ANK_REP_REGION domain-containing protein

Overview
NameANK_REP_REGION domain-containing protein
Smed IDSMED30008102
Length (bp)1426
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ANK_REP_REGION domain-containing protein (SMED30008102) t-SNE clustered cells

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30008102) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ANK_REP_REGION domain-containing protein (SMED30008102) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30008102) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008102

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30008102h1SMcG0004433 dd_Smed_v4_10280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008102h1SMcG0004433 dd_Smed_v4_10280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008102h1SMcG0004433 dd_Smed_v4_10280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30008102h1SMcG0004433 dd_Smed_v4_10280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008102h1SMcG0004433 Contig39267uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008102h1SMcG0004433 Contig39267newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30008102h1SMcG0004433 dd_Smed_v4_10280_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A2C9JP94 (ANK_REP_REGION domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106062008 PE=4 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 7.878e-23
Identity = 53/129 (41.09%), Postives = 87/129 (67.44%), Query Frame = 1
Query:  229 QTPLILCSLIEDPSWGISLAQLLLELGADIERADDNKMNVLHYCAIYXXXXXXXXXXXSVDFNINKGDILGNSPLIYAIVSENEDVTNMFIQYYLRYQIDFDKANFRGINAYMQACLRGHLDLIETLEK 615
            +TPL+LC+ ++ P WG S+A  L+E GAD+ + D  + NVLHY  IY++ +L+++LL++VDF++N+ D +GN+PL YA +S N  +  + IQ + RY+I   K N RG  A  +A L GH+   + +++
Sbjct:   46 RTPLLLCAFMQPPDWGASIAMTLIEHGADMSQRDCLERNVLHYACIYERVKLVRILLKAVDFDLNQADYVGNTPLHYAAMSGNVAIAQLLIQSFKRYRISLSKRNHRGRTALDEALLSGHVPCTQVIQE 174          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1S3KG74 (uncharacterized protein LOC106181577 OS=Lingula unguis OX=7574 GN=LOC106181577 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.192e-19
Identity = 70/231 (30.30%), Postives = 120/231 (51.95%), Query Frame = 1
Query:   97 VTGTMNNLKYSSDICKLILKGYFAQAKDKIXXXXXXXXXXXXXXQTPLILCSLIEDPSWGISLAQLLLELGADIERADDNKMNVLHYCAIYXXXXXXXXXXXSVDFNINKGDILGNSPLIYAIVSENEDVTNMFIQYYLRYQIDFDKANFRGINAYMQACLRGHLDLIETL--EKFGINKNAKDSTGTTALMYKRNAIIKFDLNHQVNESRRRSRMVRFDDIEQVLALQRQ 783
            +TG    + Y+  I   I +G+F Q +  I+  +    +  +   TPLILC++IE+  WG+ L++LLLE GA +   D   +N LHY  +YQ+ EL+++ L ++D+++N+GD  GN+ L YA+   N D+T + ++   +Y +  DK N RG    +QA   G +   + L  E     + A    G TA  ++   + K +    +N   RR+R      +     L+R+
Sbjct:    1 MTGKGGKMDYT--INTAIKRGFFQQVRFLIELGSDVNGKDEDGL-TPLILCAMIEEEEWGVGLSRLLLEKGASVGFRDKRGLNALHYACLYQRLELVRVFLCAIDYDLNQGDKFGNTALHYAVSVGNVDITRLLLRTLQKYGMTVDKPNRRGFTPLIQAWSTGRVTCAQILVDEGHADQETADKVEGKTAKEWETEVLAKMN-KLVINPKVRRNRPSTASRVSSAPILRRR 227          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1S3IN40 (uncharacterized protein LOC106165608 OS=Lingula unguis OX=7574 GN=LOC106165608 PE=4 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 2.070e-19
Identity = 67/214 (31.31%), Postives = 114/214 (53.27%), Query Frame = 1
Query:   97 VTGTMNNLKYSSDICKLILKGYFAQAKDKIXXXXXXXXXXXXXXQTPLILCSLIEDPSWGISLAQLLLELGADIERADDNKMNVLHYCAIYXXXXXXXXXXXSVDFNINKGDILGNSPLIYAIVSENEDVTNMFIQYYLRYQIDFDKANFRGINAYMQACLRGHLDLIETL--EKFGINKNAKDSTGTTALMYKRNAIIKFD---LNHQVNESR 723
            +TG    + Y+  I   I +G+F Q +  I+  +    +  +   TPLILC++IE+  WG+ L++LLLE GA +   D   +N LHY  +YQ+ EL+++ L ++D+++N+GD  GN+ L YA+   N D+T + ++   +Y +  DK N RG    +QA   G +   + L  E     + A    G TA  ++   + K +   +N +V   R
Sbjct:    1 MTGKGGKMDYT--INTAIKRGFFQQVRFLIELGSDVNGKDEDGL-TPLILCAMIEEEEWGVGLSRLLLEKGASVGFRDKRGLNALHYACLYQRLELVRVFLCAIDYDLNQGDKFGNTALHYAVSVGNVDITRLLLRTLHKYGMTVDKPNRRGFTPLIQAWSTGRVTCAQILVDEGHADQETADKVEGKTAKEWETEVLAKMNKLVINPKVRRHR 211          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: W4YP41 (ANK_REP_REGION domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.386e-16
Identity = 54/172 (31.40%), Postives = 90/172 (52.33%), Query Frame = 1
Query:  130 SDICKLILKGYFAQAKDKIXXXXXXXXXXXXXXQTPLILCSLIEDPSWGISLAQLLLELGADIERADDNKMNVLHYCAIYXXXXXXXXXXXSVDFNINKGDILGNSPLIYAIVSENEDVTNMFIQYYLRYQIDFDKANFRGINAYMQACLRGHLDLIETLEKFGINKNAKDS 645
             D+   ILKG F   +  +        +     +TPL+LC++IE   WG+ +A+LLL  GA +  +D    N L    I+ + EL+K+ L++VD++ N+ D   N+ L YA  +  E V    I+  L +++  DK N  G+   ++AC +GH  + + LE  G +   KD+
Sbjct:   10 PDLHLAILKGQFQDIRYLVTTGEDVNIQDPAEHRTPLMLCAMIEQEDWGVGIARLLLANGAMVGYSDRRGQNALMTACIFGRTELVKVFLKAVDYDPNQRDRYSNTALFYAASNGKEGVVEAVIKSLLHFKLPLDKPNKWGMTPLLEACRQGHERVAQMLEDHGASTEVKDA 181          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: W4YUQ6 (ANK_REP_REGION domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.504e-16
Identity = 54/172 (31.40%), Postives = 90/172 (52.33%), Query Frame = 1
Query:  130 SDICKLILKGYFAQAKDKIXXXXXXXXXXXXXXQTPLILCSLIEDPSWGISLAQLLLELGADIERADDNKMNVLHYCAIYXXXXXXXXXXXSVDFNINKGDILGNSPLIYAIVSENEDVTNMFIQYYLRYQIDFDKANFRGINAYMQACLRGHLDLIETLEKFGINKNAKDS 645
             D+   ILKG F   +  +        +     +TPL+LC++IE   WG+ +A+LLL  GA +  +D    N L    I+ + EL+K+ L++VD++ N+ D   N+ L YA  +  E V    I+  L +++  DK N  G+   ++AC +GH  + + LE  G +   KD+
Sbjct:   10 PDLHLAILKGQFQDIRYLVTTGEDVNIQDPAEHRTPLMLCAMIEQEDWGVGIARLLLANGAMVGYSDRRGQNALMTACIFGRTELVKVFLKAVDYDPNQRDRYSNTALFYAASNGKEGVVEAVIKSLLHFKLPLDKPNKWGMTPLLEACRQGHERVAQMLEDHGASTEVKDA 181          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ANKRD63 (ankyrin repeat domain 63 [Source:NCBI gene;Acc:103036281])

