WD repeat-containing protein 7

Overview
NameWD repeat-containing protein 7
Smed IDSMED30008079
Length (bp)4386
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD repeat-containing protein 7 (SMED30008079) t-SNE clustered cells

Violin plots show distribution of expression levels for WD repeat-containing protein 7 (SMED30008079) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD repeat-containing protein 7 (SMED30008079) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD repeat-containing protein 7 (SMED30008079) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008079

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30008079SMESG000032157.1 Contig1258newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008079SMESG000032157.1 Contig1258uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008079SMESG000069681.1 Contig1258newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008079SMESG000069681.1 Contig1258uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30008079SMESG000032157.1 dd_Smed_v4_6105_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30008079SMESG000032157.1 dd_Smed_v4_6105_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008079SMESG000032157.1 dd_Smed_v4_6105_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD repeat-containing protein 7 vs. Ensembl Human
Match: WDR7 (WD repeat domain 7 [Source:HGNC Symbol;Acc:HGNC:13490])

HSP 1 Score: 187.578 bits (475), Expect = 3.915e-47
Identity = 160/677 (23.63%), Postives = 292/677 (43.13%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQK-SIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFR----KQSLNLCDNIPNLLVEFPQPE------------NTASFRHKIEIQNQEDVIIIWKGFSNGNIYKWEFT-------KQSKLITQNRFCLDDSWEKITKAPTSLTKSIQGIDTAGS---VTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDST-----SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
            GNS +    LW  +AP H IS+++       +V+GC +G I +W  +    Q+ P   L GH + I+   L+ +  +++ +Y VS S  GE+ LW+  +GR IEF  ++ +   IQ+ + F   N ++  +LC     EI V+++ SL  + +LV   SP+W SS++  +    ++D ++A SV+G++ +W V  T   +       I  ++   I   N   IS   ++    L++ S  ++VF      +L       G  +  G F+S D +I+ T +G+ ++Y+LP    P S  FR    K   NL   + ++L++    E                + HK+ IQ          G S+G +  W  +        +  L       L ++++K+   P  +   +  I  +     VT+ ++I     +V G E+G I++     T      + +         +  L+GHR  VTCLL+P                  QV     +    L SGGVD+++ +WD+   +M  +F  H   +T L                          +   E  S  ++  I          +A +  + ++S+ ++K ++  S H  P++ + W     YL++   + +V+VW + +G +DR   G  A  ++  C
Sbjct:    3 GNSLVLPIVLWGRKAPTHCISAVLLTDDGATIVTGCHDGQICLWDLSVE-LQINPRALLFGHTASIT--CLSKACASSDKQYIVSASESGEMCLWDVSDGRCIEFTKLACTHTGIQF-YQFSVGNQREGRLLCHGHYPEILVVDATSLEVLYSLVSKISPDWISSMSIIRSHRTQEDTVVALSVTGILKVWIV--TSEISDMQDTEPIFEEESKPIYCQNCQSISFCAFTQRSLLVVCSKYWRVFDAGDYSLLCSGPSENGQTWTGGDFVSSDKVIIWTENGQSYIYKLPASCLPASDSFRSDVGKAVENLIPPVQHILLDRKDKELLICPPVTRFFYGCREYFHKLLIQ----------GDSSGRLNIWNISDTADKQGSEEGLAMTTSISLQEAFDKLNPCPAGIIDQLSVIPNSNEPLKVTASVYIPAHGRLVCGREDGSIVIVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLYP-----------------HQVSARYDQ--RYLISGGVDFSVIIWDIFSGEMKHIFCVHGGEITQL--------------------------LVPPENCSARVQHCI--------CSVASDHSVGLLSLREKKCIMLASRHLFPIQVIKWRPSDDYLVVGCSDGSVYVWQMDTGALDRCVMGITAVEILNAC 610          

HSP 2 Score: 97.0561 bits (240), Expect = 2.213e-19
Identity = 87/372 (23.39%), Postives = 167/372 (44.89%), Query Frame = 3
Query: 3183 IDQINTDHERRNLSKIQIKALLNI--ALVGSHLKPDENNDINSDSKLFSKLFTLDKSF----LARITCDFLMSVL--SKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLED--ADIDDKLL-------SLVSHKAIEDIASARPLIFVMVCYREMLKWCSISLNTFHNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIYFY----IKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQISNAIFSLGG---NSHQVKLINSQSIPSLE 4226
            + +I+T +E R      I  LL +  A  G+ ++P +       S    + F L        LAR TC  L  +L     PK+   +  R   + +I    GF VWEPY+D + V+   L    D E   A+I   L        +  +  A+  IA+ARP  F+    +E+ +  +++ NT  +  +M T+ T+ R K                         ++ +   L +     ++D+L E++++ +Y      +K +        + +F  VS+ E   +++VG+  G++ L+D++ GK  +   HK  I    F+ DGR +A+YS +++ +  WQ++ ++    G   ++ Q++ I +  +P ++
Sbjct: 1077 MKKISTSYEERRKQATAI-VLLGVIGAEFGAEIEPPKLLTRPRSSSQIPEGFGLTSGGSNYSLARHTCKALTFLLLQPPSPKLPPHSTIRRTAIDLI--GRGFTVWEPYMDVSAVLMGLLELCADAEKQLANITMGLPLSPAADSARSARHALSLIATARPPAFITTIAKEVHRHTALAANT-QSQQNMHTT-TLARAKGE-----------------------ILRVIEILIEKMPTDVVDLLVEVMDIIMYCLEGSLVKKKGLQECFPAICRFYMVSYYERNHRIAVGARHGSVALYDIRTGKCQTIHGHKGPITAVAFAPDGRYLATYSNTDSHISFWQMNTSLLGSIGMLNSAPQLRCIKTYQVPPVQ 1420          
BLAST of WD repeat-containing protein 7 vs. Ensembl Human
Match: WDR7 (WD repeat domain 7 [Source:HGNC Symbol;Acc:HGNC:13490])

HSP 1 Score: 187.193 bits (474), Expect = 4.743e-47
Identity = 160/677 (23.63%), Postives = 292/677 (43.13%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQK-SIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFR----KQSLNLCDNIPNLLVEFPQPE------------NTASFRHKIEIQNQEDVIIIWKGFSNGNIYKWEFT-------KQSKLITQNRFCLDDSWEKITKAPTSLTKSIQGIDTAGS---VTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDST-----SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
            GNS +    LW  +AP H IS+++       +V+GC +G I +W  +    Q+ P   L GH + I+   L+ +  +++ +Y VS S  GE+ LW+  +GR IEF  ++ +   IQ+ + F   N ++  +LC     EI V+++ SL  + +LV   SP+W SS++  +    ++D ++A SV+G++ +W V  T   +       I  ++   I   N   IS   ++    L++ S  ++VF      +L       G  +  G F+S D +I+ T +G+ ++Y+LP    P S  FR    K   NL   + ++L++    E                + HK+ IQ          G S+G +  W  +        +  L       L ++++K+   P  +   +  I  +     VT+ ++I     +V G E+G I++     T      + +         +  L+GHR  VTCLL+P                  QV     +    L SGGVD+++ +WD+   +M  +F  H   +T L +                            E  S  ++  I          +A +  + ++S+ ++K ++  S H  P++ + W     YL++   + +V+VW + +G +DR   G  A  ++  C
Sbjct:    3 GNSLVLPIVLWGRKAPTHCISAVLLTDDGATIVTGCHDGQICLWDLSVE-LQINPRALLFGHTASIT--CLSKACASSDKQYIVSASESGEMCLWDVSDGRCIEFTKLACTHTGIQF-YQFSVGNQREGRLLCHGHYPEILVVDATSLEVLYSLVSKISPDWISSMSIIRSHRTQEDTVVALSVTGILKVWIV--TSEISDMQDTEPIFEEESKPIYCQNCQSISFCAFTQRSLLVVCSKYWRVFDAGDYSLLCSGPSENGQTWTGGDFVSSDKVIIWTENGQSYIYKLPASCLPASDSFRSDVGKAVENLIPPVQHILLDRKDKELLICPPVTRFFYGCREYFHKLLIQ----------GDSSGRLNIWNISDTADKQGSEEGLAMTTSISLQEAFDKLNPCPAGIIDQLSVIPNSNEPLKVTASVYIPAHGRLVCGREDGSIVIVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLYP-----------------HQVSARYDQ--RYLISGGVDFSVIIWDIFSGEMKHIFCVHGGEITQLLV--------------------------PPENCSARVQHCI--------CSVASDHSVGLLSLREKKCIMLASRHLFPIQVIKWRPSDDYLVVGCSDGSVYVWQMDTGALDRCVMGITAVEILNAC 610          

HSP 2 Score: 96.6709 bits (239), Expect = 2.579e-19
Identity = 87/372 (23.39%), Postives = 167/372 (44.89%), Query Frame = 3
Query: 3183 IDQINTDHERRNLSKIQIKALLNI--ALVGSHLKPDENNDINSDSKLFSKLFTLDKSF----LARITCDFLMSVL--SKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLED--ADIDDKLL-------SLVSHKAIEDIASARPLIFVMVCYREMLKWCSISLNTFHNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIYFY----IKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQISNAIFSLGG---NSHQVKLINSQSIPSLE 4226
            + +I+T +E R      I  LL +  A  G+ ++P +       S    + F L        LAR TC  L  +L     PK+   +  R   + +I    GF VWEPY+D + V+   L    D E   A+I   L        +  +  A+  IA+ARP  F+    +E+ +  +++ NT  +  +M T+ T+ R K                         ++ +   L +     ++D+L E++++ +Y      +K +        + +F  VS+ E   +++VG+  G++ L+D++ GK  +   HK  I    F+ DGR +A+YS +++ +  WQ++ ++    G   ++ Q++ I +  +P ++
Sbjct: 1110 MKKISTSYEERRKQATAI-VLLGVIGAEFGAEIEPPKLLTRPRSSSQIPEGFGLTSGGSNYSLARHTCKALTFLLLQPPSPKLPPHSTIRRTAIDLI--GRGFTVWEPYMDVSAVLMGLLELCADAEKQLANITMGLPLSPAADSARSARHALSLIATARPPAFITTIAKEVHRHTALAANT-QSQQNMHTT-TLARAKGE-----------------------ILRVIEILIEKMPTDVVDLLVEVMDIIMYCLEGSLVKKKGLQECFPAICRFYMVSYYERNHRIAVGARHGSVALYDIRTGKCQTIHGHKGPITAVAFAPDGRYLATYSNTDSHISFWQMNTSLLGSIGMLNSAPQLRCIKTYQVPPVQ 1453          
BLAST of WD repeat-containing protein 7 vs. Ensembl Human
Match: WDR72 (WD repeat domain 72 [Source:HGNC Symbol;Acc:HGNC:26790])

HSP 1 Score: 139.813 bits (351), Expect = 7.208e-33
Identity = 138/667 (20.69%), Postives = 294/667 (44.08%), Query Frame = 3
Query:  117 NSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEFISNSQMNIQYVFSFESAN-TKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQK-SIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTETCD--ILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCDNI-PNLLVEFPQPENTASFRH----KIEIQNQEDVIIIWKGFSNGNIYKWEF--TKQSKLITQNR-------FCLDDSWEKITKAPTSLTKSIQGI-DTAGS--VTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDS----TSNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
             +S+ + ALW  +AP H+I++++       +V+G + G + +W+ +    +++    L GH + ++   LA +   +   Y VS + +GE+ +W    G+ +E  +    +    +   S   T +  +LCC +  ++ ++++ +LA + +   +  P+W + +       I++D +L  SV+G + +W+++ +    Q    +     ++  +E+ N   I    Y+  + L++ S  +KV+  + CD  +L  +    G +F  G  I+   I++ T  G  ++YQL   +    S +      L + I P+LL      EN    R      +  + +    +++ G  +G I  W       SK     R       + L D+++K      S+     G+ D AG+  VTS  +I  L  ++ G E+G II+    +   +   E  S    +  + +LKGH   VT LL+P         ++S  + QS            + SG +D  + +WD+  E+++  F   + P+T+L ++                                   +   +     +  +  +  ++++ +  +  LL    H  PVR + W     +L++   +D+V++W++ +G ++R+E+G++A++++  C
Sbjct:    2 RTSLQAVALWGQKAPPHSITAIMITDDQRTIVTGSQEGQLCLWNLSHEL-KISAKELLFGHSASVT--CLARARDFSKQPYIVSAAENGEMCVWNVTNGQCMEKATLPYRHTAICYYHCSFRMTGEGWLLCCGEYQDVLIIDAKTLAVVHSFRSSQFPDWINCMCIVHSMRIQEDSLLVVSVAGELKVWDLSSSINSIQEKQDVYEKESKF--LESLNCQTIRFCTYTERLLLVVFSKCWKVY--DYCDFSLLLTEVSRNGQFFAGGEVIAAHRILIWTEDGHSYIYQL-LNSGLSKSIYPADGRVLKETIYPHLLCSTSVQENKEQSRPFVMGYMNERKEPFYKVLFSGEVSGRITLWHIPDVPVSKFDGSPREIPVTATWTLQDNFDKHDTMSQSIIDYFSGLKDGAGTAVVTSSEYIPSLDKLICGCEDGTIIITQALNAAKARLLEGGSLVKDSPPHKVLKGHHQSVTSLLYPHG-------LSSKLD-QSW-----------MLSGDLDSCVILWDIFTEEILHKFFLEAGPVTSLLMS----------------------------------PEKFKLRGEQIICCVCGDHSVALLHLEGKSCLLHARKHLFPVRMIKWHPVENFLIVGCADDSVYIWEIETGTLERHETGERARIILNCC 607          
BLAST of WD repeat-containing protein 7 vs. Ensembl Human
Match: WDR72 (WD repeat domain 72 [Source:HGNC Symbol;Acc:HGNC:26790])

