Transmembrane protein 45B

Overview
NameTransmembrane protein 45B
Smed IDSMED30008080
Length (bp)1067
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane protein 45B (SMED30008080) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane protein 45B (SMED30008080) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane protein 45B (SMED30008080) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane protein 45B (SMED30008080) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008080

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30008080SMESG000045800.1 Contig3692GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008080SMESG000060226.1 SMESG000045717.1 SMESG000021986.1 PL06012A2B07ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008080SMESG000060226.1 SMESG000021986.1 Contig3692GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30008080SMESG000060226.1 SMESG000021986.1 dd_Smed_v4_1542_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30008080SMESG000060226.1 SMESG000021986.1 dd_Smed_v4_1542_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30008080SMESG000060226.1 SMESG000021986.1 dd_Smed_v4_1542_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30008080SMESG000060226.1 SMESG000021986.1 dd_Smed_v4_1542_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008080SMESG000060226.1 SMESG000021986.1 dd_Smed_v4_1542_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008080SMESG000060226.1 SMESG000021986.1 dd_Smed_v4_1542_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30008080SMESG000060226.1 SMESG000021986.1 dd_Smed_v4_1542_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30008080SMESG000060226.1 SMESG000021986.1 dd_Smed_v4_1542_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30008080SMESG000060226.1 SMESG000021986.1 dd_Smed_v4_1542_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30008080SMESG000060226.1 SMESG000021986.1 dd_Smed_v4_1542_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008080SMESG000060226.1 SMESG000021986.1 Contig9141newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008080SMESG000060226.1 SMESG000021986.1 Contig9141uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008080SMESG000060226.1 SMESG000021986.1 Contig46064newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008080SMESG000060226.1 SMESG000021986.1 Contig46064uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
copulatory apparatusSMED30008080SMESG000060226.1 SMESG000021986.1 PL04025A1B04ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Category 4 cellSMED30008080SMESG000060226.1 SMESG000021986.1 dd_Smed_v4_1542_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008080SMESG000060226.1 SMESG000021986.1 dd_Smed_v4_1542_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transmembrane protein 45B vs. Ensembl Human
Match: TMEM45B (transmembrane protein 45B [Source:HGNC Symbol;Acc:HGNC:25194])

HSP 1 Score: 110.153 bits (274), Expect = 2.307e-27
Identity = 74/243 (30.45%), Postives = 126/243 (51.85%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGV-WQLVNAFYYF--IKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVECLGFFWGIPAM-YQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILYSILF 839
            M +F GHALPG+FF + G+ W +     YF   + N   +   +  ++  ++R   S     + GI+       G  +        I  M +QH TMY FF  +G+VD+L +    +P   D  + A+++F+EG LF +HVH R  LD  +H LL+Y  + G + + L +IF   ++ ++  +  +++QG+WFWQ+G +L+P      W +    ++M  TM FCWH         + YS+++
Sbjct:    1 MANFKGHALPGSFFLIIGLCWSVKYPLKYFSHTRKNSPLHYYQRLEIVEAAIRTLFS-----VTGILAEQFVPDGPHLHLYHENHWIKLMNWQHSTMYLFFAVSGIVDMLTYLVSHVPLGVDRLVMAVAVFMEGFLFYYHVHNRPPLDQHIHSLLLYALFGGCVSISLEVIFRDHIVLELFRTSLIILQGTWFWQIGFVLFPPFGTPEWDQKDDANLMFITMCFCWHYLAALSIVAVNYSLVY 238          
BLAST of Transmembrane protein 45B vs. Ensembl Human
Match: TMEM45B (transmembrane protein 45B [Source:HGNC Symbol;Acc:HGNC:25194])

HSP 1 Score: 110.153 bits (274), Expect = 2.307e-27
Identity = 74/243 (30.45%), Postives = 126/243 (51.85%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGV-WQLVNAFYYF--IKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVECLGFFWGIPAM-YQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILYSILF 839
            M +F GHALPG+FF + G+ W +     YF   + N   +   +  ++  ++R   S     + GI+       G  +        I  M +QH TMY FF  +G+VD+L +    +P   D  + A+++F+EG LF +HVH R  LD  +H LL+Y  + G + + L +IF   ++ ++  +  +++QG+WFWQ+G +L+P      W +    ++M  TM FCWH         + YS+++
Sbjct:    1 MANFKGHALPGSFFLIIGLCWSVKYPLKYFSHTRKNSPLHYYQRLEIVEAAIRTLFS-----VTGILAEQFVPDGPHLHLYHENHWIKLMNWQHSTMYLFFAVSGIVDMLTYLVSHVPLGVDRLVMAVAVFMEGFLFYYHVHNRPPLDQHIHSLLLYALFGGCVSISLEVIFRDHIVLELFRTSLIILQGTWFWQIGFVLFPPFGTPEWDQKDDANLMFITMCFCWHYLAALSIVAVNYSLVY 238          
BLAST of Transmembrane protein 45B vs. Ensembl Human
Match: TMEM45A (transmembrane protein 45A [Source:HGNC Symbol;Acc:HGNC:25480])

HSP 1 Score: 105.145 bits (261), Expect = 2.140e-25
Identity = 86/274 (31.39%), Postives = 134/274 (48.91%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVECLGFFWGIPAM---------------YQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILYSILFRVIKP-VETKTSTRYEQLKN 896
            MG+F GHALPGTFF++ G+W    +   +I     +      +L + +L        + LEGI  +     GM+ E   F  G P +               + HFTMY FFG  G+ DIL     S+P      + + +LFVE  +F  H HGR  LD+ +H LLV V +   LV  L  +    ++ ++L S  +L+QGSWF+Q+G +LYP      W    H +++  T+ FCWH  +  +   + Y+ +  ++K  ++   S+    LKN
Sbjct:   17 MGNFRGHALPGTFFFIIGLWWCTKSILKYI----CKKQKRTCYLGSKTL----FYRLEILEGITIVGMALTGMAGE--QFIPGGPHLMLYDYKQGHWNQLLGWHHFTMYFFFGLLGVADILCFTISSLPVSLTKLMLSNALFVEAFIFYNHTHGREMLDIFVHQLLVLVVFLTGLVAFLEFLVRNNVLLELLRSSLILLQGSWFFQIGFVLYPPSGGPAWDLMDHENILFLTICFCWHYAVTIVIVGMNYAFITWLVKSRLKRLCSSEVGLLKN 280          
BLAST of Transmembrane protein 45B vs. Ensembl Human
Match: TMEM45A (transmembrane protein 45A [Source:HGNC Symbol;Acc:HGNC:25480])

HSP 1 Score: 104.76 bits (260), Expect = 2.161e-25
Identity = 86/274 (31.39%), Postives = 134/274 (48.91%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVECLGFFWGIPAM---------------YQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILYSILFRVIKP-VETKTSTRYEQLKN 896
            MG+F GHALPGTFF++ G+W    +   +I     +      +L + +L        + LEGI  +     GM+ E   F  G P +               + HFTMY FFG  G+ DIL     S+P      + + +LFVE  +F  H HGR  LD+ +H LLV V +   LV  L  +    ++ ++L S  +L+QGSWF+Q+G +LYP      W    H +++  T+ FCWH  +  +   + Y+ +  ++K  ++   S+    LKN
Sbjct:    1 MGNFRGHALPGTFFFIIGLWWCTKSILKYI----CKKQKRTCYLGSKTL----FYRLEILEGITIVGMALTGMAGE--QFIPGGPHLMLYDYKQGHWNQLLGWHHFTMYFFFGLLGVADILCFTISSLPVSLTKLMLSNALFVEAFIFYNHTHGREMLDIFVHQLLVLVVFLTGLVAFLEFLVRNNVLLELLRSSLILLQGSWFFQIGFVLYPPSGGPAWDLMDHENILFLTICFCWHYAVTIVIVGMNYAFITWLVKSRLKRLCSSEVGLLKN 264          
BLAST of Transmembrane protein 45B vs. Ensembl Human
Match: TMEM45A (transmembrane protein 45A [Source:HGNC Symbol;Acc:HGNC:25480])

