USP domain-containing protein

Overview
NameUSP domain-containing protein
Smed IDSMED30008099
Length (bp)1738
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of USP domain-containing protein (SMED30008099) t-SNE clustered cells

Violin plots show distribution of expression levels for USP domain-containing protein (SMED30008099) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of USP domain-containing protein (SMED30008099) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for USP domain-containing protein (SMED30008099) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008099

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30008099h1SMcG0000846 dd_Smed_v4_3740_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30008099h1SMcG0000846 dd_Smed_v6_3740_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30008099h1SMcG0000846 dd_Smed_v4_3740_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008099h1SMcG0000846 dd_Smed_v4_16031_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of USP domain-containing protein vs. Ensembl Zebrafish
Match: usp3 (ubiquitin specific peptidase 3 [Source:ZFIN;Acc:ZDB-GENE-030131-5142])

HSP 1 Score: 50.0618 bits (118), Expect = 6.889e-6
Identity = 61/273 (22.34%), Postives = 107/273 (39.19%), Query Frame = 3
Query:  330 LKNLGKNCYLNSALQAVSSGDKFFTDVRSL--VSQYPPELKNLNVFHN-----------------LIHILNGGQSK----ALIISKNKIFENWNKSNHQDSFELLAFVFNEVYNEIRKYKENQGEIPKY--------------NITQWLMIRLPMRIVFSNDIYCK-CGLVYS--SPLQCDLALHIPVPI----------SETCSLQSLVDKFFLIEPI---ENYLCDDVKCIGEAYKKTRLLAPIPNTICIHLQKSHWTGAKLEKIKNKIQF 989
            L+NLG  C++N+ LQ++S+   F    + L  V+    +     ++H                  L  +  G Q+     AL     KI  ++     QD+ E L ++ + ++ E++  K      P                N T  ++  +    V  N++YC  CG       P   DL+L IP               TC+L   +  F  +E +   E Y+C   K   ++ KK   +  +P  +C+HL++ HWT     K+   ++F
Sbjct:  165 LRNLGNTCFMNAILQSLSNIQVFSCYFKELPSVALRSGKTAGRRMYHTRSQGDSSVSLVEEFRKTLCSLWQGSQTAFSPDALFYVIWKIMPSFRGYQQQDAHEFLRYLLDHLHREMQGNKNGSPSPPVTSDEPNHASESKCFINGTSTIVTSV-FGGVLQNEVYCLICGTESRKFDPFL-DLSLDIPNQFRIKTTKDQEPGPTCTLSDCLRSFTDLEELDETELYMCHKCKKRQKSTKKF-WIQKLPKVLCLHLKRFHWTAFLRNKVDTYVEF 434          
BLAST of USP domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000054948.1 (ubiquitin specific peptidase 32 [Source:NCBI gene;Acc:100487551])

HSP 1 Score: 53.5286 bits (127), Expect = 9.008e-7
Identity = 82/314 (26.11%), Postives = 127/314 (40.45%), Query Frame = 3
Query:  837 ENYLCDDVKCIGEAYKKTRLLAPIPNTICIHLQKSHWTGAKLEKIKNKIQFEK-----TLKIRKEFCFEYQKPDSNQLQTEQATVDTVRINSEGNVDVKYECSNQ--SISGSQEISNIANCKVENDIFIDGKSSIEKHEKINSLSNINQKSIELSEEN------------VASGDDLADQNNEIIGKVNDLSIENQKSINVAGENVVFGNGFVETANLDFCNSENEKENGESQNMRIQNNIEKSNFHIEEHIARDEILTLKSVIVHSGSVYKGHYVCY-KVVGGNWYLTNDXXXXXXXXXXXXXCDAYILFYEK 1718
            E Y C   K    A KK  L   +P  + IHL++  +   +  K +  ++F +     +  +  +   +YQK     LQ E  + DT     EG    K +C N+  S S SQ      NC  +N+       ++ + +    L  I  K +  S+EN            +  G D  D N  + G   +++        V    VV  NG      L++   +N   NG+ +N   +   E S     + I    I  L ++  HSG +  GHYV Y K     WY  ND   K++   E+ +  AYILFYE+
Sbjct:  560 EMYYCSKCKTHCLATKKLDLWR-LPPILIIHLKRFQFVNGRWIKSQKIVKFPRENFDPSAFLVPKGPIQYQK-KQMVLQNEDQS-DTRLTQVEG----KKDCENKISSTSPSQGRKGNINCTSKNNSPNHSPRTLGRGKGRLRLPQIGVKKLSSSKENLDQNKENGTDNEMREGPDTVDSNKGLCGSQGEVA-------TVQDTEVVLTNG------LNY--EQNSCSNGQLENHTGEE--EDSTDDQRDDIGCQPIYNLYAISCHSGILGGGHYVTYAKNPNAKWYCYNDSSCKELHPDEIDTDSAYILFYEQ 849          
BLAST of USP domain-containing protein vs. Ensembl Xenopus
Match: hnrnpd (heterogeneous nuclear ribonucleoprotein D [Source:Xenbase;Acc:XB-GENE-988375])