HSP 1 Score: 139.043 bits (349), Expect = 2.073e-32
Identity = 138/667 (20.69%), Postives = 291/667 (43.63%), Query Frame = 3
Query:  117 NSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEFISNSQMNIQYVFSFESAN-TKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQK-SIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTETCD--ILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCDNI-PNLLVEFPQPENTASFRH----KIEIQNQEDVIIIWKGFSNGNIYKWEF--TKQSKLITQNR-------FCLDDSWEKITKAPTSLTKSIQGI-DTAGS--VTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDS----TSNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
             +S+ + ALW  +AP H+I++++       +V+G + G + +W+ +    +++    L GH + ++   LA +   +   Y VS + +GE+ +W    G+ +E  +    +    +   S   T +  +LCC +  ++ ++++ +LA + +   +  P+W + +       I++D +L  SV+G + +W+++ +    Q    +     ++  +E+ N   I    Y+  + L++ S  +KV+  + CD  +L  +    G +F  G  I+   I++ T  G  ++YQL   +    S +      L + I P+LL      EN    R      +  + +    +++ G  +G I  W       SK     R       + L D+++K      S+     G+ D AG+  VTS  +I  L  ++ G E+G II+    +   +   E  S    +  + +LKGH   VT LL+P           S    QS            + SG +D  + +WD+  E+++  F   + P+T+L ++                                   +   +     +  +  +  ++++ +  +  LL    H  PVR + W     +L++   +D+V++W++ +G ++R+E+G++A++++  C
Sbjct:    2 RTSLQAVALWGQKAPPHSITAIMITDDQRTIVTGSQEGQLCLWNLSHEL-KISAKELLFGHSASVT--CLARARDFSKQPYIVSAAENGEMCVWNVTNGQCMEKATLPYRHTAICYYHCSFRMTGEGWLLCCGEYQDVLIIDAKTLAVVHSFRSSQFPDWINCMCIVHSMRIQEDSLLVVSVAGELKVWDLSSSINSIQEKQDVYEKESKF--LESLNCQTIRFCTYTERLLLVVFSKCWKVY--DYCDFSLLLTEVSRNGQFFAGGEVIAAHRILIWTEDGHSYIYQL-LNSGLSKSIYPADGRVLKETIYPHLLCSTSVQENKEQSRPFVMGYMNERKEPFYKVLFSGEVSGRITLWHIPDVPVSKFDGSPREIPVTATWTLQDNFDKHDTMSQSIIDYFSGLKDGAGTAVVTSSEYIPSLDKLICGCEDGTIIITQALNAAKARLLEGGSLVKDSPPHKVLKGHHQSVTSLLYPHG--------LSSKLDQSW-----------MLSGDLDSCVILWDIFTEEILHKFFLEAGPVTSLLMS----------------------------------PEKFKLRGEQIICCVCGDHSVALLHLEGKSCLLHARKHLFPVRMIKWHPVENFLIVGCADDSVYIWEIETGTLERHETGERARIILNCC 607          
BLAST of WD repeat-containing protein 7 vs. Ensembl Human
Match: WDR72 (WD repeat domain 72 [Source:HGNC Symbol;Acc:HGNC:26790])

HSP 1 Score: 139.043 bits (349), Expect = 2.073e-32
Identity = 138/667 (20.69%), Postives = 291/667 (43.63%), Query Frame = 3
Query:  117 NSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEFISNSQMNIQYVFSFESAN-TKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQK-SIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTETCD--ILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCDNI-PNLLVEFPQPENTASFRH----KIEIQNQEDVIIIWKGFSNGNIYKWEF--TKQSKLITQNR-------FCLDDSWEKITKAPTSLTKSIQGI-DTAGS--VTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDS----TSNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
             +S+ + ALW  +AP H+I++++       +V+G + G + +W+ +    +++    L GH + ++   LA +   +   Y VS + +GE+ +W    G+ +E  +    +    +   S   T +  +LCC +  ++ ++++ +LA + +   +  P+W + +       I++D +L  SV+G + +W+++ +    Q    +     ++  +E+ N   I    Y+  + L++ S  +KV+  + CD  +L  +    G +F  G  I+   I++ T  G  ++YQL   +    S +      L + I P+LL      EN    R      +  + +    +++ G  +G I  W       SK     R       + L D+++K      S+     G+ D AG+  VTS  +I  L  ++ G E+G II+    +   +   E  S    +  + +LKGH   VT LL+P           S    QS            + SG +D  + +WD+  E+++  F   + P+T+L ++                                   +   +     +  +  +  ++++ +  +  LL    H  PVR + W     +L++   +D+V++W++ +G ++R+E+G++A++++  C
Sbjct:    2 RTSLQAVALWGQKAPPHSITAIMITDDQRTIVTGSQEGQLCLWNLSHEL-KISAKELLFGHSASVT--CLARARDFSKQPYIVSAAENGEMCVWNVTNGQCMEKATLPYRHTAICYYHCSFRMTGEGWLLCCGEYQDVLIIDAKTLAVVHSFRSSQFPDWINCMCIVHSMRIQEDSLLVVSVAGELKVWDLSSSINSIQEKQDVYEKESKF--LESLNCQTIRFCTYTERLLLVVFSKCWKVY--DYCDFSLLLTEVSRNGQFFAGGEVIAAHRILIWTEDGHSYIYQL-LNSGLSKSIYPADGRVLKETIYPHLLCSTSVQENKEQSRPFVMGYMNERKEPFYKVLFSGEVSGRITLWHIPDVPVSKFDGSPREIPVTATWTLQDNFDKHDTMSQSIIDYFSGLKDGAGTAVVTSSEYIPSLDKLICGCEDGTIIITQALNAAKARLLEGGSLVKDSPPHKVLKGHHQSVTSLLYPHG--------LSSKLDQSW-----------MLSGDLDSCVILWDIFTEEILHKFFLEAGPVTSLLMS----------------------------------PEKFKLRGEQIICCVCGDHSVALLHLEGKSCLLHARKHLFPVRMIKWHPVENFLIVGCADDSVYIWEIETGTLERHETGERARIILNCC 607          
BLAST of WD repeat-containing protein 7 vs. Ensembl Celegans
Match: rbc-2 (RaBConnectin related [Source:UniProtKB/TrEMBL;Acc:Q9BL05])

HSP 1 Score: 91.2781 bits (225), Expect = 4.101e-18
Identity = 68/301 (22.59%), Postives = 139/301 (46.18%), Query Frame = 3
Query:  102 MTEIGNSSIFSFAL------WLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEFISNSQMNIQYVFSF---ESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQKSIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITS-CQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLP 974
            M E+  +   S AL      W  + P + I ++  L     +++G ENG+IIIW   K  + L P   +IGH  KI+   ++ ++       FVS S DG + LWE ++GR I+  S+  ++ +Y++ +    S +T+   + C    S+I V++   L  + ++     P+W S  T      K+D ++  ++SG++ +W +   +   + +    +  D+   +E  +   +S+   +  + LII S C   +   +   ++ +++       + G+    D + +        ++QLP
Sbjct:    1 MVEVAPAGTKSPALSVPVVIWGPKPPENKICAIRVLPDGATIITGAENGHIIIW---KLAEGLMPKQLMIGHSQKIT--AISQTTNTPTNTRFVSASADGRVCLWEIQDGRCIDSTSSIAIH-RYIYPYTYKSSRHTRATRLFCIGDYSDIQVMDPQDLTVVFSISSRVEPDWISCFTIISHPEKEDQLIGMTLSGMMKVWTLTELE---KKDPATSLYEDESKRLEIQHIRSVSYICSTRRMLLIIASTCWMIIDMDDLSTVVFHKNEITTKRCVAGYLTDLDKVTIGYTDESIHVFQLP 292          

HSP 2 Score: 80.4925 bits (197), Expect = 9.033e-15
Identity = 68/301 (22.59%), Postives = 135/301 (44.85%), Query Frame = 3
Query: 3336 LDKSFLARITCDFLMSVLSKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLEDADIDDKLLSLVSHKAIEDIA-SARPLIFVMVCYREMLKWCSISLNTFHNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIY----FYIKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQISNAIFSLGGNSHQVKLINSQSIPSL 4223
            L+++ L R T   L+ +L   P         L   ++  L  GF+ WEP+L+ + V+   L  A + E      ++       AIED A ++R  + ++   R      S+S+      ++ +  +TI     +P L S               R+ ++ I  +LC+ + + I+ +L  + ++ ++      +K +  S    P++KF+ V++     +++ G   G   + +L+  K  S  +H   I    FS+DG+ +A+Y A +  +  +Q S +   +G    Q+KL  SQ  P++
Sbjct: 1004 LNRADLTRATAVSLLELLVAAPSNLIPVHSPLRRAAIDLLGRGFVHWEPHLEISKVVLGLLDLASNNEKPGTQRRITG-APLNAIEDAARTSRQALSLIALARPPALITSLSMEVA-RYNAAAQHQTIQHTVVSPLLKS---------------RSEVLRIIEELCEKRYNDIIAMLLPVGDILVHCLDITILKHKSMSEVFPPIVKFNMVAYCSTSKRVAFGGKNGTCVVHELRATKTHSLPSHNGPIAAVAFSEDGKYLATYGAEDGKINFFQTSQSFLGMG--QAQLKLTKSQPAPTV 1285          
BLAST of WD repeat-containing protein 7 vs. Ensembl Fly
Match: Rbcn-3B (gene:FBgn0023510 transcript:FBtr0070316)

HSP 1 Score: 158.303 bits (399), Expect = 1.926e-38
Identity = 151/669 (22.57%), Postives = 294/669 (43.95%), Query Frame = 3
Query:  126 IFSFALWLNEAPLHNISSLIYLSKNNF-VVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEFISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQK-SIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVF----YTETCDILS-YQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCDNIPNLLVEFPQPENT-------------ASFRHKIEIQNQEDVIIIWK----GFSNGNIYKWEFTKQSKLITQNRFCLDDSWEKITKAPTSLTKSIQGI-DTAGSVTSLLFIHDLSLIVLGMENGWIIV----KNICDTLTSAFTENDST-SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
            +    LW   AP H ISS ++LS + F +V+GC +G I +W       +++P   L+GH + +   V A      NF   VS S +GE+  W+  +G+ +E +   Q++ Q + S+ +AN++   + C    +EI V++  SL  I  L     P+W S+I   +    KDDV+LA + +G + +W +   +          I  ++  +I   N   ++    +    L++ +  ++++    +T  C +++  ++ ++G     G FI+ D +++ T  GKG+LY+LP    P++  F  +S  +  + P L        +              A  +H +   + E  I +W        N +I + +      L       L ++W  +   P  +   +  I ++   +TS +++   S +V+G E+G I++    + +   L     +N S   ++ IL GHRG V CLL PS                  +  +  + +H+L SGG+D+ + +WD+    ++  F  H+  +T L                          +   E  S  I + I          +A +  ++++S+ ++K +   S H  PV ++ W     +L++   + +V+VW + +G +DR   G  A+ ++  C
Sbjct:    7 VVPVVLWGPTAPTHCISS-VFLSDDQFTLVTGCYDGQICLWQVEPTTLKMSPRCLLVGHSAPVLCLVRASLLPENNF--LVSSSENGEMCTWDLTDGKCMEAVKLPQVHTQ-IQSYHTANSEDVRLFCIGYYAEIMVMDPFSLEVIYVLSSKVKPDWISAIHVLRPMRRKDDVVLAITTTGTVKVWTLTGNE----NKHAEPIYENESKEIRCLNAITMNCCAQNQRTVLLVCTKYWQIYDAGDFTVLCSVIAPARERWQG-----GDFITSDRVMLWTDEGKGYLYKLPANCIPDNKEFHSKS--VVRDAPYLYYVLQHAGDKVLSCPPAMKLLQGAGGQHNLLRGDSEGYISVWNVPEVPLDNISILQAKQMPPRPLKPHVCTSLVEAWSIMDPPPVGILDQLSRITESPVKLTSSIYLPQQSRLVIGREDGSIVIVPATQTVMMQLLVGIKQNFSDWPSHQILYGHRGRVNCLLCPS------------------MIHSRYEKSHLL-SGGIDFAVCLWDLYSGSLLHRFCVHAGEITQL--------------------------LVPPESCSPRILKCI--------CSVASDHSVTLVSLQERKCVTLASRHLFPVVTIKWRPLDDFLIVGCSDGSVYVWQMETGHLDRVLHGMLAEEVLSAC 607          

HSP 2 Score: 87.4261 bits (215), Expect = 9.088e-17
Identity = 73/307 (23.78%), Postives = 133/307 (43.32%), Query Frame = 3
Query: 3351 LARITCDFLMSVLSKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLEDADIDDKLLSLV--------SHKAIEDIASARPLIFVMVCYREMLKWCSISLNTFHNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIYFY----IKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQISNAIFSLG-GNSHQVKLINSQSIPSLEQM 4232
            LAR+T   L  +L   P         L   ++  L  GF VWEPYLD + V+   L  + + +     +  L L         +  A+  IA+ARP  F+    RE+ ++ ++  N          +++I+    TP   S++   K            ++     L      +I  +L E++++ ++      +K+   +     + KF+ +S      +++VG+  GNL +++L+  K     AH   I    FS DG+ + SYS +EN +  WQ S  +F LG   +   K  ++  IP + ++
Sbjct: 1213 LARLTSMALAHLLYAPPSPKLPQYTPLRRAAIDLLGRGFTVWEPYLDVSKVLLGLLEISCEGKAVPNLNYKLPLTPQADACRTARHALRLIATARPAAFITTMAREVARYNTMQQN----------AQSIN----TPLTQSVLHKAKGE----------ILQCVEMLIDKMQSEIAGLLVEVMDIALHCVDGNELKNRGLAELCPAICKFNQISHCAQTRRIAVGANSGNLAIYELRQNKCQMIPAHTHPITSLAFSPDGKYLVSYSCAENRLSFWQTSTGMFGLGQSQTRCTKGYSTAPIPDVSRL 1495          
BLAST of WD repeat-containing protein 7 vs. Ensembl Fly
Match: Rbcn-3B (gene:FBgn0023510 transcript:FBtr0344155)

HSP 1 Score: 158.303 bits (399), Expect = 1.926e-38
Identity = 151/669 (22.57%), Postives = 294/669 (43.95%), Query Frame = 3
Query:  126 IFSFALWLNEAPLHNISSLIYLSKNNF-VVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEFISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQK-SIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVF----YTETCDILS-YQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCDNIPNLLVEFPQPENT-------------ASFRHKIEIQNQEDVIIIWK----GFSNGNIYKWEFTKQSKLITQNRFCLDDSWEKITKAPTSLTKSIQGI-DTAGSVTSLLFIHDLSLIVLGMENGWIIV----KNICDTLTSAFTENDST-SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
            +    LW   AP H ISS ++LS + F +V+GC +G I +W       +++P   L+GH + +   V A      NF   VS S +GE+  W+  +G+ +E +   Q++ Q + S+ +AN++   + C    +EI V++  SL  I  L     P+W S+I   +    KDDV+LA + +G + +W +   +          I  ++  +I   N   ++    +    L++ +  ++++    +T  C +++  ++ ++G     G FI+ D +++ T  GKG+LY+LP    P++  F  +S  +  + P L        +              A  +H +   + E  I +W        N +I + +      L       L ++W  +   P  +   +  I ++   +TS +++   S +V+G E+G I++    + +   L     +N S   ++ IL GHRG V CLL PS                  +  +  + +H+L SGG+D+ + +WD+    ++  F  H+  +T L                          +   E  S  I + I          +A +  ++++S+ ++K +   S H  PV ++ W     +L++   + +V+VW + +G +DR   G  A+ ++  C
Sbjct:    7 VVPVVLWGPTAPTHCISS-VFLSDDQFTLVTGCYDGQICLWQVEPTTLKMSPRCLLVGHSAPVLCLVRASLLPENNF--LVSSSENGEMCTWDLTDGKCMEAVKLPQVHTQ-IQSYHTANSEDVRLFCIGYYAEIMVMDPFSLEVIYVLSSKVKPDWISAIHVLRPMRRKDDVVLAITTTGTVKVWTLTGNE----NKHAEPIYENESKEIRCLNAITMNCCAQNQRTVLLVCTKYWQIYDAGDFTVLCSVIAPARERWQG-----GDFITSDRVMLWTDEGKGYLYKLPANCIPDNKEFHSKS--VVRDAPYLYYVLQHAGDKVLSCPPAMKLLQGAGGQHNLLRGDSEGYISVWNVPEVPLDNISILQAKQMPPRPLKPHVCTSLVEAWSIMDPPPVGILDQLSRITESPVKLTSSIYLPQQSRLVIGREDGSIVIVPATQTVMMQLLVGIKQNFSDWPSHQILYGHRGRVNCLLCPS------------------MIHSRYEKSHLL-SGGIDFAVCLWDLYSGSLLHRFCVHAGEITQL--------------------------LVPPESCSPRILKCI--------CSVASDHSVTLVSLQERKCVTLASRHLFPVVTIKWRPLDDFLIVGCSDGSVYVWQMETGHLDRVLHGMLAEEVLSAC 607          