HSP 1 Score: 63.5438 bits (153), Expect = 2.742e-11
Identity = 60/179 (33.52%), Postives = 84/179 (46.93%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVECLGFFWGIPAM---------------YQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVL 614
            MG+F GHALPGTFF++ G+W    +   +I     +      +L + +L        + LEGI  +     GM+ E   F  G P +               + HFTMY FFG  G+ DIL     S+P      + + +LFVE  +F  H HGR  LD+ +H LLV V +   LV  L
Sbjct:   17 MGNFRGHALPGTFFFIIGLWWCTKSILKYI----CKKQKRTCYLGSKTL----FYRLEILEGITIVGMALTGMAGEQ--FIPGGPHLMLYDYKQGHWNQLLGWHHFTMYFFFGLLGVADILCFTISSLPVSLTKLMLSNALFVEAFIFYNHTHGREMLDIFVHQLLVLVVFLTGLVAFL 185          
BLAST of Transmembrane protein 45B vs. Ensembl Zebrafish
Match: tmem45a (transmembrane protein 45a [Source:ZFIN;Acc:ZDB-GENE-050522-34])

HSP 1 Score: 117.087 bits (292), Expect = 4.848e-30
Identity = 89/285 (31.23%), Postives = 143/285 (50.18%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLV-NAFYYFIKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVECL-------------GFFWGIPAMYQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPS--RWCETCHGDVMNATMIFCWHIFLNAL-FSIILYSIL------FRVIKPVETK-TSTRYEQLKNEQD 905
            MGSF GHALPG+FF + G+W      F Y  + N S        L + +L+    +  + +EG V L+   IGM  E L                W     +QH TMY FF  +G + + +H     P   D  + AL+ F EG LF +H+HGR  LDV +H LL+Y  +  A + +L +     ++ ++L +   ++QGSWFWQ+G +LYP   PS  +W    H + +  T+ +CWH+    L  +++ +S+L       R + P+E      R +++++E +
Sbjct:    1 MGSFKGHALPGSFFLITGLWWAAKQTFLYATRRNKSAGAGR---LASRALQ----RRIEIIEGAVILSFSIIGMLAEQLLAGGPKFQLYDSSTQHWEQLMNWQHTTMYLFFAISGAISLTVHSTDIAPIALDRMLLALAFFNEGFLFLYHLHGRGMLDVHVHTLLLYAIFGQAFICLLEVFHRGNILLELLRATLTVLQGSWFWQIGFVLYP---PSQVKWDLADHDNAVFVTLCYCWHLAFALLTVAVVYWSVLCAVRSRLRRVPPMEMGLLKPREKEVESEDE 275          
BLAST of Transmembrane protein 45B vs. Ensembl Zebrafish
Match: tmem45b (transmembrane protein 45B [Source:NCBI gene;Acc:402977])

HSP 1 Score: 112.849 bits (281), Expect = 1.606e-28
Identity = 85/282 (30.14%), Postives = 135/282 (47.87%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVN-AFYYFIKYNGSQ-NNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVE----------CLGFFWGIPAMYQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILYSILFRVIKPVETKTSTRYEQ-LKNEQDFDIEEQST 929
            M +F GHALPGTFF +FG+W  +   F   ++    Q  +  ++ L A   R         +EG +K+    +G+  E               W     +QH TMY F+G +G+ D+L      +P   D    +L+LFVEG LF FH+H R  LD  +H LL++  + G+   ++ +   +  + ++L     ++QG+WF+Q+G +LYP+  P  W  T H ++M  TM FCWH+ +  L   I Y  +F   K  + +     E  L+     D   Q  
Sbjct:    1 MANFKGHALPGTFFLLFGLWWSIKCPFRQILRRKERQVGDRERQKLTALFNRI------DLIEGSLKIFFAFVGIMAEQFVPDGPHAHLYQDGWVKLMNWQHSTMYLFYGISGIADVLSVSSHHVPVGLDRLFLSLALFVEGFLFYFHIHNREPLDQHIHSLLLFAVFGGSASTMMEVFKRENAVLELLRCTLAILQGTWFYQIGFVLYPLSGPE-WDLTRHDNIMFITMCFCWHLAVALLIVGICYCGVFWTSKWCQRRQRGDMEMGLRKSTSTDSSSQKA 275          
BLAST of Transmembrane protein 45B vs. Ensembl Xenopus
Match: nedd4l (NEDD4 like E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-489248])

HSP 1 Score: 137.887 bits (346), Expect = 8.944e-38
Identity = 90/284 (31.69%), Postives = 143/284 (50.35%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVECLGFFWGIPAMY---------------QHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILYSILFRVIKPVETKTSTRYEQLKNEQDFDIEEQST 929
            M +F GHALPG+FF +FG+W  V     ++      N  S K          C +  + +EGI+K A   IG+  E   F    P M+               QH TMY F+G +G+VDIL     ++P   D     +++ +EG+LF +HVH R  LD  +H LL+   + GA+ +++ +     ++ ++  S   ++QG+WFWQ+G +LYP+     W +T HG+VM  TM FCWH  +  L   I YS+++  +K  +  +S     LK       E +++
Sbjct:    1 MANFKGHALPGSFFLVFGLWWSVKYPLKYLNSKVKGNCRSNK----------CYERLELIEGILKAAFALIGILAE--QFVPDGPHMHLVNGEDHSWVKLMNWQHTTMYLFYGISGVVDILTFLPLNLPRGLDRLSLGIAVIIEGLLFYYHVHNRPALDQHIHSLLLIAVFGGAISIMIEVFMRNDIVLELFRSSLTILQGTWFWQIGFVLYPLGGAPEWDQTDHGNVMFITMCFCWHYAVALLIMAINYSLVYCCVKRHKKLSSVVDNSLKKINSNKTEVEAS 272          
BLAST of Transmembrane protein 45B vs. Ensembl Xenopus
Match: mkrn3 (makorin ring finger protein 3 [Source:Xenbase;Acc:XB-GENE-5958700])

HSP 1 Score: 126.331 bits (316), Expect = 1.664e-33
Identity = 98/281 (34.88%), Postives = 148/281 (52.67%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVEC-------LGFF------WGIPAMYQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSL-LIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILYSI-LFRVIKPVETKTSTRYEQLKNE-QDFDIE 917
            M +F GHALPG+FF +FG+W  V    Y +KY  +   N K F I         +  + +EG VK A   IG+  E        L  +      W     +QH TMY F+G +G+VDIL H   ++P   D  + ++++FVEG LF +HVHGR  LD+ +H+LL+ V  FG  + + + +F++  I   +F  SL ++QGSWFWQ+G +LYP      W    HG+++  TM +CWH     L   + Y +  + V   ++       E LK++ QD D +
Sbjct:    1 MANFKGHALPGSFFLIFGLWWSVK---YPLKY--ACKKNKKVFSIGSK---AGFQRIEVIEGAVKAAFALIGILAEQFVPDGPHLKLYNHEEHQWDHLMNWQHSTMYLFYGISGVVDILTHTTKAVPLAMDRMMLSIAVFVEGFLFYYHVHGRAMLDIHVHILLL-VSVFGGSICIFLEVFHRGNIILEMFRSSLCILQGSWFWQIGFVLYPPGGGPEWDLMDHGNMLFVTMCYCWHYAFALLIVAVNYGLATWFVQTKLKCAKPMEMELLKSQGQDSDDD 272          
BLAST of Transmembrane protein 45B vs. Ensembl Xenopus
Match: ENSXETT00000039903.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:111465740:111467537:1 gene:ENSXETG00000018995.1 transcript:ENSXETT00000039903.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.9366 bits (167), Expect = 1.613e-12
Identity = 70/260 (26.92%), Postives = 111/260 (42.69%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVNAFYYFIKYNG------SQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGM--------SVECLGFF--------WGIPAMYQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHA---LSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILY 827
            MG+F GH  PG  F  F +  L    Y ++  NG       +N +++ FL              P+EG++KL    + +         V+ L FF        +  P  +QH TMY +F  +G +DI+      +P +     HA    + FV  +L  FH HG+  ++V +H LL+  C     + ++   +  Q       +  +L+QG+W   V  ILY       W      D+M  T  +CWH+  NA    IL+
Sbjct:    1 MGTFIGHISPGLAFLSFAL--LYTVRYSWMVLNGCRDQYPPKNRSTRGFL-----------KSLPVEGVMKLIYGFLALMAEFFFPPGVQKLRFFSLSDPNFNFQNPNEWQHATMYGYFCMSGALDIVSQA--CLPTRCPLLEHAGTTAAFFVTTLLLKFHAHGKEAVEVQVHFLLLLTCAITCAIFIIEFWWPNQPKLWFTKAWLVLVQGTWLLHVAFILYKPPTGHFWSGQQPADLMFLTTFYCWHLAFNAGLMGILF 245          
BLAST of Transmembrane protein 45B vs. Ensembl Mouse
Match: Tmem45b (transmembrane protein 45b [Source:MGI Symbol;Acc:MGI:2384574])