HSP 1 Score: 51.9878 bits (123), Expect = 2.219e-6
Identity = 74/324 (22.84%), Postives = 134/324 (41.36%), Query Frame = 3
Query:  297 KERKPLIRPIRLKNLGKNCYLNSALQAVSSGDKFFTDVRSLVSQY-----PPELKNLNVFHNLIHIL----NGGQSKALIISKNKIFE-----NWNKSN--HQDSFELLAFVFNEVYN---------------------EIRKYKENQGEIPKYNITQWLMIRLPMRIVFSNDIYCKCGLVYSSPLQCD----LALHIPVPI-SETCSLQSLVDKFFLIEPIENYLCDDVKCIGEA--------------YKKTRLLAPIPNTICIHLQKSHWT--GAKLEKIKNKIQFEKTL-----KIRKEFCFEYQKPDSNQLQTEQATVD 1079
            K RK L+    L NLG  C++NS LQ ++S   F   +    S+Y       E ++L+V   L+H+L    N   ++  ++  + + E      W  S+   QD+ EL   + + + +                     E ++    + ++P Y I      + P     ++++ CK    + SP++ D    L+L IPV       +L   +  F   E +++ +C++   I  A              + K   L  +P  +CIHLQ+  W+  G+ L++    +QF + L     K R   C   ++P ++    EQ T D
Sbjct:   78 KYRKGLV--PGLLNLGNTCFMNSLLQGLASCPSFIRWLADFTSKYRQENNTTEHQHLSV--TLLHLLKALCNQEGTEDEVLDASPLLEVLRAHRWQISSFEEQDAHELFHVLTSSLEDERDRRPHVTHLFDLDSLEFPLEPQRQIHCRTQVPIYPIPSQWKSQHPFHGRLTSNMVCK-HCQHQSPMRYDTFDSLSLSIPVATWGHPITLDQCLQHFISTESVKDVVCENCTKIHAAQIPNSQSVENRKTTFVKQLKLGKLPQCLCIHLQRLSWSNQGSPLKR-NEHVQFSEFLAMDRFKYRISGCSTSKQPANHLSAAEQETTD 395          
BLAST of USP domain-containing protein vs. TrEMBL
Match: A0A1Y2G7S0 (USP domain-containing protein OS=Lobosporangium transversale OX=64571 GN=BCR41DRAFT_210544 PE=3 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.139e-7
Identity = 70/299 (23.41%), Postives = 134/299 (44.82%), Query Frame = 3
Query:  177 ILIYAFDKTSYYSISVKGKMKFKDI----------------FKRNINLKREKSSQCKERKPLIRP---IRLKNLGKNCYLNSALQAVSSGDKFFTDVRSLVSQYPPE----LKNLNVFHNLIHILNGGQSKALIISKNKIFE---NW-NKSNHQDSFELLAFVFNEVYNEIRKYKENQGEIPKYNITQWLMIRLPMRIVFSNDIYC-KCGLVYSSPLQCDLALHIPVPISETCSLQSLVDKFFLIEPIEN-----YLCDDVKCIGEAYKKTRLLAPIPNTICIHLQKSHWTGAKLEKIK 974
            IL+  F  T   S  V+    F D+                +K++++++   S+  + R    +P   + L NLG +C++NSAL+A+    +F   + S   +  P      +    F+NL         +  +++ + +++   NW N  + QD+ E +  +F+++        E +G IPK  ++ +    +       N I C  CG V S+  +    L +P+P ++   LQ+LVD F  IE + +     Y CD  K + +A + T +L  +P  + I L +  +   + ++IK
Sbjct:  163 ILLIHFGDTDAVSTKVQKARAFLDLPVVSRAEALQTMQENSWKKSLHIQ-NTSAGFRRRPAFAQPLGKVGLVNLGNSCFMNSALRALFCSTEFKQSILSDTLKVEPSKVMTTRLRETFNNL------STPRLSVVTPSALYKALPNWLNDGHQQDAAEFIKILFSQL--------EGEGPIPKEALSSFQGTAV-------NQIACGTCGTVSSNKEEF-YDLTVPLPRADIAELQALVDIFPTIEKLNDENNNKYFCDKCKSLQDATRST-ILESVPTNLIISLNRFEFDVVRAQRIK 437          
BLAST of USP domain-containing protein vs. TrEMBL
Match: A0A150G6T8 (USP domain-containing protein OS=Gonium pectorale OX=33097 GN=GPECTOR_53g165 PE=3 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 4.868e-7
Identity = 62/254 (24.41%), Postives = 110/254 (43.31%), Query Frame = 3
Query:  330 LKNLGKNCYLNSALQAVSSGDKFFTDVRSLVSQYPPELKN--LNVFHNLIHILNGGQSKALIISKNKIFENWNKSN-------HQDSFELLAFVFNEVYNEIRKYKEN------------QGEIPKYNITQWLMIRLPMRIVFSNDIYCKCGLVYSSPLQC--DLALHIPVPISETCSLQSLVDKFFLIEPIEN---YLCDDVKCIGEAYKKTRLLAPIPNTICIHLQKSHWTGA--KLEKIKNKIQFEKTLKI 1007
            L+N G  CY NS LQA+     F   V    +  P  ++   LN   +L   +N  + K  +IS  K  +   + N       HQD+ E L ++ N+    + +  +N             G  P+  IT W+      ++V  N+  C    ++   + C  ++ + + + I    SL S +  F  +E ++    + CD   C+ EA KK  LL  +P  + +HL++  +  A  +L K+  ++ F   LK+
Sbjct:   24 LENFGNTCYCNSVLQALYFCKPFRERVLRYGASLPSNVEENLLNCLADLFMQINSSKKKTGVISPKKFVQRLRRDNELFRGHMHQDAHEFLNYLLNQSCELLEQEAKNAQGGGGGGQQAGAGGQPQRPITTWVHEIFQGKLV--NETRC----LHCETVTCREEVFMDLSLEIDNNTSLTSCLRNFSSMEMLDRDDKFFCDHCCCLQEA-KKRMLLRSVPPCLILHLKRFKYVEAQGRLRKLMYRVVFPMELKL 270          
BLAST of USP domain-containing protein vs. TrEMBL
Match: A0A0B0PHZ8 (Ubiquitin carboxyl-terminal hydrolase OS=Gossypium arboreum OX=29729 GN=F383_04645 PE=3 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.481e-6
Identity = 68/254 (26.77%), Postives = 110/254 (43.31%), Query Frame = 3
Query:  300 ERKPLIRPIRLKNLGKNCYLNSALQAVSSGDKFFTDVRSLVSQYPPELKNLNVFHNLI----HILNGGQSKALIISKNKIFENWN-------KSNHQDSFELLAFVFNEVYNEIRKYKENQGEIPKYNITQWLMIRLPMRIVFSNDIYCKCGLVYSS--PLQCDLALHIPVPISETCSLQSLVDKFFLIEPIE----NYLCDDVKCIGEAYKKTRLLAPIPNTICIHLQKSHWTGAKLEKIKNKIQFEKTLKIR 1010
            E KP      L+NLG  C++N+ LQ  +    F   +RSL     P  +++  F  L     HI     S   ++S  KIF+N N       +   +D+ E L  + + + +   K K +   I    + +    RL  R+       C CG V S+  PL  DL+L     I +  SL + ++ F  +E IE    NY C++ K    + +K  +L   P+    HL++    G  +EKI   + F   L ++
Sbjct:  147 EDKPTGVGAGLENLGNTCFINAVLQCFTHTVPFVLGLRSLNHHEKPCDRDMESFCLLCVVRDHIELSLHSSGGVVSPTKIFDNLNYFSSFFQRYQQEDAHEFLQCLLDRLESCCSKLKNDLSSIDDCLVKKVFGGRLVSRLC-----CCNCGHVSSTYEPLN-DLSLE----IEDADSLLTALESFTKVEKIEDLQLNYRCENCK-EQVSVEKQLMLDQAPSVATFHLKRFKTEGTYIEKIDKHVDFPLELDLQ 389          
BLAST of USP domain-containing protein vs. TrEMBL
Match: A0A1U8LCK3 (Ubiquitin carboxyl-terminal hydrolase OS=Gossypium hirsutum OX=3635 GN=LOC107924804 PE=3 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.488e-6
Identity = 68/254 (26.77%), Postives = 110/254 (43.31%), Query Frame = 3
Query:  300 ERKPLIRPIRLKNLGKNCYLNSALQAVSSGDKFFTDVRSLVSQYPPELKNLNVFHNLI----HILNGGQSKALIISKNKIFENWN-------KSNHQDSFELLAFVFNEVYNEIRKYKENQGEIPKYNITQWLMIRLPMRIVFSNDIYCKCGLVYSS--PLQCDLALHIPVPISETCSLQSLVDKFFLIEPIE----NYLCDDVKCIGEAYKKTRLLAPIPNTICIHLQKSHWTGAKLEKIKNKIQFEKTLKIR 1010
            E KP      L+NLG  C++N+ LQ  +    F   +RSL     P  +++  F  L     HI     S   ++S  KIF+N N       +   +D+ E L  + + + +   K K +   I    + +    RL  R+       C CG V S+  PL  DL+L     I +  SL + ++ F  +E IE    NY C++ K    + +K  +L   P+    HL++    G  +EKI   + F   L ++
Sbjct:  147 EDKPTGVGAGLENLGNTCFINAVLQCFTHTVPFVLGLRSLNHHEKPCDRDMESFCLLCVVRDHIELSLHSSGGVVSPTKIFDNLNYFSSFFQRYQQEDAHEFLQCLLDRLESCCSKLKNDLSSIDDCLVKKVFGGRLVSRLCC-----CNCGHVSSTYEPLN-DLSLE----IEDADSLLTALESFTKVEKIEDLQLNYRCENCK-EQVSVEKQLMLDQAPSVATFHLKRFKTEGTYIEKIDKHVDFPLELDLQ 389          
BLAST of USP domain-containing protein vs. TrEMBL
Match: A0A5D2EHR5 (Ubiquitin carboxyl-terminal hydrolase OS=Gossypium darwinii OX=34276 GN=ES288_A11G032800v1 PE=3 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.581e-6
Identity = 68/254 (26.77%), Postives = 110/254 (43.31%), Query Frame = 3
Query:  300 ERKPLIRPIRLKNLGKNCYLNSALQAVSSGDKFFTDVRSLVSQYPPELKNLNVFHNLI----HILNGGQSKALIISKNKIFENWN-------KSNHQDSFELLAFVFNEVYNEIRKYKENQGEIPKYNITQWLMIRLPMRIVFSNDIYCKCGLVYSS--PLQCDLALHIPVPISETCSLQSLVDKFFLIEPIE----NYLCDDVKCIGEAYKKTRLLAPIPNTICIHLQKSHWTGAKLEKIKNKIQFEKTLKIR 1010
            E KP      L+NLG  C++N+ LQ  +    F   +RSL     P  +++  F  L     HI     S   ++S  KIF+N N       +   +D+ E L  + + + +   K K +   I    + +    RL  R+       C CG V S+  PL  DL+L     I +  SL + ++ F  +E IE    NY C++ K    + +K  +L   P+    HL++    G  +EKI   + F   L ++
Sbjct:  147 EDKPTGVGAGLENLGNTCFINAVLQCFTHTVPFVLGLRSLNHHEKPCDRDMESFCLLCVVRDHIELSLHSSGGVVSPTKIFDNLNCFSSFFQRYQQEDAHEFLQCLLDRLESCCSKLKNDLSSIDDCLVKKVFGGRLVSRLCC-----CNCGHVSSTYEPLN-DLSLE----IEDADSLLTALESFTKVEKIEDLQLNYRCENCK-EQVSVEKQLMLDQAPSVATFHLKRFKTEGTYIEKIDKHVDFPLELDLQ 389          
BLAST of USP domain-containing protein vs. Planmine SMEST
Match: SMESG000008607.1 (SMESG000008607.1)