HSP 1 Score: 55.0694 bits (131), Expect = 9.491e-8
Identity = 41/173 (23.70%), Postives = 76/173 (43.93%), Query Frame = 1
Query:  229 QTPLILCSLIEDPSWGISLAQLLLELGADIERADDNKMNVLHY-CAIYXXXXXXXXXXXSVDFNINKGDILGNSPLIYAIVSENEDVTNMFIQYYLRYQIDFDKANFRGINAYMQACLRGHLDLIETLEKFGINKNAKDSTGTTALMYKRNAIIKFDLNHQVNESRRRSRMVR 744
            +TPL+    ++DP        LLLE GAD+   D++    L   C +     +  L+  + D  +   D  GNS L+YA    +  +    ++ + R+ +  D  N  G +A   A   GH   ++ L     N   K  TG+   M +++  ++     +  E+R+ +R+ +
Sbjct:   48 RTPLMYAVSLQDPGTRSKFTHLLLEKGADVNSRDEHGRTALSLACELGHLDAVKILVQFNADPEVT--DTWGNSALMYAAYGGHNQILEFLMRAFKRFGLKLDHTNQAGHSAVQVAEYLGHTQCVQVL-----NGAGKKGTGSAEQMEEKDGELQ---GGERGETRQPNRLPK 210          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO33642 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRL7])