HSP 1 Score: 119.398 bits (298), Expect = 6.373e-31
Identity = 83/278 (29.86%), Postives = 140/278 (50.36%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVEC-------LGFF----WGIPAMYQHFTMYAFFGFAGLVDILLHYDFSI-PEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILYSILFRVIKPVETKTSTR---YEQLKNEQDFD 911
            M +F GHALPG+FF + G+W  V     +  + G +NN   +            +  + +EG VK     IG+  E        L  +    W     +QH TMY FFG +GL+D++ +  F I P   D  + A+++F+EG LF FHVH R  LD  +H LL++  +  A+ + L +I    ++ ++  +  L++QG+WFWQ+G +L+P      W +    ++M  TM FCWH  +      I YS+++  +  V+ +        ++LK++  + 
Sbjct:    1 MANFKGHALPGSFFLIVGLWWSVKYPLKYFHHKGLKNNRLSR----------QQERIEIIEGAVKTLFAIIGILAEQFVPDGPHLHLYHENQWVKLMNWQHSTMYLFFGVSGLMDMITYLYFHIVPLGLDRVVLAMAVFIEGFLFYFHVHNRPPLDQHIHSLLLFGLFGAAVSISLEVILRDNIVLELFRTSLLILQGTWFWQIGFVLFPPFGRPEWDQKDMDNIMFITMCFCWHYLVALCIVAINYSLVYCFLTRVKRRAEGEIIGIQKLKSDHTYQ 268          
BLAST of Transmembrane protein 45B vs. Ensembl Mouse
Match: Tmem45b (transmembrane protein 45b [Source:MGI Symbol;Acc:MGI:2384574])

HSP 1 Score: 98.2117 bits (243), Expect = 7.536e-24
Identity = 58/179 (32.40%), Postives = 102/179 (56.98%), Query Frame = 3
Query:  384 YQHFTMYAFFGFAGLVDILLHYDFSI-PEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILYSILFRVIKPVETKTSTR---YEQLKNEQDF 908
            +QH TMY FFG +GL+D++ +  F I P   D  + A+++F+EG LF FHVH R  LD  +H LL++  +  A+ + L +I    ++ ++  +  L++QG+WFWQ+G +L+P      W +    ++M  TM FCWH  +      I YS+++  +  V+ +        ++LK++  +
Sbjct:    3 WQHSTMYLFFGVSGLMDMITYLYFHIVPLGLDRVVLAMAVFIEGFLFYFHVHNRPPLDQHIHSLLLFGLFGAAVSISLEVILRDNIVLELFRTSLLILQGTWFWQIGFVLFPPFGRPEWDQKDMDNIMFITMCFCWHYLVALCIVAINYSLVYCFLTRVKRRAEGEIIGIQKLKSDHTY 181          
BLAST of Transmembrane protein 45B vs. Ensembl Mouse
Match: Tmem45a (transmembrane protein 45a [Source:MGI Symbol;Acc:MGI:1913122])

HSP 1 Score: 93.5893 bits (231), Expect = 1.841e-21
Identity = 83/286 (29.02%), Postives = 129/286 (45.10%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQN--NNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVECLGFFWGIPAM-------------YQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILYSILFRVIKPVETKTSTRYEQLKNEQDFDIEEQSTEQ 935
            MGSF GHALPG+FF+  G W  +      +    ++    NSK  L          +  +  EG+V L     G++ E   F  G PA+             + H TMY FFG  G+  I+      +P      + ++++FVE  +F  H HGR  +D+ +H LLV+V  F  LV  L  +     + ++L    L+ QG+WFWQ+  +LYP    + W  +   + M  +M FCWH     +   + Y++   ++K    K  T    L    D    EQ +E+
Sbjct:    1 MGSFKGHALPGSFFFAMGFWWTMKNILKSVYKRQTRTCYLNSKTLL----------RRTEIWEGVVVLLMSLTGIAGE--QFISGGPALILHKDGQWNQILGWHHTTMYLFFGLQGITQIICFTTNVLPLSSSKLMLSIAIFVETFMFYNHTHGREMIDIFVHQLLVFVGTFSGLVAFLEFLVKNNALLELLRCSLLMFQGTWFWQMAFVLYPPSGSATWNLSDIQNKMFLSMCFCWHYASILILIGVKYALANWLVKSRLRKGCTSEVGLLKHAD---REQESEE 271          
BLAST of Transmembrane protein 45B vs. Ensembl Mouse
Match: Teddm2 (transmembrane epididymal family member 2 [Source:MGI Symbol;Acc:MGI:1923273])

HSP 1 Score: 56.6102 bits (135), Expect = 9.927e-9
Identity = 60/254 (23.62%), Postives = 105/254 (41.34%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVECLGFFWGI--------------PAMYQHFTMYAFFGFAGLVDILLHYDFSIPEK---FDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILYSI 833
            MG F GH  PG   +++G++         I  +  Q   S+ +      R           G +K+    I ++ E     W +                 +QH T+Y  F  +G  D++      +P++    + C  ALS+++   L   H+     +++ LH+LL+   +  ALV  + +     L+  +L +   ++ GSW  Q+G +LY  I   +W +    DV  AT  FCWH+   A   I  Y +
Sbjct:    1 MGGFEGHLFPGLSLFLYGLYHAAFLSRAVICNSPVQYPPSRPWSKGRWTRL----RQMYYIGFLKILSSCILVAQELNSINWQLVLITKRHHLRNFMYRKQWQHLTLYMSFFLSGCADVI--SQNLLPKRCVVLEQCAQALSMYLFLPLMVSHMQDTEGVELQLHMLLIQAMFLLALVETIELWAPNVLLIWMLKAFLYVVTGSWLMQIGFMLYKPISGYKWLDEDKNDVAFATTFFCWHVVSGAFLMISAYGV 248          
BLAST of Transmembrane protein 45B vs. Ensembl Mouse
Match: Teddm2 (transmembrane epididymal family member 2 [Source:MGI Symbol;Acc:MGI:1923273])