HSP 2 Score: 87.4261 bits (215), Expect = 9.088e-17
Identity = 73/307 (23.78%), Postives = 133/307 (43.32%), Query Frame = 3
Query: 3351 LARITCDFLMSVLSKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLEDADIDDKLLSLV--------SHKAIEDIASARPLIFVMVCYREMLKWCSISLNTFHNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIYFY----IKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQISNAIFSLG-GNSHQVKLINSQSIPSLEQM 4232
            LAR+T   L  +L   P         L   ++  L  GF VWEPYLD + V+   L  + + +     +  L L         +  A+  IA+ARP  F+    RE+ ++ ++  N          +++I+    TP   S++   K            ++     L      +I  +L E++++ ++      +K+   +     + KF+ +S      +++VG+  GNL +++L+  K     AH   I    FS DG+ + SYS +EN +  WQ S  +F LG   +   K  ++  IP + ++
Sbjct: 1213 LARLTSMALAHLLYAPPSPKLPQYTPLRRAAIDLLGRGFTVWEPYLDVSKVLLGLLEISCEGKAVPNLNYKLPLTPQADACRTARHALRLIATARPAAFITTMAREVARYNTMQQN----------AQSIN----TPLTQSVLHKAKGE----------ILQCVEMLIDKMQSEIAGLLVEVMDIALHCVDGNELKNRGLAELCPAICKFNQISHCAQTRRIAVGANSGNLAIYELRQNKCQMIPAHTHPITSLAFSPDGKYLVSYSCAENRLSFWQTSTGMFGLGQSQTRCTKGYSTAPIPDVSRL 1495          
BLAST of WD repeat-containing protein 7 vs. Ensembl Zebrafish
Match: CABZ01045062.1 (WD repeat domain 7 [Source:NCBI gene;Acc:572502])

HSP 1 Score: 172.555 bits (436), Expect = 7.375e-43
Identity = 152/651 (23.35%), Postives = 281/651 (43.16%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQK-SIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCD-NIPNLLVEFPQ---------PENTASFRHKIEIQNQEDVIIIWKGFSNGNIYKWEFTKQSKLITQ-----NRFCLDDSWEKITKAPTSLTKSIQGIDTAGS---VTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDST-----SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSG 1988
            GNS +    LW   AP H ISSL+ +     +++G  +G I IW       ++ P   L GH + ++   L+ +S  +  +Y VS S  GE+ LW+  +GR IEF  ++ +   IQ+ + F     ++  +LC     EI V+++ SL  + +LV   SP+W SS++  +    ++D ++A SV+G++ +W +   DV    ++  V + ++   I       IS   ++    L++ S  ++VF      +L          +  G FI+ D +I+ T  G  ++Y+LP    P S  FR       + +IP L+              P  T  F  + E  ++    ++ +G S G +  W     S  I Q         L ++++K+  AP  +   +  +  A     VT+ ++I     +V G E+G II+     T      + +         +  L+GHR  VTCLL+P         ++   + +S V            SGGVD+++ +WD+   +M  +F  H   +T L                          +   E  S  ++  +          +A +  + ++S+ ++K ++  S H  P++ + W     YL++   + +V+VW + +G
Sbjct:    3 GNSLVLPIVLWSRNAPTHCISSLLVMEDLATIITGSHDGQICIWDMTPE-LEINPRALLFGHTASVT--CLSKASAGSEKQYLVSASESGEMCLWDVNDGRCIEFTKLACAHTGIQF-YQFTIGTQREGRLLCHGHYPEILVMDATSLEVLYSLVSKISPDWISSMSIIRSHRTQEDTVVAVSVTGILKVWIIT-ADVSRMQDLDPVFE-EESKPIYCQGCQSISFCTFTQLSLLVVCSKYWRVFDAGDFSLLCSVSSENNQSWAGGEFIAADKVIIWTEDGCSYIYKLPASCLPASEHFRSNVGKKSEGSIPPLVYSIADQADKQLLICPPVTRFFFGRREPFHK----LLMQGDSAGRLTVWSIPDASPPIQQLTSVSVSISLQEAFDKLLPAPAGIIDQLSVLPGASEPIKVTASVYIPSQGRLVCGREDGSIILVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRHKVTCLLYPHQ-------VSPRYDQRSLV------------SGGVDFSVIIWDIFTGEMKHIFCVHGGEITQL--------------------------IVPPENCSTRVQHCV--------CSVASDHSVGLLSLRERKCIMLASRHLFPIQVIKWRPCDDYLVVGCSDGSVYVWQMDTG 590          
BLAST of WD repeat-containing protein 7 vs. Ensembl Zebrafish
Match: CABZ01045062.1 (WD repeat domain 7 [Source:NCBI gene;Acc:572502])

HSP 1 Score: 170.629 bits (431), Expect = 2.217e-42
Identity = 151/650 (23.23%), Postives = 279/650 (42.92%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQK-SIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCD-NIPNLLVEFPQ---------PENTASFRHKIEIQNQEDVIIIWKGFSNGNIYKWEFTKQSKLITQ-------NRFCLDDSWEKITKAPTSLTKSIQGIDTAGS---VTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDST-----SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDL 1979
            GNS +    LW   AP H ISSL+ +     +++G  +G I IW       ++ P   L GH + ++   L+ +S  +  +Y VS S  GE+ LW+  +GR IEF  ++ +   IQ+ + F     ++  +LC     EI V+++ SL  + +LV   SP+W SS++  +    ++D ++A SV+G++ +W +   DV    ++  V + ++   I       IS   ++    L++ S  ++VF      +L          +  G FI+ D +I+ T  G  ++Y+LP    P S  FR       + +IP L+              P  T  F  + E  ++    ++ +G S G +  W     S  I Q           L ++++K+  AP  +   +  +  A     VT+ ++I     +V G E+G II+     T      + +         +  L+GHR  VTCLL+P         ++   + +S V            SGGVD+++ +WD+   +M  +F  H   +T L                          +   E  S  ++  +          +A +  + ++S+ ++K ++  S H  P++ + W     YL++   + +V+VW +
Sbjct:    3 GNSLVLPIVLWSRNAPTHCISSLLVMEDLATIITGSHDGQICIWDMTPE-LEINPRALLFGHTASVT--CLSKASAGSEKQYLVSASESGEMCLWDVNDGRCIEFTKLACAHTGIQF-YQFTIGTQREGRLLCHGHYPEILVMDATSLEVLYSLVSKISPDWISSMSIIRSHRTQEDTVVAVSVTGILKVWIIT-ADVSRMQDLDPVFE-EESKPIYCQGCQSISFCTFTQLSLLVVCSKYWRVFDAGDFSLLCSVSSENNQSWAGGEFIAADKVIIWTEDGCSYIYKLPASCLPASEHFRSNVGKKSEGSIPPLVYSIADQADKQLLICPPVTRFFFGRREPFHK----LLMQGDSAGRLTVWSIPDASPPIQQLTSLQVSVSISLQEAFDKLLPAPAGIIDQLSVLPGASEPIKVTASVYIPSQGRLVCGREDGSIILVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRHKVTCLLYPHQ-------VSPRYDQRSLV------------SGGVDFSVIIWDIFTGEMKHIFCVHGGEITQL--------------------------IVPPENCSTRVQHCV--------CSVASDHSVGLLSLRERKCIMLASRHLFPIQVIKWRPCDDYLVVGCSDGSVYVWQM 589          
BLAST of WD repeat-containing protein 7 vs. Ensembl Zebrafish
Match: CABZ01045062.1 (WD repeat domain 7 [Source:NCBI gene;Acc:572502])

HSP 1 Score: 160.999 bits (406), Expect = 5.171e-41
Identity = 135/538 (25.09%), Postives = 240/538 (44.61%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQK-SIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCD-NIPNLLVEFPQ---------PENTASFRHKIEIQNQEDVIIIWKGFSNGNIYKWEFTKQSKLITQNRFCLDDSWEKITKAPTSLTKSIQGIDTAGS---VTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDST-----SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTL 1664
            GNS +    LW   AP H ISSL+ +     +++G  +G I IW       ++ P   L GH + ++   L+ +S  +  +Y VS S  GE+ LW+  +GR IEF  ++ +   IQ+ + F     ++  +LC     EI V+++ SL  + +LV   SP+W SS++  +    ++D ++A SV+G++ +W +   DV    ++  V + ++   I       IS   ++    L++ S  ++VF      +L          +  G FI+ D +I+ T  G  ++Y+LP    P S  FR       + +IP L+              P  T  F  + E  ++    ++ +G S G +  W       L       L ++++K+  AP  +   +  +  A     VT+ ++I     +V G E+G II+     T      + +         +  L+GHR  VTCLL+P         ++   + +S V            SGGVD+++ +WD+   +M  +F  H   +T L
Sbjct:    3 GNSLVLPIVLWSRNAPTHCISSLLVMEDLATIITGSHDGQICIWDMTPE-LEINPRALLFGHTASVT--CLSKASAGSEKQYLVSASESGEMCLWDVNDGRCIEFTKLACAHTGIQF-YQFTIGTQREGRLLCHGHYPEILVMDATSLEVLYSLVSKISPDWISSMSIIRSHRTQEDTVVAVSVTGILKVWIIT-ADVSRMQDLDPVFE-EESKPIYCQGCQSISFCTFTQLSLLVVCSKYWRVFDAGDFSLLCSVSSENNQSWAGGEFIAADKVIIWTEDGCSYIYKLPASCLPASEHFRSNVGKKSEGSIPPLVYSIADQADKQLLICPPVTRFFFGRREPFHK----LLMQGDSAGRLTVWILFNTEYLQVSVSISLQEAFDKLLPAPAGIIDQLSVLPGASEPIKVTASVYIPSQGRLVCGREDGSIILVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRHKVTCLLYPHQ-------VSPRYDQRSLV------------SGGVDFSVIIWDIFTGEMKHIFCVHGGEITQL 511          
BLAST of WD repeat-containing protein 7 vs. Ensembl Zebrafish
Match: CABZ01045062.1 (WD repeat domain 7 [Source:NCBI gene;Acc:572502])

HSP 1 Score: 158.688 bits (400), Expect = 1.064e-38
Identity = 135/538 (25.09%), Postives = 240/538 (44.61%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQK-SIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCD-NIPNLLVEFPQ---------PENTASFRHKIEIQNQEDVIIIWKGFSNGNIYKWEFTKQSKLITQNRFCLDDSWEKITKAPTSLTKSIQGIDTAGS---VTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDST-----SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTL 1664
            GNS +    LW   AP H ISSL+ +     +++G  +G I IW       ++ P   L GH + ++   L+ +S  +  +Y VS S  GE+ LW+  +GR IEF  ++ +   IQ+ + F     ++  +LC     EI V+++ SL  + +LV   SP+W SS++  +    ++D ++A SV+G++ +W +   DV    ++  V + ++   I       IS   ++    L++ S  ++VF      +L          +  G FI+ D +I+ T  G  ++Y+LP    P S  FR       + +IP L+              P  T  F  + E  ++    ++ +G S G +  W       L       L ++++K+  AP  +   +  +  A     VT+ ++I     +V G E+G II+     T      + +         +  L+GHR  VTCLL+P         ++   + +S V            SGGVD+++ +WD+   +M  +F  H   +T L
Sbjct:    3 GNSLVLPIVLWSRNAPTHCISSLLVMEDLATIITGSHDGQICIWDMTPE-LEINPRALLFGHTASVT--CLSKASAGSEKQYLVSASESGEMCLWDVNDGRCIEFTKLACAHTGIQF-YQFTIGTQREGRLLCHGHYPEILVMDATSLEVLYSLVSKISPDWISSMSIIRSHRTQEDTVVAVSVTGILKVWIIT-ADVSRMQDLDPVFE-EESKPIYCQGCQSISFCTFTQLSLLVVCSKYWRVFDAGDFSLLCSVSSENNQSWAGGEFIAADKVIIWTEDGCSYIYKLPASCLPASEHFRSNVGKKSEGSIPPLVYSIADQADKQLLICPPVTRFFFGRREPFHK----LLMQGDSAGRLTVWSI---PDLQVSVSISLQEAFDKLLPAPAGIIDQLSVLPGASEPIKVTASVYIPSQGRLVCGREDGSIILVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRHKVTCLLYPHQ-------VSPRYDQRSLV------------SGGVDFSVIIWDIFTGEMKHIFCVHGGEITQL 508          
BLAST of WD repeat-containing protein 7 vs. Ensembl Zebrafish
Match: CABZ01073424.1 (pep chromosome:GRCz11:21:2721752:2738317:1 gene:ENSDARG00000107858.2 transcript:ENSDART00000174953.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01073424.1)

HSP 1 Score: 58.151 bits (139), Expect = 1.635e-8
Identity = 27/103 (26.21%), Postives = 58/103 (56.31%), Query Frame = 3
Query: 3840 SDKILDVLPELVELYIYFYIKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQI 4148
            S +++D++   +E  +   +K +  S     + +F  V++ E   +++VG+ +G++ L+D++ GK      HK  I    F+ DGR +A+YS +++ +  WQ+
Sbjct:  131 SPQVMDIIMYCIEGSL---VKKKGLSECFPAICRFYMVAYCERSYRIAVGARQGSVALYDVRTGKCQHIHGHKGPITAVSFAPDGRYLATYSNADSHISFWQV 230          
BLAST of WD repeat-containing protein 7 vs. Ensembl Xenopus
Match: wdr7 (WD repeat domain 7 [Source:NCBI gene;Acc:100036723])