HSP 1 Score: 57.3806 bits (137), Expect = 8.583e-9
Identity = 44/154 (28.57%), Postives = 74/154 (48.05%), Query Frame = 1
Query:  130 SDICKLILKGYFAQAKDKIXXXXXXXXXXXXXXQTPLILCSLIEDPSWGISLAQLLLELGADIERADDNKMNVLHYCAIYXXXXXXXXXXXSVDFNINKGDILGNSPLIYAIVSENEDVTNMFIQYYLRYQI-DFDKANFRGINAYMQACLRGH 588
            S + K + +  F QAK  ++  +   + + E  ++PL+  SLIED      +   LL+ GADI   DD+ MN   +     +  +  L L+  DF++N  D  GN+ L YA+++ +   T+  +    + +I   DK N  G    + A   GH
Sbjct:    2 SSLAKALEERRFRQAKLLVQLGDDLNSRSKETGRSPLVQASLIEDEDLSYKVCHWLLQEGADIAVRDDHGMNAFMHVCRQGRTRIAALFLKHRDFDLNTQDFEGNTALSYAVIAGDISTTSAIVAELRKRRIRGADKQNKNGETPLIIAAKLGH 155          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO41179 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S546])

HSP 1 Score: 54.299 bits (129), Expect = 5.857e-8
Identity = 39/131 (29.77%), Postives = 67/131 (51.15%), Query Frame = 1
Query:  229 QTPLILCSLIEDPSWGISLAQLLLELGADIERADDNKMNVLHYCAIYXXXXXXXXXXXSVDFNINKGDILGNSPLIYAIVSENEDVTNMFIQYYLRYQIDFDKANFRGINAYMQACLRGHLDLIETLEKFG 621
            +TPL+    +++     S+A+LLLE G ++   D      L Y  I ++K+LLK L   VD+++N  D+ GN+ L YAI++ +E V    ++    Y +  D  N +G    + A      D+ + L + G
Sbjct:   34 RTPLMELCFVDNEDKACSMAKLLLENGGNVGIKDKQGKTALSYACILKKKKLLKWLTRFVDYDLNSTDLDGNTALNYAILAGDETVVMELVRKLKAYGLTVDTINRKGETPLINALKSERTDIADILLEIG 164          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000034080.1 (SMESG000034080.1)