HSP 1 Score: 55.0694 bits (131), Expect = 2.069e-8
Identity = 43/153 (28.10%), Postives = 75/153 (49.02%), Query Frame = 3
Query:  384 YQHFTMYAFFGFAGLVDILLHYDFSIPEK---FDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILYSI 833
            +QH T+Y  F  +G  D++      +P++    + C  ALS+++   L   H+     +++ LH+LL+   +  ALV  + +     L+  +L +   ++ GSW  Q+G +LY  I   +W +    DV  AT  FCWH+   A   I  Y +
Sbjct:   45 WQHLTLYMSFFLSGCADVI--SQNLLPKRCVVLEQCAQALSMYLFLPLMVSHMQDTEGVELQLHMLLIQAMFLLALVETIELWAPNVLLIWMLKAFLYVVTGSWLMQIGFMLYKPISGYKWLDEDKNDVAFATTFFCWHVVSGAFLMISAYGV 195          
BLAST of Transmembrane protein 45B vs. UniProt/SwissProt
Match: sp|Q5XGD7|TM45B_XENTR (Transmembrane protein 45B OS=Xenopus tropicalis OX=8364 GN=tmem45b PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 4.738e-37
Identity = 90/284 (31.69%), Postives = 143/284 (50.35%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVECLGFFWGIPAMY---------------QHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILYSILFRVIKPVETKTSTRYEQLKNEQDFDIEEQST 929
            M +F GHALPG+FF +FG+W  V     ++      N  S K          C +  + +EGI+K A   IG+  E   F    P M+               QH TMY F+G +G+VDIL     ++P   D     +++ +EG+LF +HVH R  LD  +H LL+   + GA+ +++ +     ++ ++  S   ++QG+WFWQ+G +LYP+     W +T HG+VM  TM FCWH  +  L   I YS+++  +K  +  +S     LK       E +++
Sbjct:    1 MANFKGHALPGSFFLVFGLWWSVKYPLKYLNSKVKGNCRSNK----------CYERLELIEGILKAAFALIGILAE--QFVPDGPHMHLVNGEDHSWVKLMNWQHTTMYLFYGISGVVDILTFLPLNLPRGLDRLSLGIAVIIEGLLFYYHVHNRPALDQHIHSLLLIAVFGGAISIMIEVFMRNDIVLELFRSSLTILQGTWFWQIGFVLYPLGGAPEWDQTDHGNVMFITMCFCWHYAVALLIMAINYSLVYCCVKRHKKLSSVVDNSLKKINSNKTEVEAS 272          
BLAST of Transmembrane protein 45B vs. UniProt/SwissProt
Match: sp|Q6NS09|TM45B_XENLA (Transmembrane protein 45B OS=Xenopus laevis OX=8355 GN=tmem45b PE=2 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 1.704e-34
Identity = 89/255 (34.90%), Postives = 133/255 (52.16%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVECLGFFWGIPAMY---------------QHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSL-LIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILYSILF 839
            M +F GHALPG+FF +FG+W  V     ++      N  S K          C    + +EGI+K     IG+  E   F    P M+               QH TMY F+G +G+VDIL ++  ++P   D     +++ VEG+LF +HVH R  LD  +H LL+ +  FG  + +++ +F +  I   LF  SL ++QG+WFWQ+G +LYP+     W +T H +VM  TM FCWH  +  L   I YS+++
Sbjct:    1 MANFKGHALPGSFFLVFGLWWSVKYPLRYLNSKVKGNCRSNK----------CYDRLELIEGILKALFSLIGILAE--QFVPDGPHMHLVNGEDHSWVKLMNWQHTTMYLFYGISGVVDILTYFPLNLPRGLDRLSLGIAVIVEGLLFYYHVHNRPALDQHIHSLLL-IAVFGCAISIMIEVFMRNDIVLELFRASLSILQGTWFWQIGFVLYPLGGAPEWNQTDHDNVMFITMCFCWHYAVALLIMAINYSLVY 242          
BLAST of Transmembrane protein 45B vs. UniProt/SwissProt
Match: sp|Q497B2|TM45B_RAT (Transmembrane protein 45B OS=Rattus norvegicus OX=10116 GN=Tmem45b PE=1 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 7.284e-32
Identity = 90/278 (32.37%), Postives = 142/278 (51.08%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVEC-------LGFF----WGIPAMYQHFTMYAFFGFAGLVDILLHYDFSI-PEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILYSILFRVIKPVETKTSTR---YEQLKNEQDFD 911
            M +F GHALPG+FF +FG+W  V    Y +KY   Q    K  L     R       + +EG VK     IG+  E        L  +    W     +QH TMY FFG +G++D+L +  F+I P   D  + A+++FVEG LF FHVHGR  LD  +H LL++  +   + + L +I    ++ ++  +  L++QG+WFWQ+G +L+P      W +    +VM  TM FCWH  +    + I YS+++  +  V  +        ++LK++  + 
Sbjct:    1 MANFKGHALPGSFFLIFGLWWSVK---YPLKYF-HQKGLKKNRLSLQQQRI------EIIEGAVKALFAVIGILAEQFVPDGPHLHLYHENQWTKLMNWQHSTMYLFFGVSGIIDMLTYLYFNIVPLGLDRVVLAMAVFVEGFLFYFHVHGRPPLDQHIHSLLLFSLFGATISICLEVILRDNIVLELFRTTLLILQGTWFWQIGFVLFPPFGTPEWDQKDMDNVMFITMCFCWHYLVALCITAINYSLVYCFLTRVRRRAEGEIIGIQKLKSDHTYQ 268          
BLAST of Transmembrane protein 45B vs. UniProt/SwissProt
Match: sp|Q3T130|TM45B_BOVIN (Transmembrane protein 45B OS=Bos taurus OX=9913 GN=TMEM45B PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 1.245e-30
Identity = 85/278 (30.58%), Postives = 141/278 (50.72%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVECL-----------GFFWGIPAMYQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIF-----LNALFSIILYSILFRVIKPVETKTSTRYEQLKNEQDF 908
            M +F GHALPG+FF + G+W    +  Y +KY   +  +++  L  H  R       + +E  ++     IG+ VE                W     +QH TMY FF  +G++D+L +    +P   D  + AL+ F EG LF +HV  R  LD  +H LL+Y  + GAL + + ++    ++ ++  +  LL+QG+WFWQ+G +L+P      W +  H ++M  TM FCWH       L A +S++ Y  L RV +P E +     ++L+++  +
Sbjct:    1 MANFKGHALPGSFFLIVGLWW---SLKYPLKYFYQKEKSNQ--LTHHYQRL------EIIEAAIRTLFAVIGILVEQFVPDGPHLHLYHEDHWVKLMNWQHSTMYLFFAVSGIMDMLTYLITHVPLGLDRLVMALAAFNEGFLFYYHVRDRPPLDQHIHSLLLYTVFGGALSLAVEVVLRDNIVLELFRTSLLLLQGTWFWQIGFVLFPPFGGPEWDQNSHDNIMFVTMCFCWHYLAALCILAASYSLV-YCFLTRVKRP-EDREVIGIQKLRSDHTY 265          
BLAST of Transmembrane protein 45B vs. UniProt/SwissProt
Match: sp|Q8VCZ2|TM45B_MOUSE (Transmembrane protein 45B OS=Mus musculus OX=10090 GN=Tmem45b PE=1 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 4.458e-30
Identity = 83/278 (29.86%), Postives = 140/278 (50.36%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVEC-------LGFF----WGIPAMYQHFTMYAFFGFAGLVDILLHYDFSI-PEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILYSILFRVIKPVETKTSTR---YEQLKNEQDFD 911
            M +F GHALPG+FF + G+W  V     +  + G +NN   +            +  + +EG VK     IG+  E        L  +    W     +QH TMY FFG +GL+D++ +  F I P   D  + A+++F+EG LF FHVH R  LD  +H LL++  +  A+ + L +I    ++ ++  +  L++QG+WFWQ+G +L+P      W +    ++M  TM FCWH  +      I YS+++  +  V+ +        ++LK++  + 
Sbjct:    1 MANFKGHALPGSFFLIVGLWWSVKYPLKYFHHKGLKNNRLSR----------QQERIEIIEGAVKTLFAIIGILAEQFVPDGPHLHLYHENQWVKLMNWQHSTMYLFFGVSGLMDMITYLYFHIVPLGLDRVVLAMAVFIEGFLFYFHVHNRPPLDQHIHSLLLFGLFGAAVSISLEVILRDNIVLELFRTSLLILQGTWFWQIGFVLFPPFGRPEWDQKDMDNIMFITMCFCWHYLVALCIVAINYSLVYCFLTRVKRRAEGEIIGIQKLKSDHTYQ 268          
BLAST of Transmembrane protein 45B vs. TrEMBL
Match: T1G945 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20217592 PE=4 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 1.165e-40
Identity = 114/302 (37.75%), Postives = 164/302 (54.30%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVNAF--YYFIKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVECL-----GFFWGIPAMYQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILY-PIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILYSILFRVIKP----VETKTS------TRYEQLK--------NEQDFDIEEQSTEQFLKPK 950
            MG+F GHALPG+FF +F +W  V  F  YY     GS    S        L C   KN + LEGI+K+A  T+G+ +E +     G F  +    QH TM+ FFG +G+VDIL+H+   +PE  D+ I  LS  VE +LF FH+HGRT LDV+LH LL+YV +   + V+  + F   ++  +  S  +L+QG+WFWQVG ILY P      W +  H ++M ATMIF WH+ ++ +  I++  +L +++ P      T  S       RY+Q+K        N      E +S E+F   K
Sbjct:    1 MGTFGGHALPGSFFIIFSLWWTVQTFRRYYKSLKKGSPPYKSSVTFKPDCLPCEKCKNLE-LEGILKVAFTTLGLVLEVITAYKDGHFTHL-GNGQHATMFFFFGLSGVVDILMHHGAPLPENTDYAISCLSFIVEDVLFMFHLHGRTKLDVILHTLLLYVVHACVICVLFEVRFRNNVVVALARSFLVLLQGTWFWQVGFILYNPNPNAIPWKDEDHNEIMLATMIFAWHLAIDFIL-ILVIGLLVKMLGPFCCLAGTNKSDGAFNHVRYDQVKLITTNAEINHLPVLDESESEEEFNATK 299          
BLAST of Transmembrane protein 45B vs. TrEMBL
Match: T1EH14 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20195864 PE=4 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 7.203e-39
Identity = 94/235 (40.00%), Postives = 135/235 (57.45%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVNAF--YYFIKYNGSQNNNSKKFLIAHSLRC--CCSKNHKPLEGIVKLACCTIGMSVECLGFFWGIPAMY----QHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLN 803
            MG+F GHALPG+FF +F +W  V  F  YY    NG     S    +A +  C  C   N+  +EGI+K+   ++G+ +E    F      Y    QH TMY FFG +G+VD L+H+ FS+PE  D+ +  LS   E +LF FH+HGRT LDV +H LLVY+ +   + V++   +   +I  +     +L+QG+WFWQ+G ILYP     RW    H ++M AT+IF WHI ++
Sbjct:    1 MGTFGGHALPGSFFILFSLWWTVQTFRRYYKSLKNGCTPYRST---VAFAPDCLPCKKCNNVMIEGILKVVFTSLGLVLEAKSGFKNGHFTYSDNGQHATMYFFFGLSGVVDTLMHHGFSMPENTDYAVGCLSFVAEDVLFTFHLHGRTELDVAVHTLLVYIIHACVVCVLVEARYKNNVIVTLSRCFFVLLQGTWFWQIGFILYPNPNAVRWKNGDHNEIMLATIIFAWHIAID 232          
BLAST of Transmembrane protein 45B vs. TrEMBL
Match: A0A401SF88 (Uncharacterized protein OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0007446 PE=4 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 2.317e-38
Identity = 95/284 (33.45%), Postives = 157/284 (55.28%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVECLGFFWGIPAM---------------YQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILYSIL-------FRVIKPVET---KTSTRYEQLKNE 899
            MG+F GHALPG+FF +FG+W  V    Y ++Y   +N N     + + +     +    +EGIVK +   IGM  E   F    P M               +QH TMY F+G +G+VDI++H   ++P   D  + A+++F+EG LF +HVHGR  LD+ +H+LL+   + G+L + L +     ++ ++L +   ++QGSWFWQ+G ILYP    S W +T H ++M  TM +CWH  ++ L   + Y+I+        + ++P+E    K+S + ++ ++E
Sbjct:    1 MGNFKGHALPGSFFLLFGLWWSVK---YPMRYLCRKNKN-----VCYLVSISGHRRLDIIEGIVKASFALIGMIAE--QFVPDGPHMKLYNYEEKHWDHLMNWQHATMYLFYGISGIVDIIVHITPAVPLALDRLMLAIAVFIEGFLFYYHVHGRAMLDLHVHILLLVAVFGGSLSIFLEVFLRGNIVLELLRTSLCILQGSWFWQIGFILYPPNGSSEWDQTSHDNMMFITMCYCWHYAISLLIVALSYAIVNWVINAKLKKVEPLEMGLLKSSEKDQEAEDE 274          
BLAST of Transmembrane protein 45B vs. TrEMBL
Match: A0A226E6A5 (Transmembrane protein 45B OS=Folsomia candida OX=158441 GN=Fcan01_12449 PE=4 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.574e-36
Identity = 96/237 (40.51%), Postives = 133/237 (56.12%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVNAFYYFI---KYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVECLGFF-------WGIPAMYQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSL-LIQGSWFWQVGSILYPIIKPS--RWCETCHGDVMNATMIFCWHI 794
            MGSF GH +PGTFF+ F +W L N    ++   ++      NS  F      RC CSKN  P+E I+K+A  TIG+  E    F       WG     QH TM+AFFG  G+VD+LLH  + +P K D+   AL+  VEG LF  H+HGRTH+D+ +H+ L Y+     +V +L  +F  + +   L  +    +QG+WF+Q+G ILYP   PS  +W E  H  +M  TMIF WH+
Sbjct:    1 MGSFLGHVVPGTFFFAFALWWLYNVLNRYLLCRRFKPDSYRNSSTF------RCACSKN-IPIESILKVAATTIGILGEFATAFDKGKFTHWGNA---QHITMFAFFGLNGVVDLLLHKGWLLPPKLDYVTAALAYAVEGFLFYNHLHGRTHMDIAVHMYLFYLT-VACVVSILAEMFQPKNVMPALCRIFFTFLQGTWFYQIGFILYP---PSGDKWDEEDHTQIMIITMIFTWHM 223          
BLAST of Transmembrane protein 45B vs. TrEMBL
Match: G1KL80 (Transmembrane protein 45A OS=Anolis carolinensis OX=28377 GN=TMEM45A PE=4 SV=2)