HSP 1 Score: 185.652 bits (470), Expect = 1.386e-46
Identity = 163/672 (24.26%), Postives = 295/672 (43.90%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQK-SIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCDN-IPNLLVEFPQPENT----------------ASFRHKIEIQ-NQEDVIIIWKGFSNGNIYKWEFTKQSKLITQNRFCLDDSWEKITKAPTSLTKSIQGIDTAGS---VTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDST-----SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
            GNS +    LW  +AP H IS+++ +     +V+GC +G I +W  +    ++ P   L GH + I+   L+ +S +++ +Y VS S  GE+ LW+  +GR +EF  ++ +   IQ+ + F     ++  +LC     E+ V+++ SL  + +LV   SP+W SS++  +    ++D ++A SV+G++ +W +   +V    +   V + ++   I   N   IS   ++    L++ S  ++VF      +L       G  +  G FIS D +I+ T  G+ F+Y+LP    P S  FR       +N IP LL      E+T                 SF HK+ IQ +    + IW   S   + +    KQ   +T     L ++++K+   P  +   +  +  +     VT+ ++I     +V G E+G I++     T      + +         +  L+GHR  VTCLL+P               V S+           L SGGVD+++ VWD+   +M  +F  H   +T L                          V  D     +    +  C    +  +  +  + I+S+ ++K ++  S H  P++ + W     YL++   + +V+VW + +G +DR   G  A  ++  C
Sbjct:    3 GNSLVLPIVLWGRKAPTHCISTVLVMDDLETIVTGCHDGQICLWDLSPE-LEINPRALLFGHTASIT--CLSKASASSDRQYIVSASESGEMCLWDVNDGRCVEFTKLACTHTGIQF-YQFSIGTPREGRLLCHGHYPEVLVMDASSLDVLYSLVSKISPDWISSMSIIRSHRTQEDTVVAVSVTGILKVWIIT-AEVHRMQDTEPVFE-EESKPIYCQNCQSISFCAFTQRSLLVVCSKYWRVFDAGDYSLLCSVPSEEGQTWTGGDFISADKVIVWTEDGQSFIYKLPASCIPASDTFRIDVGKAIENSIPPLLYSVMPKEDTQLLICPPVTRFFYGRRKSF-HKLLIQGDSSGRLCIW---SVPEVLEQPENKQGLGVTTTT-SLQEAFDKLQPLPAGIIDQLSIMPNSKEPLKVTASVYIPSHGRLVCGREDGSIVIVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLYPH-------------QVSSRY------DQRYLISGGVDFSVIVWDIFSGEMKHIFCVHGGEITQL-------------------------LVPPD-----NCSTRVQHC----ICSVGSDHSVGILSLRERKCIMLASRHLFPIQVIKWRPSDDYLVVGCSDGSVYVWQMDTGALDRCVMGITAVEILNAC 610          

HSP 2 Score: 90.8929 bits (224), Expect = 1.280e-17
Identity = 81/366 (22.13%), Postives = 160/366 (43.72%), Query Frame = 3
Query: 3201 DHERRNLSKIQIKALLNIALVGSHLKPDENNDINSDSKLFSKLFTLDKSF----LARITCDFLMSVL--SKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLED--ADIDDKLL-------SLVSHKAIEDIASARPLIFVMVCYREMLKWCSISLNTF--HNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIYFY----IKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQISNAIFSLGG---NSHQVKLINSQSIPSLE 4226
            +  R+  + I + A++  A  G+ ++P +       S    + F L        LAR TC  L  +L     PK+   +  R   + +I    GF VWEPY+D + V+   L    D E   A+I   L        +  +  A+  IA+ARP  F+    +E+ +  +++ NT    N+ + + +R                            +  ++ +   L +     ++D+L E++++ +Y      +K +        + KF  VS+ E   +++VG+  G + L+D++ GK  +   HK  I    F+ DGR +A+YS  ++ +  WQ++ ++    G   ++ Q++ I +  +P ++
Sbjct: 1101 EERRKQATAIVLLAVIG-AEFGAEIEPPKLLTRPRSSSQIPEGFGLTSGGSNYSLARHTCKALTFLLLQPPSPKLPPHSTIRRTAIDLI--GRGFTVWEPYMDVSAVLMGLLELCADAEKQLANITIGLPLSPAADSARSARHALSLIATARPPAFITTIAKEVHRHTALAANTQSQQNIHTTALARA---------------------------KGEILRVVEILIEKMPSDVVDLLVEVMDIIMYCLEGSLLKKKGLQECFPSICKFYMVSYCERSHRIAVGARIGTVALYDIRTGKCQNIHGHKGPITSVSFAPDGRYLATYSNKDSHISFWQMNTSLLGSIGMLNSAPQLRCIKTYQVPPVQ 1436          
BLAST of WD repeat-containing protein 7 vs. Ensembl Xenopus
Match: wdr7 (WD repeat domain 7 [Source:NCBI gene;Acc:100036723])

HSP 1 Score: 185.652 bits (470), Expect = 1.391e-46
Identity = 163/672 (24.26%), Postives = 295/672 (43.90%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQK-SIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCDN-IPNLLVEFPQPENT----------------ASFRHKIEIQ-NQEDVIIIWKGFSNGNIYKWEFTKQSKLITQNRFCLDDSWEKITKAPTSLTKSIQGIDTAGS---VTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDST-----SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
            GNS +    LW  +AP H IS+++ +     +V+GC +G I +W  +    ++ P   L GH + I+   L+ +S +++ +Y VS S  GE+ LW+  +GR +EF  ++ +   IQ+ + F     ++  +LC     E+ V+++ SL  + +LV   SP+W SS++  +    ++D ++A SV+G++ +W +   +V    +   V + ++   I   N   IS   ++    L++ S  ++VF      +L       G  +  G FIS D +I+ T  G+ F+Y+LP    P S  FR       +N IP LL      E+T                 SF HK+ IQ +    + IW   S   + +    KQ   +T     L ++++K+   P  +   +  +  +     VT+ ++I     +V G E+G I++     T      + +         +  L+GHR  VTCLL+P               V S+           L SGGVD+++ VWD+   +M  +F  H   +T L                          V  D     +    +  C    +  +  +  + I+S+ ++K ++  S H  P++ + W     YL++   + +V+VW + +G +DR   G  A  ++  C
Sbjct:    3 GNSLVLPIVLWGRKAPTHCISTVLVMDDLETIVTGCHDGQICLWDLSPE-LEINPRALLFGHTASIT--CLSKASASSDRQYIVSASESGEMCLWDVNDGRCVEFTKLACTHTGIQF-YQFSIGTPREGRLLCHGHYPEVLVMDASSLDVLYSLVSKISPDWISSMSIIRSHRTQEDTVVAVSVTGILKVWIIT-AEVHRMQDTEPVFE-EESKPIYCQNCQSISFCAFTQRSLLVVCSKYWRVFDAGDYSLLCSVPSEEGQTWTGGDFISADKVIVWTEDGQSFIYKLPASCIPASDTFRIDVGKAIENSIPPLLYSVMPKEDTQLLICPPVTRFFYGRRKSF-HKLLIQGDSSGRLCIW---SVPEVLEQPENKQGLGVTTT-TSLQEAFDKLQPLPAGIIDQLSIMPNSKEPLKVTASVYIPSHGRLVCGREDGSIVIVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLYPH-------------QVSSRY------DQRYLISGGVDFSVIVWDIFSGEMKHIFCVHGGEITQL-------------------------LVPPD-----NCSTRVQHC----ICSVGSDHSVGILSLRERKCIMLASRHLFPIQVIKWRPSDDYLVVGCSDGSVYVWQMDTGALDRCVMGITAVEILNAC 610          

HSP 2 Score: 61.6178 bits (148), Expect = 1.235e-8
Identity = 65/299 (21.74%), Postives = 125/299 (41.81%), Query Frame = 3
Query: 3201 DHERRNLSKIQIKALLNIALVGSHLKPDENNDINSDSKLFSKLFTLDKSF----LARITCDFLMSVL--SKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLED--ADIDDKLL-------SLVSHKAIEDIASARPLIFVMVCYREMLKWCSISLNT--FHNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIYF----YIKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGK 4034
            +  R+  + I + A++  A  G+ ++P +       S    + F L        LAR TC  L  +L     PK+   +  R   + +I    GF VWEPY+D + V+   L    D E   A+I   L        +  +  A+  IA+ARP  F+    +E+ +  +++ NT    N+ + + +R                            +  ++ +   L +     ++D+L E++++ +Y      +K +        + KF  VS+ E   +++VG+  G + L+D++ GK
Sbjct: 1085 EERRKQATAIVLLAVIG-AEFGAEIEPPKLLTRPRSSSQIPEGFGLTSGGSNYSLARHTCKALTFLLLQPPSPKLPPHSTIRRTAIDLI--GRGFTVWEPYMDVSAVLMGLLELCADAEKQLANITIGLPLSPAADSARSARHALSLIATARPPAFITTIAKEVHRHTALAANTQSQQNIHTTALARA---------------------------KGEILRVVEILIEKMPSDVVDLLVEVMDIIMYCLEGSLLKKKGLQECFPSICKFYMVSYCERSHRIAVGARIGTVALYDIRTGK 1353          
BLAST of WD repeat-containing protein 7 vs. Ensembl Xenopus
Match: wdr7 (WD repeat domain 7 [Source:NCBI gene;Acc:100036723])

HSP 1 Score: 185.652 bits (470), Expect = 1.593e-46
Identity = 163/672 (24.26%), Postives = 295/672 (43.90%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQK-SIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCDN-IPNLLVEFPQPENT----------------ASFRHKIEIQ-NQEDVIIIWKGFSNGNIYKWEFTKQSKLITQNRFCLDDSWEKITKAPTSLTKSIQGIDTAGS---VTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDST-----SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
            GNS +    LW  +AP H IS+++ +     +V+GC +G I +W  +    ++ P   L GH + I+   L+ +S +++ +Y VS S  GE+ LW+  +GR +EF  ++ +   IQ+ + F     ++  +LC     E+ V+++ SL  + +LV   SP+W SS++  +    ++D ++A SV+G++ +W +   +V    +   V + ++   I   N   IS   ++    L++ S  ++VF      +L       G  +  G FIS D +I+ T  G+ F+Y+LP    P S  FR       +N IP LL      E+T                 SF HK+ IQ +    + IW   S   + +    KQ   +T     L ++++K+   P  +   +  +  +     VT+ ++I     +V G E+G I++     T      + +         +  L+GHR  VTCLL+P               V S+           L SGGVD+++ VWD+   +M  +F  H   +T L                          V  D     +    +  C    +  +  +  + I+S+ ++K ++  S H  P++ + W     YL++   + +V+VW + +G +DR   G  A  ++  C
Sbjct:    3 GNSLVLPIVLWGRKAPTHCISTVLVMDDLETIVTGCHDGQICLWDLSPE-LEINPRALLFGHTASIT--CLSKASASSDRQYIVSASESGEMCLWDVNDGRCVEFTKLACTHTGIQF-YQFSIGTPREGRLLCHGHYPEVLVMDASSLDVLYSLVSKISPDWISSMSIIRSHRTQEDTVVAVSVTGILKVWIIT-AEVHRMQDTEPVFE-EESKPIYCQNCQSISFCAFTQRSLLVVCSKYWRVFDAGDYSLLCSVPSEEGQTWTGGDFISADKVIVWTEDGQSFIYKLPASCIPASDTFRIDVGKAIENSIPPLLYSVMPKEDTQLLICPPVTRFFYGRRKSF-HKLLIQGDSSGRLCIW---SVPEVLEQPENKQGLGVTTT-TSLQEAFDKLQPLPAGIIDQLSIMPNSKEPLKVTASVYIPSHGRLVCGREDGSIVIVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLYPH-------------QVSSRYD------QRYLISGGVDFSVIVWDIFSGEMKHIFCVHGGEITQL-------------------------LVPPD-----NCSTRVQHC----ICSVGSDHSVGILSLRERKCIMLASRHLFPIQVIKWRPSDDYLVVGCSDGSVYVWQMDTGALDRCVMGITAVEILNAC 610          

HSP 2 Score: 90.8929 bits (224), Expect = 1.264e-17
Identity = 81/366 (22.13%), Postives = 160/366 (43.72%), Query Frame = 3
Query: 3201 DHERRNLSKIQIKALLNIALVGSHLKPDENNDINSDSKLFSKLFTLDKSF----LARITCDFLMSVL--SKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLED--ADIDDKLL-------SLVSHKAIEDIASARPLIFVMVCYREMLKWCSISLNTF--HNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIYFY----IKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQISNAIFSLGG---NSHQVKLINSQSIPSLE 4226
            +  R+  + I + A++  A  G+ ++P +       S    + F L        LAR TC  L  +L     PK+   +  R   + +I    GF VWEPY+D + V+   L    D E   A+I   L        +  +  A+  IA+ARP  F+    +E+ +  +++ NT    N+ + + +R                            +  ++ +   L +     ++D+L E++++ +Y      +K +        + KF  VS+ E   +++VG+  G + L+D++ GK  +   HK  I    F+ DGR +A+YS  ++ +  WQ++ ++    G   ++ Q++ I +  +P ++
Sbjct: 1085 EERRKQATAIVLLAVIG-AEFGAEIEPPKLLTRPRSSSQIPEGFGLTSGGSNYSLARHTCKALTFLLLQPPSPKLPPHSTIRRTAIDLI--GRGFTVWEPYMDVSAVLMGLLELCADAEKQLANITIGLPLSPAADSARSARHALSLIATARPPAFITTIAKEVHRHTALAANTQSQQNIHTTALARA---------------------------KGEILRVVEILIEKMPSDVVDLLVEVMDIIMYCLEGSLLKKKGLQECFPSICKFYMVSYCERSHRIAVGARIGTVALYDIRTGKCQNIHGHKGPITSVSFAPDGRYLATYSNKDSHISFWQMNTSLLGSIGMLNSAPQLRCIKTYQVPPVQ 1420          
BLAST of WD repeat-containing protein 7 vs. Ensembl Xenopus
Match: wdr7 (WD repeat domain 7 [Source:NCBI gene;Acc:100036723])