HSP 1 Score: 978.393 bits (2528), Expect = 0.000e+0
Identity = 492/500 (98.40%), Postives = 498/500 (99.60%), Query Frame = 3
Query:  222 VKGKMKFKDIFKRNINLKREKSSQCKERKPLIRPIRLKNLGKNCYLNSALQAVSSGDKFFTDVRSLVSQYPPELKNLNVFHNLIHILNGGQSKALIISKNKIFENWNKSNHQDSFELLAFVFNEVYNEIRKYKENQGEIPKYNITQWLMIRLPMRIVFSNDIYCKCGLVYSSPLQCDLALHIPVPISETCSLQSLVDKFFLIEPIENYLCDDVKCIGEAYKKTRLLAPIPNTICIHLQKSHWTGAKLEKIKNKIQFEKTLKIRKEFCFEYQKPDSNQLQTEQATVDTVRINSEGNVDVKYECSNQSISGSQEISNIANCKVENDIFIDGKSSIEKHEKINSLSNINQKSIELSEENVASGDDLADQNNEIIGKVNDLSIENQKSINVAGENVVFGNGFVETANLDFCNSENEKENGESQNMRIQNNIEKSNFHIEEHIARDEILTLKSVIVHSGSVYKGHYVCYKVVGGNWYLTNDXXXXXXXXXXXXXCDAYILFYEKI 1721
            +KGKMKFKDIFKRNINLK+EKSSQCKERKPLIRPIRLKNLGKNCYLNSALQAVSSGDKFFTDVRSLVSQYPPELKNLNVFHNLIHILNGGQSKALIISKNKIFENWNKSNHQDSFELLAFVFNEVYNEIRKYKENQGEIPKYNITQWLMIRLPMRIVFSNDIYCKCGLVYSSPLQCDLALHIPVPISETCSLQSLVDKFFL EPIENYLCDDVKCIGEAYKKTRLLAPIPNTICIHLQKSHWTGAKLEKIKNKIQFEKTLKI+KEFCFEYQKPDSNQLQTEQATVDTVRINSEGNVDVKYECSNQS+SGSQEISNIANCKVENDIFIDGKSSIEKHEKINSLSNIN+KSIELSEENV+SGDDLADQNNEII KVNDLSIENQKSINVAGENVVFGNGFVETANLDFCNSENEKENGESQNMRIQNNIEKSNFHIEEHIARDEILTLKSVIVHSGSVYKGHYVCYKVVGGNWYLTNDFVVKKVKESEVFSCDAYILFYEKI
Sbjct:   17 IKGKMKFKDIFKRNINLKKEKSSQCKERKPLIRPIRLKNLGKNCYLNSALQAVSSGDKFFTDVRSLVSQYPPELKNLNVFHNLIHILNGGQSKALIISKNKIFENWNKSNHQDSFELLAFVFNEVYNEIRKYKENQGEIPKYNITQWLMIRLPMRIVFSNDIYCKCGLVYSSPLQCDLALHIPVPISETCSLQSLVDKFFLTEPIENYLCDDVKCIGEAYKKTRLLAPIPNTICIHLQKSHWTGAKLEKIKNKIQFEKTLKIKKEFCFEYQKPDSNQLQTEQATVDTVRINSEGNVDVKYECSNQSVSGSQEISNIANCKVENDIFIDGKSSIEKHEKINSLSNINKKSIELSEENVSSGDDLADQNNEIIVKVNDLSIENQKSINVAGENVVFGNGFVETANLDFCNSENEKENGESQNMRIQNNIEKSNFHIEEHIARDEILTLKSVIVHSGSVYKGHYVCYKVVGGNWYLTNDFVVKKVKESEVFSCDAYILFYEKI 516          
BLAST of USP domain-containing protein vs. Planmine SMEST
Match: SMESG000008607.1 (SMESG000008607.1)