HSP 1 Score: 140.969 bits (354), Expect = 8.597e-36
Identity = 99/282 (35.11%), Postives = 145/282 (51.42%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVEC-------LGFF------WGIPAMYQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSL-LIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILYSILFRVIKPVETKTSTRYEQLKNEQDFDIEEQS 926
            MG+F GHALPG+FF +FG+W  V    Y +KY   +  N+         +       +  EGI+K A   IGM  E        L  +      W     +QH TMY F+G +GLVDI+ H   ++P   D  + +L++ VEG LF FH+HGR  LD+ +H LL+ V  FGA + V + IF + +I   +F  SL ++QGSWFWQ+G +LYP      W +  H ++M  TM +CWH     L   + YSI+  +++    +  T    L    + D E + 
Sbjct:    1 MGNFKGHALPGSFFLLFGLWWSVK---YPLKYLSRRKKNTSSIGSKAGFQRL-----EFTEGIIKAAFALIGMVAEQFVPDGPHLKLYNYERKQWDHLMNWQHATMYLFYGISGLVDIVAHGTNALPVAMDRMMLSLAVAVEGFLFYFHIHGRAMLDLHVHQLLL-VAIFGAAICVFLEIFFRGIIVLEMFRTSLCILQGSWFWQIGFVLYPPSGSPEWNQMDHNNIMFLTMCYCWHYAFALLIMAVNYSIVSWIVRSKMKQAPTMEIGLLKTSERDQESED 273          
BLAST of Transmembrane protein 45B vs. Ensembl Cavefish
Match: tmem45b (transmembrane protein 45B [Source:NCBI gene;Acc:103028580])

HSP 1 Score: 115.546 bits (288), Expect = 1.507e-29
Identity = 84/280 (30.00%), Postives = 135/280 (48.21%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVE----------CLGFFWGIPAMYQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILYSILFRVIKPVETKTSTRYE-QLKNEQDFDIEEQST 929
            M +F GHALPG+FF +FG+W  V    Y +++   +  N +K  +         K    +EG++K     +G+  E               W     +QH TMY F+G +G+ DIL       P   D    +++LFVEG LF FH+H R  LD  +H LL+   + GA   +L +      + ++L S   ++QG+WF+Q+G +LYP +  + W    HG++M  TM +CWH  +  L   I +S+++ V +    +  +  E  L+     D   Q  
Sbjct:    1 MANFKGHALPGSFFLLFGLWWSVK---YPLRHTLQKRQNGRKQNVP-----LFFKKLDLIEGVLKTFFAFVGIMAEQFVPDGPHGHLYDEDWVKLMNWQHSTMYLFYGISGIADILSSAPLPTPAGLDRLALSIALFVEGFLFYFHLHNRPPLDQHIHSLLLVAVFGGAASTLLEVFMKNNTLLELLRSSLAILQGTWFYQIGFVLYP-LNGNLWELDNHGNIMFITMCYCWHYAVALLIVGINFSLVWWVTRRCGGRQGSEIEIGLRKTNHHDSSSQKA 271          
BLAST of Transmembrane protein 45B vs. Ensembl Cavefish
Match: tmem45a (transmembrane protein 45a [Source:ZFIN;Acc:ZDB-GENE-050522-34])