HSP 1 Score: 185.267 bits (469), Expect = 1.826e-46
Identity = 163/672 (24.26%), Postives = 295/672 (43.90%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQK-SIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCDN-IPNLLVEFPQPENT----------------ASFRHKIEIQ-NQEDVIIIWKGFSNGNIYKWEFTKQSKLITQNRFCLDDSWEKITKAPTSLTKSIQGIDTAGS---VTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDST-----SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
            GNS +    LW  +AP H IS+++ +     +V+GC +G I +W  +    ++ P   L GH + I+   L+ +S +++ +Y VS S  GE+ LW+  +GR +EF  ++ +   IQ+ + F     ++  +LC     E+ V+++ SL  + +LV   SP+W SS++  +    ++D ++A SV+G++ +W +   +V    +   V + ++   I   N   IS   ++    L++ S  ++VF      +L       G  +  G FIS D +I+ T  G+ F+Y+LP    P S  FR       +N IP LL      E+T                 SF HK+ IQ +    + IW   S   + +    KQ   +T     L ++++K+   P  +   +  +  +     VT+ ++I     +V G E+G I++     T      + +         +  L+GHR  VTCLL+P               V S+           L SGGVD+++ VWD+   +M  +F  H   +T L                          V  D     +    +  C    +  +  +  + I+S+ ++K ++  S H  P++ + W     YL++   + +V+VW + +G +DR   G  A  ++  C
Sbjct:    3 GNSLVLPIVLWGRKAPTHCISTVLVMDDLETIVTGCHDGQICLWDLSPE-LEINPRALLFGHTASIT--CLSKASASSDRQYIVSASESGEMCLWDVNDGRCVEFTKLACTHTGIQF-YQFSIGTPREGRLLCHGHYPEVLVMDASSLDVLYSLVSKISPDWISSMSIIRSHRTQEDTVVAVSVTGILKVWIIT-AEVHRMQDTEPVFE-EESKPIYCQNCQSISFCAFTQRSLLVVCSKYWRVFDAGDYSLLCSVPSEEGQTWTGGDFISADKVIVWTEDGQSFIYKLPASCIPASDTFRIDVGKAIENSIPPLLYSVMPKEDTQLLICPPVTRFFYGRRKSF-HKLLIQGDSSGRLCIW---SVPEVLEQPENKQGLGVTTT-TSLQEAFDKLQPLPAGIIDQLSIMPNSKEPLKVTASVYIPSHGRLVCGREDGSIVIVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLYPH-------------QVSSRY------DQRYLISGGVDFSVIVWDIFSGEMKHIFCVHGGEITQL-------------------------LVPPD-----NCSTRVQHC----ICSVGSDHSVGILSLRERKCIMLASRHLFPIQVIKWRPSDDYLVVGCSDGSVYVWQMDTGALDRCVMGITAVEILNAC 610          

HSP 2 Score: 91.2781 bits (225), Expect = 1.141e-17
Identity = 81/366 (22.13%), Postives = 160/366 (43.72%), Query Frame = 3
Query: 3201 DHERRNLSKIQIKALLNIALVGSHLKPDENNDINSDSKLFSKLFTLDKSF----LARITCDFLMSVL--SKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLED--ADIDDKLL-------SLVSHKAIEDIASARPLIFVMVCYREMLKWCSISLNTF--HNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIYFY----IKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQISNAIFSLGG---NSHQVKLINSQSIPSLE 4226
            +  R+  + I + A++  A  G+ ++P +       S    + F L        LAR TC  L  +L     PK+   +  R   + +I    GF VWEPY+D + V+   L    D E   A+I   L        +  +  A+  IA+ARP  F+    +E+ +  +++ NT    N+ + + +R                            +  ++ +   L +     ++D+L E++++ +Y      +K +        + KF  VS+ E   +++VG+  G + L+D++ GK  +   HK  I    F+ DGR +A+YS  ++ +  WQ++ ++    G   ++ Q++ I +  +P ++
Sbjct: 1114 EERRKQATAIVLLAVIG-AEFGAEIEPPKLLTRPRSSSQIPEGFGLTSGGSNYSLARHTCKALTFLLLQPPSPKLPPHSTIRRTAIDLI--GRGFTVWEPYMDVSAVLMGLLELCADAEKQLANITIGLPLSPAADSARSARHALSLIATARPPAFITTIAKEVHRHTALAANTQSQQNIHTTALARA---------------------------KGEILRVVEILIEKMPSDVVDLLVEVMDIIMYCLEGSLLKKKGLQECFPSICKFYMVSYCERSHRIAVGARIGTVALYDIRTGKCQNIHGHKGPITSVSFAPDGRYLATYSNKDSHISFWQMNTSLLGSIGMLNSAPQLRCIKTYQVPPVQ 1449          
BLAST of WD repeat-containing protein 7 vs. Ensembl Xenopus
Match: wdr7 (WD repeat domain 7 [Source:NCBI gene;Acc:100036723])

HSP 1 Score: 184.882 bits (468), Expect = 2.728e-46
Identity = 160/662 (24.17%), Postives = 288/662 (43.50%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQK-SIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCDN-IPNLLVEFP-QPENTASFR------HKIEIQNQEDVIIIWKGFSNGNIYKWEFTKQSKLITQNRFCLDDSWEKITKAPTSLTKSIQGIDTAGS---VTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDST-----SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
            GNS +    LW  +AP H IS+++ +     +V+GC +G I +W  +    ++ P   L GH + I+   L+ +S +++ +Y VS S  GE+ LW+  +GR +EF  ++ +   IQ+ + F     ++  +LC     E+ V+++ SL  + +LV   SP+W SS++  +    ++D ++A SV+G++ +W +   +V    +   V + ++   I   N   IS   ++    L++ S  ++VF      +L       G  +  G FIS D +I+ T  G+ F+Y+LP    P S  FR       +N IP LL      P  T  F       HK+ IQ          G S+G +  W               L ++++K+   P  +   +  +  +     VT+ ++I     +V G E+G I++     T      + +         +  L+GHR  VTCLL+P               V S+           L SGGVD+++ VWD+   +M  +F  H   +T L                          V  D     +    +  C    +  +  +  + I+S+ ++K ++  S H  P++ + W     YL++   + +V+VW + +G +DR   G  A  ++  C
Sbjct:    3 GNSLVLPIVLWGRKAPTHCISTVLVMDDLETIVTGCHDGQICLWDLSPE-LEINPRALLFGHTASIT--CLSKASASSDRQYIVSASESGEMCLWDVNDGRCVEFTKLACTHTGIQF-YQFSIGTPREGRLLCHGHYPEVLVMDASSLDVLYSLVSKISPDWISSMSIIRSHRTQEDTVVAVSVTGILKVWIIT-AEVHRMQDTEPVFE-EESKPIYCQNCQSISFCAFTQRSLLVVCSKYWRVFDAGDYSLLCSVPSEEGQTWTGGDFISADKVIVWTEDGQSFIYKLPASCIPASDTFRIDVGKAIENSIPPLLYSLLICPPVTRFFYGRRKSFHKLLIQ----------GDSSGRLCIWSTAHVQGSWLTTTTSLQEAFDKLQPLPAGIIDQLSIMPNSKEPLKVTASVYIPSHGRLVCGREDGSIVIVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLYPH-------------QVSSRY------DQRYLISGGVDFSVIVWDIFSGEMKHIFCVHGGEITQL-------------------------LVPPD-----NCSTRVQHC----ICSVGSDHSVGILSLRERKCIMLASRHLFPIQVIKWRPSDDYLVVGCSDGSVYVWQMDTGALDRCVMGITAVEILNAC 595          

HSP 2 Score: 91.2781 bits (225), Expect = 1.114e-17
Identity = 81/366 (22.13%), Postives = 160/366 (43.72%), Query Frame = 3
Query: 3201 DHERRNLSKIQIKALLNIALVGSHLKPDENNDINSDSKLFSKLFTLDKSF----LARITCDFLMSVL--SKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLED--ADIDDKLL-------SLVSHKAIEDIASARPLIFVMVCYREMLKWCSISLNTF--HNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIYFY----IKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQISNAIFSLGG---NSHQVKLINSQSIPSLE 4226
            +  R+  + I + A++  A  G+ ++P +       S    + F L        LAR TC  L  +L     PK+   +  R   + +I    GF VWEPY+D + V+   L    D E   A+I   L        +  +  A+  IA+ARP  F+    +E+ +  +++ NT    N+ + + +R                            +  ++ +   L +     ++D+L E++++ +Y      +K +        + KF  VS+ E   +++VG+  G + L+D++ GK  +   HK  I    F+ DGR +A+YS  ++ +  WQ++ ++    G   ++ Q++ I +  +P ++
Sbjct: 1086 EERRKQATAIVLLAVIG-AEFGAEIEPPKLLTRPRSSSQIPEGFGLTSGGSNYSLARHTCKALTFLLLQPPSPKLPPHSTIRRTAIDLI--GRGFTVWEPYMDVSAVLMGLLELCADAEKQLANITIGLPLSPAADSARSARHALSLIATARPPAFITTIAKEVHRHTALAANTQSQQNIHTTALARA---------------------------KGEILRVVEILIEKMPSDVVDLLVEVMDIIMYCLEGSLLKKKGLQECFPSICKFYMVSYCERSHRIAVGARIGTVALYDIRTGKCQNIHGHKGPITSVSFAPDGRYLATYSNKDSHISFWQMNTSLLGSIGMLNSAPQLRCIKTYQVPPVQ 1421          
BLAST of WD repeat-containing protein 7 vs. Ensembl Mouse
Match: Wdr7 (WD repeat domain 7 [Source:MGI Symbol;Acc:MGI:1860197])

HSP 1 Score: 185.267 bits (469), Expect = 1.431e-46
Identity = 163/677 (24.08%), Postives = 291/677 (42.98%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQ-KSIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFR----KQSLNLCDNIPNLLVEFPQPE------------NTASFRHKIEIQNQEDVIIIWKGFSNGNIYKWEFT----KQSK---LITQNRFCLDDSWEKITKAPTSLTKSIQGIDTAGS---VTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDST-----SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
            GNS +    LW  +AP H ISS++       +V+GC +G I +W  +    ++ P   L GH + I+   L+ +  + +  Y VS S +GE+ LW+  +GR IEF  ++ +   IQ+ + F   N ++  +LC     EI V+++ SL  + +LV   SP+W SS++  + +  ++D ++A SV+G++ +W V  T   +       I  ++   I   N   IS   ++    L++ S  ++VF      +L       G  +  G F+S D +I+ T +G+ ++Y+LP    P S  FR    K   NL   + + L++    E                + HK+ IQ          G S+G +  W       KQ     L       L ++++K+   P  +   +  I  +     VT+ ++I     +V G E+G II+     T      + +         +  L+GHR  VTCLL+P                  QV     +    L SGGVD+++ +WD+   +M  +F  H   +T L                          +   E  S  ++  I          +A +  + ++S+ ++K ++  S H  P++ + W     YL++   + +V+VW + +G +DR   G  A  ++  C
Sbjct:    3 GNSLVLPIVLWGRKAPTHCISSILLTDDGGTIVTGCHDGQICLWDVSVE-LEVNPRALLFGHTASIT--CLSKACASGDKRYTVSASANGEMCLWDVNDGRCIEFTKLACTHTGIQF-YQFSVGNQQEGRLLCHGHYPEILVVDATSLEVLYSLVSKISPDWISSMSIIRSQRTQEDTVVALSVTGILKVWIV--TSEMSGMQDTEPIFEEESKPIYCQNCQSISFCAFTQRSLLVVCSKYWRVFDAGDYSLLCSGPSENGQTWTGGDFVSADKVIIWTENGQSYIYKLPASCLPASDSFRSDVGKAVENLIPPVQHSLLDQKDKELVICPPVTRFFYGCKEYLHKLLIQ----------GDSSGRLNIWNIADIAEKQEADEGLKMTTCISLQEAFDKLKPCPAGIIDQLSVIPNSNEPLKVTASVYIPAHGRLVCGREDGSIIIVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLYP-----------------HQVSARYDQ--RYLISGGVDFSVIIWDIFSGEMKHIFCVHGGEITQL--------------------------LVPPENCSARVQHCI--------CSVASDHSVGLLSLREKKCIMLASRHLFPIQVIKWRPSDDYLVVGCTDGSVYVWQMDTGALDRCAMGITAVEILNAC 610          

HSP 2 Score: 97.4413 bits (241), Expect = 1.065e-19
Identity = 87/372 (23.39%), Postives = 164/372 (44.09%), Query Frame = 3
Query: 3183 IDQINTDHERRNLSKIQIKALLNI--ALVGSHLKPDENNDINSDSKLFSKLFTLDKSF----LARITCDFLMSVL--SKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLED--ADIDDKLL-------SLVSHKAIEDIASARPLIFVMVCYREMLKWCSISLNTFHNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIYFY----IKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQISNAIFSLGG---NSHQVKLINSQSIPSLE 4226
            + +I+T +E R      I  LL +  A  G+ ++P +       S    + F L        LAR TC  L  +L     PK+   +  R     +I    GF VWEPY+D + V+   L    D E   A+I   L        +  +  A+  IA+ARP  F+    +E+ +  +++ NT    S  +T  T+ R K                         ++ +   L +     ++D+L E++++ +Y      +K +        + +F  VS+ E   +++VG+  G++ L+D++ GK  +   HK  I    F+ DGR +A+YS +++ +  WQ++ ++    G   ++ Q++ I +  +P ++
Sbjct: 1077 MKKISTSYEERRKQATAI-VLLGVIGAEFGAEIEPPKLLTRPRSSSQIPEGFGLTSGGSNYSLARHTCKALTYLLLQPPSPKLPPHSTIRRTATDLI--GRGFTVWEPYMDVSAVLMGLLELCADAEKQLANITMGLPLSPAADSARSARHALSLIATARPPAFITTIAKEVHRHTALAANTQSQQSIHTT--TLARAKGE-----------------------ILRVIEILIEKMPTDVVDLLVEVMDIIMYCLEGSLVKKKGLQECFPAICRFYMVSYYERSHRIAVGARHGSVALYDIRTGKCQTIHGHKGPITAVSFAPDGRYLATYSNTDSHISFWQMNTSLLGSIGMLNSAPQLRCIKTYQVPPVQ 1420          
BLAST of WD repeat-containing protein 7 vs. Ensembl Mouse
Match: Wdr7 (WD repeat domain 7 [Source:MGI Symbol;Acc:MGI:1860197])

HSP 1 Score: 185.267 bits (469), Expect = 1.549e-46
Identity = 163/677 (24.08%), Postives = 291/677 (42.98%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQ-KSIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFR----KQSLNLCDNIPNLLVEFPQPE------------NTASFRHKIEIQNQEDVIIIWKGFSNGNIYKWEFT----KQSK---LITQNRFCLDDSWEKITKAPTSLTKSIQGIDTAGS---VTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDST-----SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
            GNS +    LW  +AP H ISS++       +V+GC +G I +W  +    ++ P   L GH + I+   L+ +  + +  Y VS S +GE+ LW+  +GR IEF  ++ +   IQ+ + F   N ++  +LC     EI V+++ SL  + +LV   SP+W SS++  + +  ++D ++A SV+G++ +W V  T   +       I  ++   I   N   IS   ++    L++ S  ++VF      +L       G  +  G F+S D +I+ T +G+ ++Y+LP    P S  FR    K   NL   + + L++    E                + HK+ IQ          G S+G +  W       KQ     L       L ++++K+   P  +   +  I  +     VT+ ++I     +V G E+G II+     T      + +         +  L+GHR  VTCLL+P                  QV     +    L SGGVD+++ +WD+   +M  +F  H   +T L +                            E  S  ++  I          +A +  + ++S+ ++K ++  S H  P++ + W     YL++   + +V+VW + +G +DR   G  A  ++  C
Sbjct:    3 GNSLVLPIVLWGRKAPTHCISSILLTDDGGTIVTGCHDGQICLWDVSVE-LEVNPRALLFGHTASIT--CLSKACASGDKRYTVSASANGEMCLWDVNDGRCIEFTKLACTHTGIQF-YQFSVGNQQEGRLLCHGHYPEILVVDATSLEVLYSLVSKISPDWISSMSIIRSQRTQEDTVVALSVTGILKVWIV--TSEMSGMQDTEPIFEEESKPIYCQNCQSISFCAFTQRSLLVVCSKYWRVFDAGDYSLLCSGPSENGQTWTGGDFVSADKVIIWTENGQSYIYKLPASCLPASDSFRSDVGKAVENLIPPVQHSLLDQKDKELVICPPVTRFFYGCKEYLHKLLIQ----------GDSSGRLNIWNIADIAEKQEADEGLKMTTCISLQEAFDKLKPCPAGIIDQLSVIPNSNEPLKVTASVYIPAHGRLVCGREDGSIIIVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLYP-----------------HQVSARYDQ--RYLISGGVDFSVIIWDIFSGEMKHIFCVHGGEITQLLV--------------------------PPENCSARVQHCI--------CSVASDHSVGLLSLREKKCIMLASRHLFPIQVIKWRPSDDYLVVGCTDGSVYVWQMDTGALDRCAMGITAVEILNAC 610          