HSP 1 Score: 969.533 bits (2505), Expect = 0.000e+0
Identity = 489/496 (98.59%), Postives = 494/496 (99.60%), Query Frame = 3
Query:  234 MKFKDIFKRNINLKREKSSQCKERKPLIRPIRLKNLGKNCYLNSALQAVSSGDKFFTDVRSLVSQYPPELKNLNVFHNLIHILNGGQSKALIISKNKIFENWNKSNHQDSFELLAFVFNEVYNEIRKYKENQGEIPKYNITQWLMIRLPMRIVFSNDIYCKCGLVYSSPLQCDLALHIPVPISETCSLQSLVDKFFLIEPIENYLCDDVKCIGEAYKKTRLLAPIPNTICIHLQKSHWTGAKLEKIKNKIQFEKTLKIRKEFCFEYQKPDSNQLQTEQATVDTVRINSEGNVDVKYECSNQSISGSQEISNIANCKVENDIFIDGKSSIEKHEKINSLSNINQKSIELSEENVASGDDLADQNNEIIGKVNDLSIENQKSINVAGENVVFGNGFVETANLDFCNSENEKENGESQNMRIQNNIEKSNFHIEEHIARDEILTLKSVIVHSGSVYKGHYVCYKVVGGNWYLTNDXXXXXXXXXXXXXCDAYILFYEKI 1721
            MKFKDIFKRNINLK+EKSSQCKERKPLIRPIRLKNLGKNCYLNSALQAVSSGDKFFTDVRSLVSQYPPELKNLNVFHNLIHILNGGQSKALIISKNKIFENWNKSNHQDSFELLAFVFNEVYNEIRKYKENQGEIPKYNITQWLMIRLPMRIVFSNDIYCKCGLVYSSPLQCDLALHIPVPISETCSLQSLVDKFFL EPIENYLCDDVKCIGEAYKKTRLLAPIPNTICIHLQKSHWTGAKLEKIKNKIQFEKTLKI+KEFCFEYQKPDSNQLQTEQATVDTVRINSEGNVDVKYECSNQS+SGSQEISNIANCKVENDIFIDGKSSIEKHEKINSLSNIN+KSIELSEENV+SGDDLADQNNEII KVNDLSIENQKSINVAGENVVFGNGFVETANLDFCNSENEKENGESQNMRIQNNIEKSNFHIEEHIARDEILTLKSVIVHSGSVYKGHYVCYKVVGGNWYLTNDFVVKKVKESEVFSCDAYILFYEKI
Sbjct:    1 MKFKDIFKRNINLKKEKSSQCKERKPLIRPIRLKNLGKNCYLNSALQAVSSGDKFFTDVRSLVSQYPPELKNLNVFHNLIHILNGGQSKALIISKNKIFENWNKSNHQDSFELLAFVFNEVYNEIRKYKENQGEIPKYNITQWLMIRLPMRIVFSNDIYCKCGLVYSSPLQCDLALHIPVPISETCSLQSLVDKFFLTEPIENYLCDDVKCIGEAYKKTRLLAPIPNTICIHLQKSHWTGAKLEKIKNKIQFEKTLKIKKEFCFEYQKPDSNQLQTEQATVDTVRINSEGNVDVKYECSNQSVSGSQEISNIANCKVENDIFIDGKSSIEKHEKINSLSNINKKSIELSEENVSSGDDLADQNNEIIVKVNDLSIENQKSINVAGENVVFGNGFVETANLDFCNSENEKENGESQNMRIQNNIEKSNFHIEEHIARDEILTLKSVIVHSGSVYKGHYVCYKVVGGNWYLTNDFVVKKVKESEVFSCDAYILFYEKI 496          
BLAST of USP domain-containing protein vs. Planmine SMEST
Match: SMESG000039999.1 (SMESG000039999.1)