HSP 1 Score: 92.8189 bits (229), Expect = 2.150e-21
Identity = 86/287 (29.97%), Postives = 127/287 (44.25%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVN-AFYYFIKYNGSQNNNS-KKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVECLGFFWGIPAM---------------YQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPS--RWCETCHGDVMNATMIFCWHIFLNALFSIILYSIL-------FRVIKPVETKTSTRYEQLKNEQD 905
            MGSF GHALPG+FF + G+W  V  + +Y  + N S          + H L           EG V L    IG+  E   F  G P                 +QH TMY FF  AG   + +H     P   D  +  L+ F EG LF +H+HGR  LDV +H+LL+Y  +               ++ ++L +   L+QGSWFWQ+  +LYP   PS  +W  + H ++M  TM + WH+    L     ++ +        R + P+E       E+  + +D
Sbjct:    1 MGSFKGHALPGSFFLIAGLWWAVKYSLWYTTRRNKSAGAGRITTRALQHRLEIT--------EGAVTLCFSLIGILGE--QFAAGGPKFQIYDPSTQHWYQLMNWQHTTMYLFFAIAGATSLTVHSVDGAPLALDRLLLGLAFFNEGFLFLYHLHGRDMLDVHVHMLLLYAVF-----------HRGNILLELLRAALCLLQGSWFWQIAFVLYP---PSEVKWDLSDHNNMMFITMCYSWHLAFALLTVAAAHTTVLCVVRSKLRRMPPMEMGLLKPQEREADSED 263          
BLAST of Transmembrane protein 45B vs. Ensembl Medaka
Match: tmem45a (transmembrane protein 45A [Source:NCBI gene;Acc:101171567])

HSP 1 Score: 117.472 bits (293), Expect = 2.997e-30
Identity = 89/284 (31.34%), Postives = 137/284 (48.24%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVN-AFYYFIKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVECLGFFWGIPAM---------------YQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILYSILFRVIKPVETKTSTRYEQLKNEQDFDIEEQS 926
            MGSF GHALPG+FF + G+W     + ++  + N S  +     L   SL+    +  + +E  V L    +GM  E   F    P +               +QH TMY FFG A  V ++LH   + P   D  + A++ F EG LF +H+HGR+ LDV +H LL+Y  +  A+   L +     +I ++L     ++QGSWFW++G +LYP   P  W  T H ++M  TM + WH+    L   +LY  +  V++    +T      L    + D E + 
Sbjct:    1 MGSFKGHALPGSFFLVAGIWWTGKYSLWHATRRNKSIGSTR---LAGRSLQ----RRLEIIENSVVLFFSLVGMLAE--QFLADGPKLQLYNFAEKHWEDLMNWQHATMYLFFGLAATVSLVLHSTEAAPLALDRLMLAVAFFNEGFLFLYHLHGRSMLDVHVHQLLLYAVFGQAIAAFLEVFHRGNIILELLRCTLTILQGSWFWEIGFVLYPPSGP-EWDLTDHSNMMFVTMCYSWHLAFAMLVVGVLYCTVSCVVRSRLKRTPPMEMGLLKTTERDAESED 274          
BLAST of Transmembrane protein 45B vs. Ensembl Medaka
Match: tmem45a (transmembrane protein 45A [Source:NCBI gene;Acc:101171567])

HSP 1 Score: 112.464 bits (280), Expect = 2.304e-28
Identity = 86/265 (32.45%), Postives = 133/265 (50.19%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVN-AFYYFIKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVECLGFFWGIPAM---------------YQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILY-SILFRVIKPVETK 866
            MGSF GHALPG+FF + G+W     + ++  + N S  +     L   SL+    +  + +E  V L    +GM  E   F    P +               +QH TMY FFG A  V ++LH   + P   D  + A++ F EG LF +H+HGR+ LDV +H LL+Y  +  A+   L +     +I ++L     ++QGSWFW++G +LYP   P  W  T H ++M  TM + WH+    L   +LY ++ + V+   + K
Sbjct:    1 MGSFKGHALPGSFFLVAGIWWTGKYSLWHATRRNKSIGSTR---LAGRSLQ----RRLEIIENSVVLFFSLVGMLAEQ--FLADGPKLQLYNFAEKHWEDLMNWQHATMYLFFGLAATVSLVLHSTEAAPLALDRLMLAVAFFNEGFLFLYHLHGRSMLDVHVHQLLLYAVFGQAIAAFLEVFHRGNIILELLRCTLTILQGSWFWEIGFVLYPPSGP-EWDLTDHSNMMFVTMCYSWHLAFAMLVVGVLYCTVSWSVLPSPQQK 255          
BLAST of Transmembrane protein 45B vs. Ensembl Medaka
Match: tmem45b (transmembrane protein 45B [Source:NCBI gene;Acc:101167390])

HSP 1 Score: 103.219 bits (256), Expect = 4.914e-25
Identity = 84/289 (29.07%), Postives = 138/289 (47.75%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVECL-------------GFFWGIPAMYQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWH----IFLNALFSIILYSILFR-VIKPVETKTSTRYEQLKNEQDFDIEEQSTEQ 935
            M +F GHA+PG+FF  +G + L   +  F  +  SQ         A  +     K     EG +++    +G+ VE                  W     +QH +MY FFG +G+  +L      +P + D    +L+LFVEG LF FHVH R  LD  +H LL++  + G+  ++L +     ++ ++  +   ++QGSWF+Q+G +LYP+  P  W    HG++M  TM FCWH    + L A  S +++  L R   +  + +   R    K   +  + E+S E+
Sbjct:    1 MANFGGHAIPGSFFLFYG-FCLTVKYVLFHNWRKSQPK-------ARQILPPLFKRINYFEGGLQVFASFVGIMVEQFVVDGPHAHLYDKENKSWVKLMNWQHSSMYLFFGISGIAMLLSTSSKLVPARIDRVALSLALFVEGFLFYFHVHARPPLDAHIHSLLLFPVFAGSASIMLELFIKDNILLELFGACFFILQGSWFYQIGFVLYPLSGPD-WDLNEHGNIMFVTMCFCWHLAMALLLVASTSFLVWFTLTRFSDRRGDIEIGMRNTFSKTNSEKALLEESEEE 280          
BLAST of Transmembrane protein 45B vs. Ensembl Medaka
Match: tmem45b (transmembrane protein 45B [Source:NCBI gene;Acc:101167390])

HSP 1 Score: 103.219 bits (256), Expect = 4.914e-25
Identity = 84/289 (29.07%), Postives = 138/289 (47.75%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVECL-------------GFFWGIPAMYQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWH----IFLNALFSIILYSILFR-VIKPVETKTSTRYEQLKNEQDFDIEEQSTEQ 935
            M +F GHA+PG+FF  +G + L   +  F  +  SQ         A  +     K     EG +++    +G+ VE                  W     +QH +MY FFG +G+  +L      +P + D    +L+LFVEG LF FHVH R  LD  +H LL++  + G+  ++L +     ++ ++  +   ++QGSWF+Q+G +LYP+  P  W    HG++M  TM FCWH    + L A  S +++  L R   +  + +   R    K   +  + E+S E+
Sbjct:    1 MANFGGHAIPGSFFLFYG-FCLTVKYVLFHNWRKSQPK-------ARQILPPLFKRINYFEGGLQVFASFVGIMVEQFVVDGPHAHLYDKENKSWVKLMNWQHSSMYLFFGISGIAMLLSTSSKLVPARIDRVALSLALFVEGFLFYFHVHARPPLDAHIHSLLLFPVFAGSASIMLELFIKDNILLELFGACFFILQGSWFYQIGFVLYPLSGPD-WDLNEHGNIMFVTMCFCWHLAMALLLVASTSFLVWFTLTRFSDRRGDIEIGMRNTFSKTNSEKALLEESEEE 280          
BLAST of Transmembrane protein 45B vs. Planmine SMEST
Match: SMESG000060226.1 (SMESG000060226.1)