HSP 2 Score: 97.8265 bits (242), Expect = 8.848e-20
Identity = 87/372 (23.39%), Postives = 164/372 (44.09%), Query Frame = 3
Query: 3183 IDQINTDHERRNLSKIQIKALLNI--ALVGSHLKPDENNDINSDSKLFSKLFTLDKSF----LARITCDFLMSVL--SKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLED--ADIDDKLL-------SLVSHKAIEDIASARPLIFVMVCYREMLKWCSISLNTFHNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIYFY----IKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQISNAIFSLGG---NSHQVKLINSQSIPSLE 4226
            + +I+T +E R      I  LL +  A  G+ ++P +       S    + F L        LAR TC  L  +L     PK+   +  R     +I    GF VWEPY+D + V+   L    D E   A+I   L        +  +  A+  IA+ARP  F+    +E+ +  +++ NT    S  +T  T+ R K                         ++ +   L +     ++D+L E++++ +Y      +K +        + +F  VS+ E   +++VG+  G++ L+D++ GK  +   HK  I    F+ DGR +A+YS +++ +  WQ++ ++    G   ++ Q++ I +  +P ++
Sbjct: 1109 MKKISTSYEERRKQATAI-VLLGVIGAEFGAEIEPPKLLTRPRSSSQIPEGFGLTSGGSNYSLARHTCKALTYLLLQPPSPKLPPHSTIRRTATDLI--GRGFTVWEPYMDVSAVLMGLLELCADAEKQLANITMGLPLSPAADSARSARHALSLIATARPPAFITTIAKEVHRHTALAANTQSQQSIHTT--TLARAKGE-----------------------ILRVIEILIEKMPTDVVDLLVEVMDIIMYCLEGSLVKKKGLQECFPAICRFYMVSYYERSHRIAVGARHGSVALYDIRTGKCQTIHGHKGPITAVSFAPDGRYLATYSNTDSHISFWQMNTSLLGSIGMLNSAPQLRCIKTYQVPPVQ 1452          
BLAST of WD repeat-containing protein 7 vs. Ensembl Mouse
Match: Wdr7 (WD repeat domain 7 [Source:MGI Symbol;Acc:MGI:1860197])

HSP 1 Score: 164.466 bits (415), Expect = 3.370e-42
Identity = 140/551 (25.41%), Postives = 243/551 (44.10%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQ-KSIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFR----KQSLNLCDNIPNLLVEFPQPE------------NTASFRHKIEIQNQEDVIIIWKGFSNGNIYKWEFT----KQSK---LITQNRFCLDDSWEKITKAPTSLTKSIQGIDTAGS---VTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDST-----SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTL 1664
            GNS +    LW  +AP H ISS++       +V+GC +G I +W  +    ++ P   L GH + I+   L+ +  + +  Y VS S +GE+ LW+  +GR IEF  ++ +   IQ+ + F   N ++  +LC     EI V+++ SL  + +LV   SP+W SS++  + +  ++D ++A SV+G++ +W V  T   +       I  ++   I   N   IS   ++    L++ S  ++VF      +L       G  +  G F+S D +I+ T +G+ ++Y+LP    P S  FR    K   NL   + + L++    E                + HK+ IQ          G S+G +  W       KQ     L       L ++++K+   P  +   +  I  +     VT+ ++I     +V G E+G II+     T      + +         +  L+GHR  VTCLL+P                     ++       L SGGVD+++ +WD+   +M  +F  H   +T L
Sbjct:    3 GNSLVLPIVLWGRKAPTHCISSILLTDDGGTIVTGCHDGQICLWDVSVE-LEVNPRALLFGHTASIT--CLSKACASGDKRYTVSASANGEMCLWDVNDGRCIEFTKLACTHTGIQF-YQFSVGNQQEGRLLCHGHYPEILVVDATSLEVLYSLVSKISPDWISSMSIIRSQRTQEDTVVALSVTGILKVWIV--TSEMSGMQDTEPIFEEESKPIYCQNCQSISFCAFTQRSLLVVCSKYWRVFDAGDYSLLCSGPSENGQTWTGGDFVSADKVIIWTENGQSYIYKLPASCLPASDSFRSDVGKAVENLIPPVQHSLLDQKDKELVICPPVTRFFYGCKEYLHKLLIQ----------GDSSGRLNIWNIADIAEKQEADEGLKMTTCISLQEAFDKLKPCPAGIIDQLSVIPNSNEPLKVTASVYIPAHGRLVCGREDGSIIIVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLYPHQ-------------------VSARYDQRYLISGGVDFSVIIWDIFSGEMKHIFCVHGGEITQL 518          
BLAST of WD repeat-containing protein 7 vs. Ensembl Mouse
Match: Wdr7 (WD repeat domain 7 [Source:MGI Symbol;Acc:MGI:1860197])

HSP 1 Score: 153.295 bits (386), Expect = 9.748e-39
Identity = 127/487 (26.08%), Postives = 220/487 (45.17%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQ-KSIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFR----KQSLNLCDNIPNLLVEFPQPE------------NTASFRHKIEIQNQEDVIIIWKGFSNGNIYKWEFT----KQSK---LITQNRFCLDDSWEKITKAPTSLTKSIQGIDTAGS---VTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDST-----SNYVILKGHRGPVTCLLHP 1472
            GNS +    LW  +AP H ISS++       +V+GC +G I +W  +    ++ P   L GH + I+   L+ +  + +  Y VS S +GE+ LW+  +GR IEF  ++ +   IQ+ + F   N ++  +LC     EI V+++ SL  + +LV   SP+W SS++  + +  ++D ++A SV+G++ +W V  T   +       I  ++   I   N   IS   ++    L++ S  ++VF      +L       G  +  G F+S D +I+ T +G+ ++Y+LP    P S  FR    K   NL   + + L++    E                + HK+ IQ          G S+G +  W       KQ     L       L ++++K+   P  +   +  I  +     VT+ ++I     +V G E+G II+     T      + +         +  L+GHR  VTCLL+P
Sbjct:    3 GNSLVLPIVLWGRKAPTHCISSILLTDDGGTIVTGCHDGQICLWDVSVE-LEVNPRALLFGHTASIT--CLSKACASGDKRYTVSASANGEMCLWDVNDGRCIEFTKLACTHTGIQF-YQFSVGNQQEGRLLCHGHYPEILVVDATSLEVLYSLVSKISPDWISSMSIIRSQRTQEDTVVALSVTGILKVWIV--TSEMSGMQDTEPIFEEESKPIYCQNCQSISFCAFTQRSLLVVCSKYWRVFDAGDYSLLCSGPSENGQTWTGGDFVSADKVIIWTENGQSYIYKLPASCLPASDSFRSDVGKAVENLIPPVQHSLLDQKDKELVICPPVTRFFYGCKEYLHKLLIQ----------GDSSGRLNIWNIADIAEKQEADEGLKMTTCISLQEAFDKLKPCPAGIIDQLSVIPNSNEPLKVTASVYIPAHGRLVCGREDGSIIIVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLYP 473          
BLAST of WD repeat-containing protein 7 vs. Ensembl Mouse
Match: Wdr72 (WD repeat domain 72 [Source:MGI Symbol;Acc:MGI:3583957])

HSP 1 Score: 142.124 bits (357), Expect = 1.709e-33
Identity = 144/680 (21.18%), Postives = 291/680 (42.79%), Query Frame = 3
Query:  117 NSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEFISNSQMNIQYVFSFESAN-TKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQK-SIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTETCDI-LSYQDCYR-GDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQS-LNLC-----------DNIPNLLVEFPQPENTASFRHKIEIQNQED---VIIIWKGFSNGNIYKW--------EFTKQSKLIT-QNRFCLDDSWEKITKAPTSLTKSIQG----IDTAGSVTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDS----TSNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILW--SGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
              ++ + ALW  +AP H+I++++       +V+G + G + +WS +    +++    L GH + ++   LA +   +   Y VS + +GE+ +W    G+ +E  S    +    +   S   T +  +LCC +  ++ VL++ +LA + T     SP+W   +       I++D +L  S++G + +W+++ +    Q    +     +++D  + N   I   PY+  + L++ S  +K++  + CD  L + +  R G +F  G  ++   I++ T  G  ++YQL  R     +  R  S L+ C              P+LL      EN  S    +   N+       +++ G  +G I  W        +F    + I     + L D+++K      S+T    G    +    ++TS  +I +L  ++ G E+G I +    +   +   E DS    +  + +L+GH   VT LL+P                      NL       W  SG     + +WD+  E+++  F   + P+T L ++                            EN       I  C       +  +  ++++ +  ++ LL    H  PVR + W     +L++   +D+V++W++ +G ++R+E+G++A++++ NC
Sbjct:    2 RGALQAVALWGRKAPPHSITAIMITDDQQTIVTGSQEGQLCLWSLSPEL-KISAKELLFGHSASVT--CLARARDFSKQPYVVSAAENGEMCMWNVSSGQCVEKTSLPYRHTAICYYHCSFRMTGEGWLLCCGEYQDVLVLDAGTLAVLHTFTSLQSPDWMKCMCIVHSVRIQEDSLLVVSITGELKVWDLSSSINSIQEKQDVHEKESKFLD--SFNCQTIRFCPYTERLLLVVFSKCWKIY--DYCDFSLLWTEVSRDGQFFAGGEVLAAHRILVWTEDGHSYIYQLLNRWAQMGATLRTFSGLSKCVCPADGGVLKGTVYPHLLCSTSVEEN-KSLHFVMGYMNERKEPFYKVLFSGEVSGRITLWHIPDVPISKFDGSPREIPITTTWTLQDNFDKHQMVSQSITDHFSGSRDEVGMTATITSSEYIPNLDKLICGCEDGTIFITKALNAAKAGLLEGDSLLKDSPCHTLLRGHHQSVTSLLYPH---------------------NLASKLDQSWMVSGDRGSYVILWDIFTEEILHTFFLEAGPVTRLLMS---------------------------PENLKRSDGQILCC-------VCGDHSVALLHLEGRRCLLRARKHLFPVRMIRWHPVENFLIVGCTDDSVYIWEIETGTLERHETGERARIIL-NC 617          
BLAST of WD repeat-containing protein 7 vs. UniProt/SwissProt
Match: sp|Q9Y4E6|WDR7_HUMAN (WD repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=WDR7 PE=1 SV=2)

HSP 1 Score: 187.193 bits (474), Expect = 2.278e-46
Identity = 160/677 (23.63%), Postives = 292/677 (43.13%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQK-SIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFR----KQSLNLCDNIPNLLVEFPQPE------------NTASFRHKIEIQNQEDVIIIWKGFSNGNIYKWEFT-------KQSKLITQNRFCLDDSWEKITKAPTSLTKSIQGIDTAGS---VTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDST-----SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
            GNS +    LW  +AP H IS+++       +V+GC +G I +W  +    Q+ P   L GH + I+   L+ +  +++ +Y VS S  GE+ LW+  +GR IEF  ++ +   IQ+ + F   N ++  +LC     EI V+++ SL  + +LV   SP+W SS++  +    ++D ++A SV+G++ +W V  T   +       I  ++   I   N   IS   ++    L++ S  ++VF      +L       G  +  G F+S D +I+ T +G+ ++Y+LP    P S  FR    K   NL   + ++L++    E                + HK+ IQ          G S+G +  W  +        +  L       L ++++K+   P  +   +  I  +     VT+ ++I     +V G E+G I++     T      + +         +  L+GHR  VTCLL+P                  QV     +    L SGGVD+++ +WD+   +M  +F  H   +T L +                            E  S  ++  I          +A +  + ++S+ ++K ++  S H  P++ + W     YL++   + +V+VW + +G +DR   G  A  ++  C
Sbjct:    3 GNSLVLPIVLWGRKAPTHCISAVLLTDDGATIVTGCHDGQICLWDLSVE-LQINPRALLFGHTASIT--CLSKACASSDKQYIVSASESGEMCLWDVSDGRCIEFTKLACTHTGIQF-YQFSVGNQREGRLLCHGHYPEILVVDATSLEVLYSLVSKISPDWISSMSIIRSHRTQEDTVVALSVTGILKVWIV--TSEISDMQDTEPIFEEESKPIYCQNCQSISFCAFTQRSLLVVCSKYWRVFDAGDYSLLCSGPSENGQTWTGGDFVSSDKVIIWTENGQSYIYKLPASCLPASDSFRSDVGKAVENLIPPVQHILLDRKDKELLICPPVTRFFYGCREYFHKLLIQ----------GDSSGRLNIWNISDTADKQGSEEGLAMTTSISLQEAFDKLNPCPAGIIDQLSVIPNSNEPLKVTASVYIPAHGRLVCGREDGSIVIVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLYP-----------------HQVSARYDQ--RYLISGGVDFSVIIWDIFSGEMKHIFCVHGGEITQLLV--------------------------PPENCSARVQHCI--------CSVASDHSVGLLSLREKKCIMLASRHLFPIQVIKWRPSDDYLVVGCSDGSVYVWQMDTGALDRCVMGITAVEILNAC 610          