HSP 1 Score: 290.426 bits (742), Expect = 8.527e-91
Identity = 200/546 (36.63%), Postives = 284/546 (52.01%), Query Frame = 3
Query:  312 LIRPIRLKNLGKNCYLNSALQAVSSGDKFFTDVRSLVSQYPPELKNLNVFHNLIHILNGGQSKALIISKNKIFENWNKSNHQDSFELLAFVFNEVYNEIRKYKENQGEIPKYNITQWLMIRLPMRIVFSNDIYCKCGLVYSSPLQCDLALHIPVPISET---------------CSLQSLVDKFFLIEPIENYLCDDVKCIGE-AYKKTRLLAPIPNTICIHLQKSHWTGAKLEKIKNKIQFEKTLKIRKEFCFEYQKPDSNQLQTEQATVDTVRINSEGNVDVKYECSNQSISGSQEISNIANCKVENDIFIDGKSSIEKHEKINSLS---------NINQKSIELSEENVASGDD--------LADQNNEIIGKVNDLSIENQKSINVAGENV--------VFGNGFVETANLDF-----------------------------CNSENEKENGESQNMRIQNNIE-------KSNFHIEEHIARDEILTLKSVIVHSGSVYKGHYVCYKVVGGNWYLTNDXXXXXXXXXXXXXCDAYILFYEK 1718
            +++P  L N+G NCYLNSA Q +SS +KF +D+ +L  +Y   ++ L VF+ LI ILNG +SK+L IS+N IF+NWNK   QDSFELLA V N+VYN+IRKY E++GEIPK NI +WL   LPMRI+   +I+C C  +   PLQ DLALH+ +P++ +                +LQ LV+ FF  + IE+Y C+   C G+ A++ TRL+AP+P T+CIHLQK+ W G K+EKI  KI+F + L I+ +F   +   D+ Q    +A  D +++ S      + + S++S      +  I N K +N   +D K S E  EKI             N + +  ELSE      DD          D+N+ I  +   L  EN  S + A  +V           N   E    DF                             C+      + E+    +Q++I+        ++  IE   +  E   L SVIVH G VY GHYVCY+   G WY+TND  V  V+E +V + +AYILFYEK
Sbjct:   15 IVKPPSLLNIGANCYLNSAFQGISSCNKFLSDLDTLRQKYGSRVEKLAVFYQLIDILNGEKSKSLEISRNPIFKNWNKPGQQDSFELLAHVMNQVYNDIRKYLESEGEIPKKNIQEWLKKELPMRIIIQYEIHCHCKSIIYVPLQSDLALHVTIPLTGSRNYNCDFSYIFIILGSNLQELVNMFFNRDRIEDYDCETEGCDGKSAFRYTRLIAPLPRTLCIHLQKTFWNGYKMEKITKKIKFSRELNIQSKFLISH---DTLQNSITKANEDKLKLESSK----ENKESSESKCNESNLDEILNDKDKNTKKVDAKCS-ENLEKIQLTEKSLISEDGINFDVQKTELSEREEVIIDDEESSENKNQLDENHSISERKIILDTENDLSDDSANSDVDKINMQKLFVSNKSTEIGRRDFIPQNNSVNNVDNSINSNSNIPAGLINISSCSENVSDFHQENGCFPLQSDIQGPVLNTFSNDTRIERIDSETENYLLTSVIVHYGGVYGGHYVCYRYSNGQWYMTNDSSVYPVREEDVLNSEAYILFYEK 552          
BLAST of USP domain-containing protein vs. Planmine SMEST
Match: SMESG000040007.1 (SMESG000040007.1)