HSP 1 Score: 538.88 bits (1387), Expect = 0.000e+0
Identity = 273/284 (96.13%), Postives = 279/284 (98.24%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVECLGFFWGIPAMYQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILYSILFRVIKPVETKTSTRYEQLKNEQDFDIEEQSTEQFLKPKMSINDSFL 974
            MGSFFGHALPGTFFYMFGVW LVNAFYYFIKYNGSQNNNSKKFL+AHSLRCCCS NHKPLEGIVKLACCTIGMSVECLGFFWGIPAMYQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRT+LDVVLHVLLVYVCYFGALVVVLMMIFNKQLIFKVLFSLS LIQGSWFWQVGSILYPIIKPS+WCETCHGDVMNATMIFCWHIFLNALF+IILYSILFRVI PVETKTSTRY+ LKN+QDFDIEEQSTEQFLKPKMSINDSFL
Sbjct:    1 MGSFFGHALPGTFFYMFGVWHLVNAFYYFIKYNGSQNNNSKKFLLAHSLRCCCSNNHKPLEGIVKLACCTIGMSVECLGFFWGIPAMYQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTNLDVVLHVLLVYVCYFGALVVVLMMIFNKQLIFKVLFSLSFLIQGSWFWQVGSILYPIIKPSKWCETCHGDVMNATMIFCWHIFLNALFAIILYSILFRVINPVETKTSTRYKHLKNDQDFDIEEQSTEQFLKPKMSINDSFL 284          
BLAST of Transmembrane protein 45B vs. Planmine SMEST
Match: SMESG000045717.1 (SMESG000045717.1)

HSP 1 Score: 512.686 bits (1319), Expect = 0.000e+0
Identity = 258/284 (90.85%), Postives = 270/284 (95.07%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVECLGFFWGIPAMYQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILYSILFRVIKPVETKTSTRYEQLKNEQDFDIEEQSTEQFLKPKMSINDSFL 974
            MGSFFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQNNNSKKFL+AHSLRCCCS NHKPLEGIVKLACCTIGMSVECLGFFWGIPAMYQHFTMYAFFGFAGLVDILLHY+FSIPEKFD+CIHALS +VEGMLFAFHVHGRT LDVVLHVLLVYVCYF ALVV+LMMIFNK LIFKVL+SLSLLIQGSWFWQV SILYPII+PS+WCETCHGDVMNATMIFCWHIFLNALF+IILYSIL RVIK VETK STRYE +KN+QDFDIEEQSTEQ LKPKM  N+S L
Sbjct:    1 MGSFFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQNNNSKKFLLAHSLRCCCSNNHKPLEGIVKLACCTIGMSVECLGFFWGIPAMYQHFTMYAFFGFAGLVDILLHYNFSIPEKFDYCIHALSFYVEGMLFAFHVHGRTSLDVVLHVLLVYVCYFSALVVILMMIFNKPLIFKVLYSLSLLIQGSWFWQVASILYPIIQPSKWCETCHGDVMNATMIFCWHIFLNALFAIILYSILNRVIKTVETKASTRYEHMKNDQDFDIEEQSTEQLLKPKMFNNESLL 284          
BLAST of Transmembrane protein 45B vs. Planmine SMEST
Match: SMESG000021986.1 (SMESG000021986.1)

HSP 1 Score: 474.552 bits (1220), Expect = 2.527e-170
Identity = 236/284 (83.10%), Postives = 243/284 (85.56%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVECLGFFWGIPAMYQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILYSILFRVIKPVETKTSTRYEQLKNEQDFDIEEQSTEQFLKPKMSINDSFL 974
            MG+FFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQNNNSKKFL+AHSLRCCCSKNHKPLEGIVKLACCTIGMSVECLGFFWGIPAMYQHFTMYAFFGFA LVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRT                              L   +   L  LIQGSWFWQVGSILYPIIKPS+WCETCHGDVMNATMIFCWHIFLNALF+IILYSILFRVI PVETKTSTRYE LKN+QDFDIEEQSTEQFLKPKMSIND+FL
Sbjct:    1 MGTFFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQNNNSKKFLLAHSLRCCCSKNHKPLEGIVKLACCTIGMSVECLGFFWGIPAMYQHFTMYAFFGFASLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRT-----------------------------NLDVVLHVLLVFLIQGSWFWQVGSILYPIIKPSKWCETCHGDVMNATMIFCWHIFLNALFAIILYSILFRVINPVETKTSTRYEHLKNDQDFDIEEQSTEQFLKPKMSINDTFL 255          
BLAST of Transmembrane protein 45B vs. Planmine SMEST
Match: SMESG000048714.1 (SMESG000048714.1)

HSP 1 Score: 458.759 bits (1179), Expect = 1.061e-163
Identity = 233/276 (84.42%), Postives = 248/276 (89.86%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVECLGFFWGIPAMYQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILYSILFRVIKPVETKTSTRYEQLKNEQDFDIEEQSTEQFLKPK 950
            MGSFFGHALPGTFFYMFGVW LVN FYYFIKYNGSQNNNSKKFL+AHSLR CC K H PLEGIVKLACCTIGMSVEC GFF GIPAMYQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALS +VEGMLFAFHVHG+T L+VVLHVLLVYVCYFGALVV  MMIFNKQL+F+VL SL  LIQGSWFWQV  ILYPII+PS+WCETCH DVM ATMIFCWHIFLNAL +IILYSI+FR+IKPVET+TST+YE LKN+QDFDIEEQ      K +
Sbjct:    1 MGSFFGHALPGTFFYMFGVWHLVNTFYYFIKYNGSQNNNSKKFLLAHSLRFCCLKKHIPLEGIVKLACCTIGMSVECWGFFHGIPAMYQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSFYVEGMLFAFHVHGQTSLEVVLHVLLVYVCYFGALVVAFMMIFNKQLMFRVLLSLCFLIQGSWFWQVAIILYPIIEPSQWCETCHEDVMTATMIFCWHIFLNALLAIILYSIIFRIIKPVETETSTQYEHLKNDQDFDIEEQKYRTAFKDQ 276          
BLAST of Transmembrane protein 45B vs. Planmine SMEST
Match: SMESG000045710.1 (SMESG000045710.1)