HSP 1 Score: 766.533 bits (1978), Expect = 0.000e+0
Identity = 408/410 (99.51%), Postives = 409/410 (99.76%), Query Frame = 1
Query:  109 MNNLKYSSDICKLILKGYFAQAKDKIXXXXXXXXXXXXXXQTPLILCSLIEDPSWGISLAQLLLELGADIERADDNKMNVLHYCAIYXXXXXXXXXXXSVDFNINKGDILGNSPLIYAIVSENEDVTNMFIQYYLRYQIDFDKANFRGINAYMQACLRGHLDLIETLEKFGINKNAKDSTGTTALMYKRNAIIKFDLNHQVNESRRRSRMVRFDDIEQVLALQRQTMDLITDSHKLTNFVDENFDKVTQMKANVKKVKQNKIDMYYINKSYVNSKDICGNIVVNDNLTIRKIRPQTAFFTSKDLLKQNNWYSLLGPLCTSLEQQYSPSYKSFTKSESSNIDLTDSFSGKSKVRQRKLSRSLASHSRRNSIASRGTTNXXXXXXGINSNKTKKKLESVISAKTICRNISRM 1338
            MNNLKYSSDICKLILKGYFAQAKDKIKNTNVDVNETNENKQTPLILCSLIEDPSWGISLAQLLLELGADIERADDNKMNVLHYCAIYQQKELLKLLLESVDFNINKGDILGNSPLIYAIVSENEDVTNMFIQYYLRYQIDFDKANFRGINAYMQACLRGHLDLIETLEKFGINKNAKDSTGTTALMYKRNAIIKFDLNHQVNESRRRSRMVRFDDIEQVLALQRQTMDLITDSHKLTNFVDENFDKVTQMKANVKKVKQNKIDMYY+NKSYVNSKDICGNIVVNDNLTIRKIRPQTAFFTSKDLLKQNNWYSLLGPLCTSLEQQYSPSYKSFTKSESSNIDLTDSFSGKSKVRQRKLSRSLASHSRRNSIASRG TNDDSSDSGINSNKTKKKLESVISAKTICRNISRM
Sbjct:    1 MNNLKYSSDICKLILKGYFAQAKDKIKNTNVDVNETNENKQTPLILCSLIEDPSWGISLAQLLLELGADIERADDNKMNVLHYCAIYQQKELLKLLLESVDFNINKGDILGNSPLIYAIVSENEDVTNMFIQYYLRYQIDFDKANFRGINAYMQACLRGHLDLIETLEKFGINKNAKDSTGTTALMYKRNAIIKFDLNHQVNESRRRSRMVRFDDIEQVLALQRQTMDLITDSHKLTNFVDENFDKVTQMKANVKKVKQNKIDMYYMNKSYVNSKDICGNIVVNDNLTIRKIRPQTAFFTSKDLLKQNNWYSLLGPLCTSLEQQYSPSYKSFTKSESSNIDLTDSFSGKSKVRQRKLSRSLASHSRRNSIASRGATNDDSSDSGINSNKTKKKLESVISAKTICRNISRM 410          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000077536.1 (SMESG000077536.1)

HSP 1 Score: 57.7658 bits (138), Expect = 7.675e-9
Identity = 37/118 (31.36%), Postives = 65/118 (55.08%), Query Frame = 1
Query:  127 SSDICKLILKGYFAQAKDKIXXXXXXXXXXXXXXQTPLILCSLIEDPSWGISLAQLLLELGADIERADDNKMNVLHYCAIYXXXXXXXXXXXSVDFNINKGDILGNSPLIYAIVSENE 480
            +S   + I +G F Q ++ +        +     +T ++LC+ + D  W  SL+  LLE GA I++ D+   N LH+  I  +K+L+++ L S DF+IN  +  G + L YA+ SE++
Sbjct:   13 ASSPAEAIYRGLFKQVRELLNKEADPDEKIKS--KTAIMLCTFLTDTFWAKSLSFTLLEYGAKIDKKDEYGFNALHFSVIKNKKDLVEIFLNSFDFDINSKNNFGFTALHYAVNSESK 128          
The following BLAST results are available for this feature:
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JP947.878e-2341.09ANK_REP_REGION domain-containing protein OS=Biomph... [more]
A0A1S3KG741.192e-1930.30uncharacterized protein LOC106181577 OS=Lingula un... [more]
A0A1S3IN402.070e-1931.31uncharacterized protein LOC106165608 OS=Lingula un... [more]
W4YP411.386e-1631.40ANK_REP_REGION domain-containing protein OS=Strong... [more]
W4YUQ61.504e-1631.40ANK_REP_REGION domain-containing protein OS=Strong... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ANKRD639.491e-823.70ankyrin repeat domain 63 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO336428.583e-928.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411795.857e-829.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000034080.10.000e+099.51SMESG000034080.1[more]
SMESG000077536.17.675e-931.36SMESG000077536.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008102 ID=SMED30008102|Name=ANK_REP_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1426bp
AAGCAACTGTTTTATTATTGTAATTTTTGTTACTTACAACTCTTTCAATA
ATATTGTACATTTGACTGTCTGATTTATCTTATGCTATTTTAAGTTGTCA
CTGGAACAATGAATAACCTAAAATACAGCTCAGACATTTGCAAGCTCATT
CTTAAAGGTTATTTTGCTCAGGCTAAAGATAAAATTAAAAACACAAATGT
CGATGTTAATGAAACCAATGAAAACAAACAAACTCCGTTGATCCTATGTT
CTTTAATAGAAGATCCTTCATGGGGAATCAGTTTAGCGCAACTTCTCCTG
GAACTTGGAGCTGACATTGAGCGTGCCGATGACAATAAGATGAACGTCCT
ACATTACTGTGCAATTTACCAACAGAAGGAGTTATTAAAACTGCTACTCG
AATCTGTCGATTTTAACATTAACAAAGGAGATATTCTTGGCAACAGTCCA
CTAATTTATGCTATTGTTTCGGAAAATGAAGACGTGACCAATATGTTTAT
TCAGTATTATCTAAGATATCAAATAGATTTCGACAAAGCCAATTTTCGAG
GAATCAACGCATATATGCAAGCCTGTCTGAGAGGTCATTTAGATTTAATA
GAGACTTTGGAAAAATTTGGTATTAATAAAAATGCAAAAGATTCTACCGG
GACGACTGCTTTGATGTATAAAAGAAATGCAATTATTAAGTTTGACTTGA
ATCATCAAGTTAATGAAAGTCGAAGGCGATCAAGAATGGTGAGATTCGAC
GACATTGAACAGGTTTTGGCATTACAACGGCAAACAATGGATTTAATAAC
CGACTCCCATAAATTGACAAATTTCGTTGACGAAAATTTTGACAAAGTCA
CCCAGATGAAAGCAAATGTAAAAAAAGTTAAACAAAACAAAATTGACATG
TACTATATTAACAAAAGTTACGTCAACTCAAAAGATATCTGTGGAAACAT
TGTAGTCAATGATAATTTAACAATAAGGAAAATTCGTCCGCAAACTGCAT
TTTTTACTTCCAAAGATTTATTGAAACAGAATAACTGGTATTCTTTGCTC
GGACCTTTATGCACCAGTCTTGAACAGCAGTATTCTCCATCTTACAAGAG
TTTCACAAAGTCTGAATCTTCAAATATTGATCTAACTGATTCGTTTAGCG
GGAAATCAAAGGTTAGGCAAAGGAAGTTGAGTAGATCATTAGCATCTCAC
AGCCGACGAAACTCAATTGCTAGTCGTGGAACAACAAATGATGATTCTTC
AGACAGTGGTATTAATTCAAACAAAACAAAGAAAAAGTTGGAAAGCGTTA
TTTCAGCGAAAACGATTTGTCGAAATATCAGTAGAATGAGTTCAAATAAT
TCTTTATTATGAAATGCAAATAATATTTTCTCTTTGATTTTTTTGGAAAT
TCAATAAAAGCGAGCTAAAATTTGGT
back to top