HSP 1 Score: 261.922 bits (668), Expect = 2.187e-75
Identity = 129/281 (45.91%), Postives = 183/281 (65.12%), Query Frame = 3
Query:  303 RKPLIRPIRLKNLGKNCYLNSALQAVSSGDKFFTDVRSLVSQYPPELKNLNVFHNLIHILNGGQSKALIISKNKIFENWNKSNHQDSFELLAFVFNEVYNEIRKYKENQGEIPKYNITQWLMIRLPMRIVFSNDIYCKCGLVYSSPLQCDLALHIPVPISET---------------CSLQSLVDKFFLIEPIENYLCDDVKCIGE-AYKKTRLLAPIPNTICIHLQKSHWTGAKLEKIKNKIQFEKTLKIRKEFCFEYQKPDSNQLQTEQATVDTVRINS 1097
             K +++P  L N+G NCYLNSA Q +SS +KF +D+ +L  +Y   ++ L VF+ LI ILNGG+SK+L IS+N IF+NWNK   QDSFELLA V N+VYN+IRKY E++GEIPK NI +WL   LPMRI+   +I+C C  +   PLQ DLALH+ +P++ +                +LQ LV+ FF  + IE+Y C+   C G+ A++ TRL+AP+P T+CIHLQK+ W G K+EKI  KI+F + L I+ +F   +   D+ Q    +A  D +++ S
Sbjct:  228 EKKVVKPPSLSNIGANCYLNSAFQGISSCNKFLSDLDTLRQKYGSRVEKLAVFYQLIDILNGGKSKSLEISRNPIFKNWNKPGQQDSFELLAHVMNQVYNDIRKYLESEGEIPKKNIQEWLKKELPMRIIIQYEIHCHCKSIIYVPLQSDLALHVTIPLTGSRNYNCDFSYIFIILGSNLQELVNMFFNRDRIEDYDCETEGCDGKSAFRYTRLIAPLPRTLCIHLQKTFWNGYKMEKITKKIKFSRELNIQSKFLISH---DTLQNSITKANEDKLKLES 505          

HSP 2 Score: 68.5514 bits (166), Expect = 1.017e-11
Identity = 32/54 (59.26%), Postives = 38/54 (70.37%), Query Frame = 3
Query: 1557 LKSVIVHSGSVYKGHYVCYKVVGGNWYLTNDXXXXXXXXXXXXXCDAYILFYEK 1718
            L SVIVH G VY GHYVCY+   G WY+TND  +  V E +V + +AYILFYEK
Sbjct: 1804 LTSVIVHYGGVYGGHYVCYRYSNGQWYMTNDSSIYPVHEQDVLNSEAYILFYEK 1857          
BLAST of USP domain-containing protein vs. Planmine SMEST
Match: SMESG000040010.1 (SMESG000040010.1)