HSP 1 Score: 456.447 bits (1173), Expect = 9.277e-163
Identity = 232/276 (84.06%), Postives = 247/276 (89.49%), Query Frame = 3
Query:  123 MGSFFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQNNNSKKFLIAHSLRCCCSKNHKPLEGIVKLACCTIGMSVECLGFFWGIPAMYQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTXXXXXXXXXXXYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPIIKPSRWCETCHGDVMNATMIFCWHIFLNALFSIILYSILFRVIKPVETKTSTRYEQLKNEQDFDIEEQSTEQFLKPK 950
            MGSFFGHALPGTFFYMFGVW LVNAFYYFIKYNGSQNNNSKKFL+AHSLR CC K H PLEGIVKL+CC IGMSVEC GFF GIPAMYQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALS +VEGMLFAFHVHG+T L+VVLHVLLVYVCYFGALVV  MMIFNKQL+F+VL SL  LIQGSWFWQV  ILYPI KPS+WCETCH DVM ATMIFCWHIFLNAL +IILYSI+FR+IKPVET+TST+YE LKN+QDFDIEEQ      K +
Sbjct:    1 MGSFFGHALPGTFFYMFGVWHLVNAFYYFIKYNGSQNNNSKKFLLAHSLRFCCLKKHIPLEGIVKLSCCIIGMSVECWGFFHGIPAMYQHFTMYAFFGFAGLVDILLHYDFSIPEKFDFCIHALSFYVEGMLFAFHVHGQTSLEVVLHVLLVYVCYFGALVVAFMMIFNKQLMFRVLLSLCFLIQGSWFWQVAIILYPIKKPSKWCETCHEDVMTATMIFCWHIFLNALLAIILYSIIFRIIKPVETETSTQYEHLKNDQDFDIEEQKYRTAFKDQ 276          
The following BLAST results are available for this feature:
BLAST of Transmembrane protein 45B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TMEM45B2.307e-2730.45transmembrane protein 45B [Source:HGNC Symbol;Acc:... [more]
TMEM45B2.307e-2730.45transmembrane protein 45B [Source:HGNC Symbol;Acc:... [more]
TMEM45A2.140e-2531.39transmembrane protein 45A [Source:HGNC Symbol;Acc:... [more]
TMEM45A2.161e-2531.39transmembrane protein 45A [Source:HGNC Symbol;Acc:... [more]
TMEM45A2.742e-1133.52transmembrane protein 45A [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Transmembrane protein 45B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 45B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 45B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tmem45a4.848e-3031.23transmembrane protein 45a [Source:ZFIN;Acc:ZDB-GEN... [more]
tmem45b1.606e-2830.14transmembrane protein 45B [Source:NCBI gene;Acc:40... [more]
back to top
BLAST of Transmembrane protein 45B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nedd4l8.944e-3831.69NEDD4 like E3 ubiquitin protein ligase [Source:Xen... [more]
mkrn31.664e-3334.88makorin ring finger protein 3 [Source:Xenbase;Acc:... [more]
ENSXETT00000039903.11.613e-1226.92pep primary_assembly:Xenopus_tropicalis_v9.1:5:111... [more]
back to top
BLAST of Transmembrane protein 45B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tmem45b6.373e-3129.86transmembrane protein 45b [Source:MGI Symbol;Acc:M... [more]
Tmem45b7.536e-2432.40transmembrane protein 45b [Source:MGI Symbol;Acc:M... [more]
Tmem45a1.841e-2129.02transmembrane protein 45a [Source:MGI Symbol;Acc:M... [more]
Teddm29.927e-923.62transmembrane epididymal family member 2 [Source:M... [more]
Teddm22.069e-828.10transmembrane epididymal family member 2 [Source:M... [more]
back to top
BLAST of Transmembrane protein 45B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5XGD7|TM45B_XENTR4.738e-3731.69Transmembrane protein 45B OS=Xenopus tropicalis OX... [more]
sp|Q6NS09|TM45B_XENLA1.704e-3434.90Transmembrane protein 45B OS=Xenopus laevis OX=835... [more]
sp|Q497B2|TM45B_RAT7.284e-3232.37Transmembrane protein 45B OS=Rattus norvegicus OX=... [more]
sp|Q3T130|TM45B_BOVIN1.245e-3030.58Transmembrane protein 45B OS=Bos taurus OX=9913 GN... [more]
sp|Q8VCZ2|TM45B_MOUSE4.458e-3029.86Transmembrane protein 45B OS=Mus musculus OX=10090... [more]
back to top
BLAST of Transmembrane protein 45B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1G9451.165e-4037.75Uncharacterized protein OS=Helobdella robusta OX=6... [more]
T1EH147.203e-3940.00Uncharacterized protein OS=Helobdella robusta OX=6... [more]
A0A401SF882.317e-3833.45Uncharacterized protein OS=Chiloscyllium punctatum... [more]
A0A226E6A51.574e-3640.51Transmembrane protein 45B OS=Folsomia candida OX=1... [more]
G1KL808.597e-3635.11Transmembrane protein 45A OS=Anolis carolinensis O... [more]
back to top
BLAST of Transmembrane protein 45B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tmem45b1.507e-2930.00transmembrane protein 45B [Source:NCBI gene;Acc:10... [more]
tmem45a2.150e-2129.97transmembrane protein 45a [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Transmembrane protein 45B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 45B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 45B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 45B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tmem45a2.997e-3031.34transmembrane protein 45A [Source:NCBI gene;Acc:10... [more]
tmem45a2.304e-2832.45transmembrane protein 45A [Source:NCBI gene;Acc:10... [more]
tmem45b4.914e-2529.07transmembrane protein 45B [Source:NCBI gene;Acc:10... [more]
tmem45b4.914e-2529.07transmembrane protein 45B [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Transmembrane protein 45B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060226.10.000e+096.13SMESG000060226.1[more]
SMESG000045717.10.000e+090.85SMESG000045717.1[more]
SMESG000021986.12.527e-17083.10SMESG000021986.1[more]
SMESG000048714.11.061e-16384.42SMESG000048714.1[more]
SMESG000045710.19.277e-16384.06SMESG000045710.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008080 ID=SMED30008080|Name=Transmembrane protein 45B|organism=Schmidtea mediterranea sexual|type=transcript|length=1067bp
ATTGAGTTAAAGTTAACAATAATTTTAAAATTGAATATTTAATTTCTAAT
TGTTACCATATCAACAGAAAGCTTGAATCCATTTATTTTATTATTATTAT
TTCTTTTTACTGAAATTGGCAAATGGGCAGTTTTTTTGGACATGCTTTAC
CCGGCACGTTTTTCTATATGTTTGGAGTCTGGCAGTTAGTCAATGCATTT
TACTATTTTATCAAGTACAACGGTTCACAAAACAATAATTCGAAGAAATT
TTTAATCGCTCACTCACTTCGATGTTGCTGTTCAAAAAATCACAAACCGT
TAGAAGGAATCGTGAAATTGGCGTGTTGCACAATTGGGATGTCAGTAGAA
TGTTTGGGATTCTTTTGGGGCATCCCAGCAATGTATCAACATTTTACGAT
GTACGCATTTTTCGGATTTGCCGGTCTGGTTGACATTTTGCTTCACTACG
ACTTCTCGATTCCTGAAAAGTTTGATTTCTGCATTCATGCGTTGAGTTTA
TTTGTCGAAGGAATGCTGTTTGCATTTCATGTTCACGGAAGAACACATCT
AGACGTGGTTCTTCATGTCCTCTTAGTCTATGTTTGTTATTTTGGTGCGC
TAGTAGTAGTTTTGATGATGATATTCAATAAACAGTTAATTTTTAAAGTT
TTATTCTCGTTAAGTTTACTGATTCAAGGCAGCTGGTTTTGGCAGGTAGG
TTCAATCCTTTATCCAATTATCAAACCCTCAAGATGGTGTGAAACTTGTC
ATGGAGACGTCATGAATGCCACGATGATCTTTTGTTGGCATATCTTTTTG
AACGCTTTGTTTTCGATTATTCTTTATTCAATCCTTTTTAGAGTTATCAA
ACCAGTTGAAACTAAAACGTCAACTCGATACGAACAACTGAAGAACGAAC
AAGATTTCGACATTGAAGAACAAAGTACAGAACAGTTTTTAAAGCCCAAA
ATGTCGATTAATGATTCTTTCTTATAAACAATAACTGGGACATCATAAAT
TTTCTGTGTTTGATATATTAATATAATTATTAACAACGGATATAACATTA
TTTGATTTTAAAAAAAA
back to top

protein sequence of SMED30008080-orf-1

>SMED30008080-orf-1 ID=SMED30008080-orf-1|Name=SMED30008080-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=285bp
MGSFFGHALPGTFFYMFGVWQLVNAFYYFIKYNGSQNNNSKKFLIAHSLR
CCCSKNHKPLEGIVKLACCTIGMSVECLGFFWGIPAMYQHFTMYAFFGFA
GLVDILLHYDFSIPEKFDFCIHALSLFVEGMLFAFHVHGRTHLDVVLHVL
LVYVCYFGALVVVLMMIFNKQLIFKVLFSLSLLIQGSWFWQVGSILYPII
KPSRWCETCHGDVMNATMIFCWHIFLNALFSIILYSILFRVIKPVETKTS
TRYEQLKNEQDFDIEEQSTEQFLKPKMSINDSFL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000232copulatory apparatus
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR042127TMEM45
IPR006904DUF716
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006904Protein of unknown function DUF716PFAMPF04819DUF716coord: 117..235
e-value: 8.6E-19
score: 67.5
NoneNo IPR availablePANTHERPTHR16007:SF15coord: 1..252
NoneNo IPR availableTMHMMTMhelixcoord: 220..242
NoneNo IPR availableTMHMMTMhelixcoord: 178..200
NoneNo IPR availableTMHMMTMhelixcoord: 146..168
NoneNo IPR availableTMHMMTMhelixcoord: 78..100
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
NoneNo IPR availableTMHMMTMhelixcoord: 120..139
IPR042127Transmembrane protein 45PANTHERPTHR16007EPIDIDYMAL MEMBRANE PROTEIN E9-RELATEDcoord: 1..252