HSP 2 Score: 96.6709 bits (239), Expect = 1.238e-18
Identity = 87/372 (23.39%), Postives = 167/372 (44.89%), Query Frame = 3
Query: 3183 IDQINTDHERRNLSKIQIKALLNI--ALVGSHLKPDENNDINSDSKLFSKLFTLDKSF----LARITCDFLMSVL--SKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLED--ADIDDKLL-------SLVSHKAIEDIASARPLIFVMVCYREMLKWCSISLNTFHNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIYFY----IKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQISNAIFSLGG---NSHQVKLINSQSIPSLE 4226
            + +I+T +E R      I  LL +  A  G+ ++P +       S    + F L        LAR TC  L  +L     PK+   +  R   + +I    GF VWEPY+D + V+   L    D E   A+I   L        +  +  A+  IA+ARP  F+    +E+ +  +++ NT  +  +M T+ T+ R K                         ++ +   L +     ++D+L E++++ +Y      +K +        + +F  VS+ E   +++VG+  G++ L+D++ GK  +   HK  I    F+ DGR +A+YS +++ +  WQ++ ++    G   ++ Q++ I +  +P ++
Sbjct: 1110 MKKISTSYEERRKQATAI-VLLGVIGAEFGAEIEPPKLLTRPRSSSQIPEGFGLTSGGSNYSLARHTCKALTFLLLQPPSPKLPPHSTIRRTAIDLI--GRGFTVWEPYMDVSAVLMGLLELCADAEKQLANITMGLPLSPAADSARSARHALSLIATARPPAFITTIAKEVHRHTALAANT-QSQQNMHTT-TLARAKGE-----------------------ILRVIEILIEKMPTDVVDLLVEVMDIIMYCLEGSLVKKKGLQECFPAICRFYMVSYYERNHRIAVGARHGSVALYDIRTGKCQTIHGHKGPITAVAFAPDGRYLATYSNTDSHISFWQMNTSLLGSIGMLNSAPQLRCIKTYQVPPVQ 1453          
BLAST of WD repeat-containing protein 7 vs. UniProt/SwissProt
Match: sp|Q9ERH3|WDR7_RAT (WD repeat-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Wdr7 PE=1 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 3.924e-46
Identity = 162/677 (23.93%), Postives = 291/677 (42.98%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQK-SIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFR----KQSLNLCDNIPNLLVEFPQPE------------NTASFRHKIEIQNQEDVIIIWKGFSNGNIYKWEFT----KQSK---LITQNRFCLDDSWEKITKAPTSLTKSIQGIDTAGS---VTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDST-----SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
            GNS +    LW  +AP H ISS++       +V+GC +G I +W  ++   ++ P   L GH + I+   L+ +  + + +Y VS S +GE+ LW+  +GR IEF  ++ +   IQ+ + F   N ++  +LC     EI V+++ SL  + +LV   SP+W SS++  +    ++D ++A SV+G++ +W V  T   +       I  ++   I   N   +S   ++    L++ S  ++VF      +L       G  +  G F+S D +I+ T +G+ ++Y+LP    P S  FR    K   NL   + + L++    E                + HK+ IQ          G S+G +  W       KQ     L T     L D+++K+   P  +   +  I  +     VT+ ++I     +V G E+G II+     T      + +         +  L+GHR  VTCLL+P                  QV     +    L SGGVD+++ +WD+   +M  +F  H   +T L +                                 +    +  C    +  +A +  + ++S+ ++K ++  S H  P++ + W     YL++   + +V VW + +G +DR   G  A  ++  C
Sbjct:    3 GNSLVLPIVLWGRKAPTHCISSILLTDDGGTIVTGCHDGQICLWDLSEE-LEVNPRALLFGHTAAIT--CLSKACASGDKQYTVSASANGEMCLWDVNDGRCIEFTKLACTHTGIQF-YQFSVGNQREGRLLCHGHYPEILVVDATSLEVLYSLVSKISPDWISSMSIIRSHRTQEDTVVALSVTGILKVWIV--TSEISGLQDTEPIFEEESKPIYCQNCQSLSFCAFTQRSLLVVCSKYWRVFDAGDYSLLCSGPSEDGQTWTGGDFVSADKVIIWTENGQSYIYKLPASCLPASDSFRSDVGKAVENLIPPVQHSLLDQKDRELVICPPVTRFFYGCKEYLHKLLIQ----------GDSSGRLSIWNIADIADKQEANEGLKTTTCISLQDAFDKLKPCPAGIIDQLSVIPNSNEPLKVTASVYIPAHGRLVCGREDGSIIIVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLYP-----------------HQVSARYDQ--RYLISGGVDFSVIIWDIFSGEMKHIFCVHGGEITQLLV------------------------------PPENCSARVQHC----VCSVASDHSVGLLSLREKKCIMLASRHLFPIQVIKWRPSDDYLVVGCTDGSVCVWQMDTGALDRCAMGITAVEILNAC 610          

HSP 2 Score: 96.6709 bits (239), Expect = 1.280e-18
Identity = 86/372 (23.12%), Postives = 165/372 (44.35%), Query Frame = 3
Query: 3183 IDQINTDHERRNLSKIQIKALLNI--ALVGSHLKPDENNDINSDSKLFSKLFTLDKSF----LARITCDFLMSVL--SKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLED--ADIDDKLL-------SLVSHKAIEDIASARPLIFVMVCYREMLKWCSISLNTFHNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIYFY----IKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQISNAIFSLGG---NSHQVKLINSQSIPSLE 4226
            + +++T +E R      I  LL +  A  G+ ++P +       S    + F L        LAR TC  L  +L     PK+   +  R   + +I    GF VWEPY+D + V+   L    D E   A+I   L        +  +  A+  IA+ARP  F+    +E+ +  +++ NT    S  +T  T+ R K                         ++ +   L +     ++D+L E++++ +Y      +K +        + +F  VS+ E   +++VG+  G++ L+D++ GK  +   HK  I    F+ DGR +A+YS +++ +  WQ++ ++    G   ++ Q++ I +  +P ++
Sbjct: 1108 MKKMSTSYEERRKQATAI-VLLGVIGAEFGAEIEPPKLLTRPRSSSQIPEGFGLTSGGSNYSLARHTCKALTFLLLQPPSPKLPPHSTIRRTAIDLI--GRGFTVWEPYMDVSAVLMGLLELCADAEKQLANITMGLPLSPAADSARSARHALSLIATARPPAFITTIAKEVHRHTALAANTQSQQSIHTT--TLARAKGE-----------------------ILRVIEILIEKMPTDVVDLLVEVMDIIMYCLEGSLVKKKGLQECFPAICRFYMVSYYERSHRIAVGARHGSVALYDIRTGKCQTIHGHKGPITAVSFAPDGRYLATYSNTDSHISFWQMNTSLLGSIGMLNSAPQLRCIKTYQVPPVQ 1451          
BLAST of WD repeat-containing protein 7 vs. UniProt/SwissProt
Match: sp|Q920I9|WDR7_MOUSE (WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Wdr7 PE=1 SV=3)

HSP 1 Score: 185.267 bits (469), Expect = 1.083e-45
Identity = 163/677 (24.08%), Postives = 291/677 (42.98%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQ-KSIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFR----KQSLNLCDNIPNLLVEFPQPE------------NTASFRHKIEIQNQEDVIIIWKGFSNGNIYKWEFT----KQSK---LITQNRFCLDDSWEKITKAPTSLTKSIQGIDTAGS---VTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDST-----SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
            GNS +    LW  +AP H ISS++       +V+GC +G I +W  +    ++ P   L GH + I+   L+ +  + +  Y VS S +GE+ LW+  +GR IEF  ++ +   IQ+ + F   N ++  +LC     EI V+++ SL  + +LV   SP+W SS++  + +  ++D ++A SV+G++ +W V  T   +       I  ++   I   N   IS   ++    L++ S  ++VF      +L       G  +  G F+S D +I+ T +G+ ++Y+LP    P S  FR    K   NL   + + L++    E                + HK+ IQ          G S+G +  W       KQ     L       L ++++K+   P  +   +  I  +     VT+ ++I     +V G E+G II+     T      + +         +  L+GHR  VTCLL+P                  QV     +    L SGGVD+++ +WD+   +M  +F  H   +T L +                            E  S  ++  I          +A +  + ++S+ ++K ++  S H  P++ + W     YL++   + +V+VW + +G +DR   G  A  ++  C
Sbjct:    3 GNSLVLPIVLWGRKAPTHCISSILLTDDGGTIVTGCHDGQICLWDVSVE-LEVNPRALLFGHTASIT--CLSKACASGDKRYTVSASANGEMCLWDVNDGRCIEFTKLACTHTGIQF-YQFSVGNQQEGRLLCHGHYPEILVVDATSLEVLYSLVSKISPDWISSMSIIRSQRTQEDTVVALSVTGILKVWIV--TSEMSGMQDTEPIFEEESKPIYCQNCQSISFCAFTQRSLLVVCSKYWRVFDAGDYSLLCSGPSENGQTWTGGDFVSADKVIIWTENGQSYIYKLPASCLPASDSFRSDVGKAVENLIPPVQHSLLDQKDKELVICPPVTRFFYGCKEYLHKLLIQ----------GDSSGRLNIWNIADIAEKQEADEGLKMTTCISLQEAFDKLKPCPAGIIDQLSVIPNSNEPLKVTASVYIPAHGRLVCGREDGSIIIVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLYP-----------------HQVSARYDQ--RYLISGGVDFSVIIWDIFSGEMKHIFCVHGGEITQLLV--------------------------PPENCSARVQHCI--------CSVASDHSVGLLSLREKKCIMLASRHLFPIQVIKWRPSDDYLVVGCTDGSVYVWQMDTGALDRCAMGITAVEILNAC 610          

HSP 2 Score: 97.8265 bits (242), Expect = 6.189e-19
Identity = 87/372 (23.39%), Postives = 164/372 (44.09%), Query Frame = 3
Query: 3183 IDQINTDHERRNLSKIQIKALLNI--ALVGSHLKPDENNDINSDSKLFSKLFTLDKSF----LARITCDFLMSVL--SKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLED--ADIDDKLL-------SLVSHKAIEDIASARPLIFVMVCYREMLKWCSISLNTFHNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIYFY----IKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQISNAIFSLGG---NSHQVKLINSQSIPSLE 4226
            + +I+T +E R      I  LL +  A  G+ ++P +       S    + F L        LAR TC  L  +L     PK+   +  R     +I    GF VWEPY+D + V+   L    D E   A+I   L        +  +  A+  IA+ARP  F+    +E+ +  +++ NT    S  +T  T+ R K                         ++ +   L +     ++D+L E++++ +Y      +K +        + +F  VS+ E   +++VG+  G++ L+D++ GK  +   HK  I    F+ DGR +A+YS +++ +  WQ++ ++    G   ++ Q++ I +  +P ++
Sbjct: 1109 MKKISTSYEERRKQATAI-VLLGVIGAEFGAEIEPPKLLTRPRSSSQIPEGFGLTSGGSNYSLARHTCKALTYLLLQPPSPKLPPHSTIRRTATDLI--GRGFTVWEPYMDVSAVLMGLLELCADAEKQLANITMGLPLSPAADSARSARHALSLIATARPPAFITTIAKEVHRHTALAANTQSQQSIHTT--TLARAKGE-----------------------ILRVIEILIEKMPTDVVDLLVEVMDIIMYCLEGSLVKKKGLQECFPAICRFYMVSYYERSHRIAVGARHGSVALYDIRTGKCQTIHGHKGPITAVSFAPDGRYLATYSNTDSHISFWQMNTSLLGSIGMLNSAPQLRCIKTYQVPPVQ 1452          
BLAST of WD repeat-containing protein 7 vs. UniProt/SwissProt
Match: sp|D3YYM4|WDR72_MOUSE (WD repeat-containing protein 72 OS=Mus musculus OX=10090 GN=Wdr72 PE=1 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 1.961e-32
Identity = 144/680 (21.18%), Postives = 291/680 (42.79%), Query Frame = 3
Query:  117 NSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEFISNSQMNIQYVFSFESAN-TKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQK-SIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTETCDI-LSYQDCYR-GDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQS-LNLC-----------DNIPNLLVEFPQPENTASFRHKIEIQNQED---VIIIWKGFSNGNIYKW--------EFTKQSKLIT-QNRFCLDDSWEKITKAPTSLTKSIQG----IDTAGSVTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDS----TSNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILW--SGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
              ++ + ALW  +AP H+I++++       +V+G + G + +WS +    +++    L GH + ++   LA +   +   Y VS + +GE+ +W    G+ +E  S    +    +   S   T +  +LCC +  ++ VL++ +LA + T     SP+W   +       I++D +L  S++G + +W+++ +    Q    +     +++D  + N   I   PY+  + L++ S  +K++  + CD  L + +  R G +F  G  ++   I++ T  G  ++YQL  R     +  R  S L+ C              P+LL      EN  S    +   N+       +++ G  +G I  W        +F    + I     + L D+++K      S+T    G    +    ++TS  +I +L  ++ G E+G I +    +   +   E DS    +  + +L+GH   VT LL+P                      NL       W  SG     + +WD+  E+++  F   + P+T L ++                            EN       I  C       +  +  ++++ +  ++ LL    H  PVR + W     +L++   +D+V++W++ +G ++R+E+G++A++++ NC
Sbjct:    2 RGALQAVALWGRKAPPHSITAIMITDDQQTIVTGSQEGQLCLWSLSPEL-KISAKELLFGHSASVT--CLARARDFSKQPYVVSAAENGEMCMWNVSSGQCVEKTSLPYRHTAICYYHCSFRMTGEGWLLCCGEYQDVLVLDAGTLAVLHTFTSLQSPDWMKCMCIVHSVRIQEDSLLVVSITGELKVWDLSSSINSIQEKQDVHEKESKFLD--SFNCQTIRFCPYTERLLLVVFSKCWKIY--DYCDFSLLWTEVSRDGQFFAGGEVLAAHRILVWTEDGHSYIYQLLNRWAQMGATLRTFSGLSKCVCPADGGVLKGTVYPHLLCSTSVEEN-KSLHFVMGYMNERKEPFYKVLFSGEVSGRITLWHIPDVPISKFDGSPREIPITTTWTLQDNFDKHQMVSQSITDHFSGSRDEVGMTATITSSEYIPNLDKLICGCEDGTIFITKALNAAKAGLLEGDSLLKDSPCHTLLRGHHQSVTSLLYPH---------------------NLASKLDQSWMVSGDRGSYVILWDIFTEEILHTFFLEAGPVTRLLMS---------------------------PENLKRSDGQILCC-------VCGDHSVALLHLEGRRCLLRARKHLFPVRMIRWHPVENFLIVGCTDDSVYIWEIETGTLERHETGERARIIL-NC 617          
BLAST of WD repeat-containing protein 7 vs. UniProt/SwissProt
Match: sp|Q3MJ13|WDR72_HUMAN (WD repeat-containing protein 72 OS=Homo sapiens OX=9606 GN=WDR72 PE=2 SV=2)