HSP 1 Score: 237.269 bits (604), Expect = 5.060e-72
Identity = 124/270 (45.93%), Postives = 171/270 (63.33%), Query Frame = 3
Query:  255 KRNINLKREKSSQCKERKPLIRPIRLKNLGKNCYLNSALQAVSSGDKFFTDVRSLVSQYPPELKNLNVFHNLIHILNGGQSKALIISKNKIFENWNKSNHQDSFELLAFVFNEVYNEIRKYKENQGEIPKYNITQWLMIRLPMRIVFSNDIYCKCGLVYSSPLQCDLALHIPVPISETCSLQSLVDKFFLIEPIENYLCDDVKCIG-EAYKKTRLLAPIPNTICIHLQKSHWTGAKLEKIKNKIQFEKTLKIRKEFCFEYQKPDSNQLQT 1061
            ++N N+     S  K     + P  L N+G NCYLNSALQ++SS +KF  D++ L S+Y  +L  L +FHNL+ +LN G   A+ IS+N IF +WNKS  QDSFELLA+V N+VYNEIR + E      K +I+ WL IRLPM+++    I C CG + S PL  DLALHI VP +   +L+  +D+ F  + I NY+CD   C G  A K T+LL P+P T+CIHLQKS+W G +++KI N+I F   L I+ E+C    + DS  L++
Sbjct:   32 EQNTNVDFITGSVLKSGTKKVSPPSLANIGANCYLNSALQSISSCEKFKEDIKRLHSKYK-DLDKLTLFHNLMIVLNNGSKNAIEISRNNIFRHWNKSGQQDSFELLAYVINQVYNEIRNHSE-----VKNDISGWLRIRLPMKLLIQYSIKCSCGTIISIPLHSDLALHISVPRNGNETLERCLDQHFTDDIILNYICDTKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKINNRINFSAELIIKSEYCHTIDEIDSELLKS 295          

HSP 2 Score: 55.0694 bits (131), Expect = 7.866e-8
Identity = 32/77 (41.56%), Postives = 48/77 (62.34%), Query Frame = 3
Query: 1494 NNIEKSNFHIEEHIARDE--ILTLKSVIVHSGSVYKGHYVCYKVVGGNWYLTNDXXXXXXXXXXXXXCDAYILFYEK 1718
            NN+  ++ +  EH+ + +  +  L SVIVH G+V  GHY+CYK +   WYL +D  + KV++  VF  D YIL YE+
Sbjct:  338 NNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCYKCIDNQWYLADDNQISKVRKEIVFKSDPYILIYEE 414          
The following BLAST results are available for this feature:
BLAST of USP domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of USP domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of USP domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of USP domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
usp36.889e-622.34ubiquitin specific peptidase 3 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of USP domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSXETT00000054948.19.008e-726.11ubiquitin specific peptidase 32 [Source:NCBI gene;... [more]
hnrnpd2.219e-622.84heterogeneous nuclear ribonucleoprotein D [Source:... [more]
back to top
BLAST of USP domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of USP domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of USP domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1Y2G7S01.139e-723.41USP domain-containing protein OS=Lobosporangium tr... [more]
A0A150G6T84.868e-724.41USP domain-containing protein OS=Gonium pectorale ... [more]
A0A0B0PHZ81.481e-626.77Ubiquitin carboxyl-terminal hydrolase OS=Gossypium... [more]
A0A1U8LCK31.488e-626.77Ubiquitin carboxyl-terminal hydrolase OS=Gossypium... [more]
A0A5D2EHR51.581e-626.77Ubiquitin carboxyl-terminal hydrolase OS=Gossypium... [more]
back to top
BLAST of USP domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of USP domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of USP domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of USP domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of USP domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of USP domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008607.10.000e+098.40SMESG000008607.1[more]
SMESG000008607.10.000e+098.59SMESG000008607.1[more]
SMESG000039999.18.527e-9136.63SMESG000039999.1[more]
SMESG000040007.12.187e-7545.91SMESG000040007.1[more]
SMESG000040010.15.060e-7245.93SMESG000040010.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008099 ID=SMED30008099|Name=USP domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1738bp
TGAAAATTAGTTTGATAACTACATTTTTGAAAACAATTAAAGATACTATA
ATTTCATTTTATATGATTAATTAATTTCCATATATTTTTAAGTTTTAAAA
TTTCAAAGTTGATTAAAAATCATTTTGTAATATGTTAATAGTTTTAACAG
TTTTTATTAATATTAGAATTTGGTTAATTTTAATTTATGCTTTTGATAAA
ACGTCATATTATTCTATTTCAGTTAAAGGTAAAATGAAATTTAAAGATAT
TTTTAAACGAAACATTAATTTGAAAAGAGAGAAATCATCGCAATGCAAAG
AACGAAAACCTTTAATTCGTCCTATAAGATTGAAAAATTTAGGTAAGAAT
TGCTATCTGAATTCAGCGTTACAGGCTGTTTCTTCTGGTGACAAATTTTT
CACTGACGTTAGAAGCCTTGTGTCTCAATATCCACCTGAACTTAAAAATT
TGAATGTCTTTCATAATCTTATACATATTTTAAATGGTGGTCAATCTAAG
GCTTTAATAATATCGAAAAACAAAATTTTCGAAAATTGGAACAAATCAAA
TCATCAAGACAGTTTCGAATTGCTGGCATTCGTTTTCAATGAGGTTTATA
ATGAAATCAGGAAATACAAAGAAAATCAAGGGGAAATTCCCAAATATAAT
ATTACTCAATGGCTTATGATTCGGTTACCTATGCGAATTGTATTTAGTAA
TGATATATACTGTAAATGCGGGTTGGTTTATTCCTCTCCTTTACAGTGTG
ACTTAGCGTTGCATATCCCAGTACCAATCAGCGAGACGTGTTCTCTTCAA
AGTCTCGTTGATAAGTTTTTTCTCATTGAACCAATCGAAAACTACTTATG
CGATGATGTCAAATGTATTGGCGAAGCTTACAAAAAAACTCGATTGTTGG
CACCAATTCCAAACACAATTTGTATCCATTTACAAAAGTCTCATTGGACT
GGAGCAAAGCTTGAAAAAATAAAGAACAAAATACAATTTGAAAAAACTCT
AAAAATAAGAAAAGAATTTTGCTTTGAATATCAAAAACCAGATTCAAACC
AGTTGCAAACCGAACAGGCTACAGTCGATACTGTTCGCATTAATTCTGAA
GGAAATGTCGATGTCAAATATGAATGTTCAAATCAATCGATATCAGGAAG
TCAGGAAATCTCAAACATTGCCAATTGCAAGGTGGAAAACGACATTTTTA
TCGATGGAAAATCTTCGATTGAGAAACATGAAAAAATCAATAGTTTATCA
AATATAAATCAAAAATCGATTGAATTATCTGAAGAAAATGTTGCTTCTGG
AGATGATTTGGCTGATCAAAACAATGAAATAATAGGAAAAGTCAATGATT
TATCTATTGAAAATCAAAAGTCGATAAATGTAGCTGGAGAAAATGTTGTC
TTTGGAAATGGTTTCGTTGAAACTGCAAATCTGGATTTCTGTAATAGTGA
GAATGAAAAAGAAAATGGGGAAAGCCAAAACATGAGGATTCAAAACAATA
TCGAGAAATCCAATTTCCACATTGAGGAGCACATTGCAAGAGACGAAATT
TTAACCTTGAAATCAGTTATCGTGCATAGCGGATCGGTTTATAAAGGCCA
TTATGTATGTTATAAGGTTGTTGGTGGTAATTGGTATCTTACAAATGATT
TCGTTGTGAAAAAGGTTAAAGAATCCGAAGTTTTCAGTTGTGATGCATAT
ATATTGTTTTACGAAAAAATATGATATTTTATCTCTTT
back to top

