAG
TGTTATATAAACCCATCTATATTGATACTTTTTAATTTTCAAGTGATATT
GAGCTATTAAGATATAAATATTTACGTCCATAAACAAGTATTGTATTTTT
CACTAAAAGGTATATAAATAAATTGTGCATGTTTCCTTTG
back to top

protein sequence of SMED30008103-orf-1

>SMED30008103-orf-1 ID=SMED30008103-orf-1|Name=SMED30008103-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=152bp
MSSKYIVAVGAGVAFISYCIYFDYKRRSHPDFKKKLREKRKNQKENKMKI
RIPTLPDMNNNVARQEFFLEQIRFGDQCMSSGACEEGIQRLALALSVCGN
PQSLLKVFEQTLGPQAYDMLLSTLPKMKEQVDELTKKQEKFSITITEEPL
E*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR002056MAS20
IPR022422MAS20_rcpt_metazoan
IPR023392Tom20_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006886intracellular protein transport
GO:0006605protein targeting
GO:0006626protein targeting to mitochondrion
GO:0006810transport
GO:0015031protein transport
GO:0071806protein transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0005742mitochondrial outer membrane translocase complex
GO:0005739mitochondrion
GO:0005740mitochondrial envelope
GO:0005741mitochondrial outer membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0031012extracellular matrix
GO:0044233ER-mitochondrion membrane contact site
Vocabulary: molecular function
TermDefinition
GO:0015450P-P-bond-hydrolysis-driven protein transmembrane transporter activity
GO:0051082unfolded protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR022422Protein import receptor MAS20, metazoanPRINTSPR01989EUOM20RECPTRcoord: 90..99
score: 47.5
coord: 101..113
score: 60.9
coord: 71..85
score: 25.56
coord: 56..69
score: 49.4
coord: 1..18
score: 30.09
coord: 30..46
score: 56.86
coord: 117..134
score: 27.31
IPR002056Protein import receptor MAS20PRINTSPR00351OM20RECEPTORcoord: 56..78
score: 26.0
coord: 17..38
score: 58.27
coord: 93..113
score: 38.67
IPR002056Protein import receptor MAS20PIRSFPIRSF037707TOM20coord: 1..148
e-value: 1.3E-31
score: 107.2
IPR002056Protein import receptor MAS20PFAMPF02064MAS20coord: 11..121
e-value: 3.1E-33
score: 114.6
IPR002056Protein import receptor MAS20PANTHERPTHR12430MITOCHONDRIAL IMPORT RECEPTOR SUBUNIT TOM20coord: 6..139
IPR023392Mitochondrial outer membrane translocase complex, Tom20 domain superfamilyGENE3DG3DSA:1.20.960.10coord: 50..141
e-value: 6.2E-25
score: 88.8
IPR023392Mitochondrial outer membrane translocase complex, Tom20 domain superfamilySUPERFAMILYSSF47157Mitochondrial import receptor subunit Tom20coord: 52..132
NoneNo IPR availableTMHMMTMhelixcoord: 5..22