protein sequence of SMED30008102-orf-1

>SMED30008102-orf-1 ID=SMED30008102-orf-1|Name=SMED30008102-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=418bp
MNNLKYSSDICKLILKGYFAQAKDKIKNTNVDVNETNENKQTPLILCSLI
EDPSWGISLAQLLLELGADIERADDNKMNVLHYCAIYQQKELLKLLLESV
DFNINKGDILGNSPLIYAIVSENEDVTNMFIQYYLRYQIDFDKANFRGIN
AYMQACLRGHLDLIETLEKFGINKNAKDSTGTTALMYKRNAIIKFDLNHQ
VNESRRRSRMVRFDDIEQVLALQRQTMDLITDSHKLTNFVDENFDKVTQM
KANVKKVKQNKIDMYYINKSYVNSKDICGNIVVNDNLTIRKIRPQTAFFT
SKDLLKQNNWYSLLGPLCTSLEQQYSPSYKSFTKSESSNIDLTDSFSGKS
KVRQRKLSRSLASHSRRNSIASRGTTNDDSSDSGINSNKTKKKLESVISA
KTICRNISRMSSNNSLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004222metalloendopeptidase activity
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0008168methyltransferase activity
GO:0016740transferase activity
GO:0031625ubiquitin protein ligase binding
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0016567protein ubiquitination
GO:0032259methylation
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0000151ubiquitin ligase complex
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 19..39
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 356..389
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 363..384
NoneNo IPR availablePANTHERPTHR24173:SF41coord: 12..176
NoneNo IPR availablePANTHERPTHR24173FAMILY NOT NAMEDcoord: 12..176
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 110..141
e-value: 160.0
score: 10.9
coord: 39..72
e-value: 1300.0
score: 4.1
coord: 147..176
e-value: 12.0
score: 14.8
coord: 76..106
e-value: 0.079
score: 22.1
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 147..179
score: 8.576
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 59..133
e-value: 9.4E-9
score: 35.7
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 30..187
score: 24.321
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 8..132
e-value: 1.4E-18
score: 68.9
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 133..213
e-value: 1.4E-8
score: 36.4
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 15..187