protein sequence of SMED30008099-orf-1

>SMED30008099-orf-1 ID=SMED30008099-orf-1|Name=SMED30008099-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=531bp
MLIVLTVFINIRIWLILIYAFDKTSYYSISVKGKMKFKDIFKRNINLKRE
KSSQCKERKPLIRPIRLKNLGKNCYLNSALQAVSSGDKFFTDVRSLVSQY
PPELKNLNVFHNLIHILNGGQSKALIISKNKIFENWNKSNHQDSFELLAF
VFNEVYNEIRKYKENQGEIPKYNITQWLMIRLPMRIVFSNDIYCKCGLVY
SSPLQCDLALHIPVPISETCSLQSLVDKFFLIEPIENYLCDDVKCIGEAY
KKTRLLAPIPNTICIHLQKSHWTGAKLEKIKNKIQFEKTLKIRKEFCFEY
QKPDSNQLQTEQATVDTVRINSEGNVDVKYECSNQSISGSQEISNIANCK
VENDIFIDGKSSIEKHEKINSLSNINQKSIELSEENVASGDDLADQNNEI
IGKVNDLSIENQKSINVAGENVVFGNGFVETANLDFCNSENEKENGESQN
MRIQNNIEKSNFHIEEHIARDEILTLKSVIVHSGSVYKGHYVCYKVVGGN
WYLTNDFVVKKVKESEVFSCDAYILFYEKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR038765Papain-like_cys_pep_sf
IPR001394Peptidase_C19_UCH
IPR028889USP_dom
Vocabulary: molecular function
TermDefinition
GO:0036459thiol-dependent ubiquitinyl hydrolase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0016579protein deubiquitination
GO:0006511ubiquitin-dependent protein catabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.90.70.10coord: 43..317
e-value: 4.2E-24
score: 87.1
NoneNo IPR availableGENE3DG3DSA:3.90.70.10coord: 431..530
e-value: 4.8E-16
score: 61.0
NoneNo IPR availablePANTHERPTHR24006FAMILY NOT NAMEDcoord: 58..529
NoneNo IPR availableCDDcd02257Peptidase_C19coord: 476..528
e-value: 3.13201E-13
score: 67.5082
IPR001394Peptidase C19, ubiquitin carboxyl-terminal hydrolasePFAMPF00443UCHcoord: 67..527
e-value: 1.9E-27
score: 96.4
IPR028889Ubiquitin specific protease domainPROSITEPS50235USP_3coord: 65..530
score: 28.43
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 67..529