HSP 1 Score: 138.658 bits (348), Expect = 1.487e-31
Identity = 138/667 (20.69%), Postives = 291/667 (43.63%), Query Frame = 3
Query:  117 NSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEFISNSQMNIQYVFSFESAN-TKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQK-SIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTETCD--ILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCDNI-PNLLVEFPQPENTASFRH----KIEIQNQEDVIIIWKGFSNGNIYKWEF--TKQSKLITQNR-------FCLDDSWEKITKAPTSLTKSIQGI-DTAGS--VTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDS----TSNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
             +S+ + ALW  +AP H+I++++       +V+G + G + +W+ +    +++    L GH + ++   LA +   +   Y VS + +GE+ +W    G+ +E  +    +    +   S   T +  +LCC +  ++ ++++ +LA + +   +  P+W + +       I++D +L  SV+G + +W+++ +    Q    +     ++  +E+ N   I    Y+  + L++ S  +KV+  + CD  +L  +    G +F  G  I+   I++ T  G  ++YQL   +    S +      L + I P+LL      EN    R      +  + +    +++ G  +G I  W       SK     R       + L D+++K      S+     G+ D AG+  VTS  +I  L  ++ G E+G II+    +   +   E  S    +  + +LKGH   VT LL+P           S    QS            + SG +D  + +WD+  E+++  F   + P+T+L ++                                   +   +     +  +  +  ++++ +  +  LL    H  PVR + W     +L++   +D+V++W++ +G ++R+E+G++A++++  C
Sbjct:    2 RTSLQAVALWGQKAPPHSITAIMITDDQRTIVTGSQEGQLCLWNLSHEL-KISAKELLFGHSASVT--CLARARDFSKQPYIVSAAENGEMCVWNVTNGQCMEKATLPYRHTAICYYHCSFRMTGEGWLLCCGEYQDVLIIDAKTLAVVHSFRSSQFPDWINCMCIVHSMRIQEDSLLVVSVAGELKVWDLSSSINSIQEKQDVYEKESKF--LESLNCQTIRFCTYTERLLLVVFSKCWKVY--DYCDFSLLLTEVSRNGQFFAGGEVIAAHRILIWTEDGHSYIYQL-LNSGLSKSIYPADGRVLKETIYPHLLCSTSVQENKEQSRPFVMGYMNERKEPFYKVLFSGEVSGRITLWHIPDVPVSKFDGSPREIPVTATWTLQDNFDKHDTMSQSIIDYFSGLKDGAGTAVVTSSEYIPSLDKLICGCEDGTIIITQALNAAKARLLEGGSLVKDSPPHKVLKGHHQSVTSLLYPHG--------LSSKLDQSW-----------MLSGDLDSCVILWDIFTEEILHKFFLEAGPVTSLLMS----------------------------------PEKFKLRGEQIICCVCGDHSVALLHLEGKSCLLHARKHLFPVRMIKWHPVENFLIVGCADDSVYIWEIETGTLERHETGERARIILNCC 607          
BLAST of WD repeat-containing protein 7 vs. TrEMBL
Match: A0A4W3HEP6 (Uncharacterized protein OS=Callorhinchus milii OX=7868 PE=4 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 6.713e-48
Identity = 166/675 (24.59%), Postives = 297/675 (44.00%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQ-KSIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETA-----NPSKISHNPYSSSIFLIITSCQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCDN-IPNLLVEFPQPEN---------TASFRHKIEIQNQEDVIIIWKGFSNGNIYKWEF------TKQSKLITQNRFCLDDSWEKITKAPTSLTKSIQ---GIDTAGSVTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDST-----SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
            GN+ +    LW  +AP H IS+L+ +     +V+GC +G I +W       ++ P   L GH + I+   L+ +S  ++ +Y VS S  GE+ LW+  +GR IEF  ++ +   IQ+ + F +   ++  +LC     EI V+++ SL  + +LV   +P+W SS++  +    ++D ++A S++G++ +W +          I  + D +   + E+      N   +S   Y+    L++ S  ++VF      +L    C  G  +  G F+S D +++ T  G  F+YQLP    P S  FR       +N IP LL      ++         T  F  + E  ++    ++ +G S+G I  W        T    LIT +  CL D+++K++  P  +   +    G +    VT+ ++I     +V G E+G II+     T      + +         +  L+GHR  VTCLL+P             +    Q C         L SGGVD+++ +WD+   +M  +F  H   +T L                          V   E  S  ++  I          +A +  + ++S+ ++K ++  S H  P++ L W     YL++   + +V+VW + +G +DR   G  A  ++  C
Sbjct:    3 GNNLVLPIVLWGRKAPTHCISTLLLMDDLATIVTGCHDGQICLWDLTPE-IEILPRALLFGHTASIT--CLSKASATSDKQYVVSASESGEMCLWDVNDGRCIEFAKLACTHTGIQF-YQFSNGTQREGRLLCYGHYPEILVVDATSLEVLYSLVSKIAPDWISSMSIIRSPRTQEDTVVAVSLTGILKVWIIT-------AEINRLQDIEPLFEEESKPIYCLNCQSVSFCTYTQQSLLVVCSKYWRVFDAGDFSLLCSVPCESGQSWTGGDFVSVDKVVIWTEDGSSFMYQLPSSCLPASESFRSDVGKAIENSIPPLLFNVLDRKDKSLLICSPVTRFFYGRREPFHK----LLVQGDSSGRISMWSILDTRCPTNSHGLITTS-ACLQDAFDKLSPRPAGIIDQLSVLPGNEEPLKVTASVYIPSHGRLVCGREDGSIIIVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLYPHQV----------SARYDQRC---------LVSGGVDFSVIIWDILSGEMKHIFCVHGGEITQL--------------------------VVPPENCSSRVQYCI--------CSVASDHSVGLLSLRERKCIMLASRHLFPIQVLKWRPSDDYLVVGCSDGSVYVWQMDTGALDRCVMGITAVEILNAC 608          

HSP 2 Score: 94.3597 bits (233), Expect = 1.797e-15
Identity = 87/369 (23.58%), Postives = 166/369 (44.99%), Query Frame = 3
Query: 3207 ERRNLSKIQIKALLNIALVGSHLKPD-ENNDINSDSKLFSKL---FTLDKSF----LARITCDFLMSVL--SKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLEDADIDDKLLSLV----------SHKAIEDIASARPLIFVMVCYREMLKWCSISLNTFHNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNR--NILVPIFNDLCQHQSDKILDVLPELVELYIYFY----IKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQISNAIFSLGG---NSHQVKLINSQSIPSLE 4226
            ERR     Q  A++ + ++G+    + E   + S ++  S++   F L        LAR TC  L  +L  +  PK+   +  R   + +I    GF VWEPY+D + V+   L    D E   + +KL  L           +  A+  IA+ARP  F+    RE+ +   ++ NT                +S P++ +           S L+R  N ++ +   L +     ++D+L E++++ +Y      IK +        + +F  VS  E   +++VGS  G++ L+D++ GK  +   H   I    F+ DGR +A+YS +++ +  WQ++ ++    G   ++ Q++ + +  +P + 
Sbjct: 1082 ERRK----QATAIVLLGVIGAEFGAEIEPPKLPSRTRHTSQVPEGFGLTTGGSNYSLARHTCKALTYLLLQAPAPKLPAHSTIRRTAIDLI--GRGFTVWEPYMDVSAVLMGLLELCADGEK-HLPNKLPVLPLSPAADSARSARHALSLIATARPPAFITTIAREVHRHTVLAANT----------------QSQPNVHT-----------STLSRAKNEILRVVEILIEKMPSDVVDLLVEVMDIVMYCLEGSLIKKKGLQECFSAICRFYMVSSCEKSNRIAVGSRHGSMALYDIRTGKCQTIQGHSGPITAVGFAPDGRYLATYSNADSHISFWQMNTSLLGSIGMLNSAPQLRCMKTYQVPPIH 1416          
BLAST of WD repeat-containing protein 7 vs. TrEMBL
Match: A0A4W3HEQ0 (Uncharacterized protein OS=Callorhinchus milii OX=7868 PE=4 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 7.226e-48
Identity = 162/670 (24.18%), Postives = 295/670 (44.03%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQ-KSIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETA-----NPSKISHNPYSSSIFLIITSCQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCDN-IPNLLVEFPQPEN---------TASFRHKIEIQNQEDVIIIWKGFSNGNIYKWEFTKQSKLI-TQNRFCLDDSWEKITKAPTSLTKSIQ---GIDTAGSVTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDST-----SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
            GN+ +    LW  +AP H IS+L+ +     +V+GC +G I +W       ++ P   L GH + I+   L+ +S  ++ +Y VS S  GE+ LW+  +GR IEF  ++ +   IQ+ + F +   ++  +LC     EI V+++ SL  + +LV   +P+W SS++  +    ++D ++A S++G++ +W +          I  + D +   + E+      N   +S   Y+    L++ S  ++VF      +L    C  G  +  G F+S D +++ T  G  F+YQLP    P S  FR       +N IP LL      ++         T  F  + E  ++    ++ +G S+G I  W     ++ +      CL D+++K++  P  +   +    G +    VT+ ++I     +V G E+G II+     T      + +         +  L+GHR  VTCLL+P             +    Q C         L SGGVD+++ +WD+   +M  +F  H   +T L                          V   E  S  ++  I          +A +  + ++S+ ++K ++  S H  P++ L W     YL++   + +V+VW + +G +DR   G  A  ++  C
Sbjct:    3 GNNLVLPIVLWGRKAPTHCISTLLLMDDLATIVTGCHDGQICLWDLTPE-IEILPRALLFGHTASIT--CLSKASATSDKQYVVSASESGEMCLWDVNDGRCIEFAKLACTHTGIQF-YQFSNGTQREGRLLCYGHYPEILVVDATSLEVLYSLVSKIAPDWISSMSIIRSPRTQEDTVVAVSLTGILKVWIIT-------AEINRLQDIEPLFEEESKPIYCLNCQSVSFCTYTQQSLLVVCSKYWRVFDAGDFSLLCSVPCESGQSWTGGDFVSVDKVVIWTEDGSSFMYQLPSSCLPASESFRSDVGKAIENSIPPLLFNVLDRKDKSLLICSPVTRFFYGRREPFHK----LLVQGDSSGRISMWSILDTAEGVKVTTSACLQDAFDKLSPRPAGIIDQLSVLPGNEEPLKVTASVYIPSHGRLVCGREDGSIIIVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLYPHQV----------SARYDQRC---------LVSGGVDFSVIIWDILSGEMKHIFCVHGGEITQL--------------------------VVPPENCSSRVQYCI--------CSVASDHSVGLLSLRERKCIMLASRHLFPIQVLKWRPSDDYLVVGCSDGSVYVWQMDTGALDRCVMGITAVEILNAC 604          

HSP 2 Score: 87.8113 bits (216), Expect = 2.090e-13
Identity = 69/298 (23.15%), Postives = 135/298 (45.30%), Query Frame = 3
Query: 3390 SKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLEDADIDDKLLSLV----------SHKAIEDIASARPLIFVMVCYREMLKWCSISLNTFHNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNR--NILVPIFNDLCQHQSDKILDVLPELVELYIYFY----IKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQISNAIFSLGG---NSHQVKLINSQSIPSLE 4226
            +  PK+   +  R   + +I    GF VWEPY+D + V+   L    D E   + +KL  L           +  A+  IA+ARP  F+    RE+ +   ++ NT                +S P++ +           S L+R  N ++ +   L +     ++D+L E++++ +Y      IK +        + +F  VS  E   +++VGS  G++ L+D++ GK  +   H   I    F+ DGR +A+YS +++ +  WQ++ ++    G   ++ Q++ + +  +P + 
Sbjct: 1070 APAPKLPAHSTIRRTAIDLI--GRGFTVWEPYMDVSAVLMGLLELCADGEK-HLPNKLPVLPLSPAADSARSARHALSLIATARPPAFITTIAREVHRHTVLAANT----------------QSQPNVHT-----------STLSRAKNEILRVVEILIEKMPSDVVDLLVEVMDIVMYCLEGSLIKKKGLQECFSAICRFYMVSSCEKSNRIAVGSRHGSMALYDIRTGKCQTIQGHSGPITAVGFAPDGRYLATYSNADSHISFWQMNTSLLGSIGMLNSAPQLRCMKTYQVPPIH 1337          
BLAST of WD repeat-containing protein 7 vs. TrEMBL
Match: A0A4W3HBV2 (Uncharacterized protein OS=Callorhinchus milii OX=7868 PE=4 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 9.221e-48
Identity = 162/670 (24.18%), Postives = 295/670 (44.03%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQ-KSIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETA-----NPSKISHNPYSSSIFLIITSCQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCDN-IPNLLVEFPQPEN---------TASFRHKIEIQNQEDVIIIWKGFSNGNIYKWEFTKQSKLI-TQNRFCLDDSWEKITKAPTSLTKSIQ---GIDTAGSVTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDST-----SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
            GN+ +    LW  +AP H IS+L+ +     +V+GC +G I +W       ++ P   L GH + I+   L+ +S  ++ +Y VS S  GE+ LW+  +GR IEF  ++ +   IQ+ + F +   ++  +LC     EI V+++ SL  + +LV   +P+W SS++  +    ++D ++A S++G++ +W +          I  + D +   + E+      N   +S   Y+    L++ S  ++VF      +L    C  G  +  G F+S D +++ T  G  F+YQLP    P S  FR       +N IP LL      ++         T  F  + E  ++    ++ +G S+G I  W     ++ +      CL D+++K++  P  +   +    G +    VT+ ++I     +V G E+G II+     T      + +         +  L+GHR  VTCLL+P             +    Q C         L SGGVD+++ +WD+   +M  +F  H   +T L                          V   E  S  ++  I          +A +  + ++S+ ++K ++  S H  P++ L W     YL++   + +V+VW + +G +DR   G  A  ++  C
Sbjct:    3 GNNLVLPIVLWGRKAPTHCISTLLLMDDLATIVTGCHDGQICLWDLTPE-IEILPRALLFGHTASIT--CLSKASATSDKQYVVSASESGEMCLWDVNDGRCIEFAKLACTHTGIQF-YQFSNGTQREGRLLCYGHYPEILVVDATSLEVLYSLVSKIAPDWISSMSIIRSPRTQEDTVVAVSLTGILKVWIIT-------AEINRLQDIEPLFEEESKPIYCLNCQSVSFCTYTQQSLLVVCSKYWRVFDAGDFSLLCSVPCESGQSWTGGDFVSVDKVVIWTEDGSSFMYQLPSSCLPASESFRSDVGKAIENSIPPLLFNVLDRKDKSLLICSPVTRFFYGRREPFHK----LLVQGDSSGRISMWSILDTAEGVKVTTSACLQDAFDKLSPRPAGIIDQLSVLPGNEEPLKVTASVYIPSHGRLVCGREDGSIIIVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLYPHQV----------SARYDQRC---------LVSGGVDFSVIIWDILSGEMKHIFCVHGGEITQL--------------------------VVPPENCSSRVQYCI--------CSVASDHSVGLLSLRERKCIMLASRHLFPIQVLKWRPSDDYLVVGCSDGSVYVWQMDTGALDRCVMGITAVEILNAC 604          

HSP 2 Score: 94.3597 bits (233), Expect = 1.843e-15
Identity = 87/367 (23.71%), Postives = 165/367 (44.96%), Query Frame = 3
Query: 3207 ERRNLSKIQIKALLNIALVGSHLKPD-ENNDINSDSKLFSKL---FTLDKSF----LARITCDFLMSVL--SKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLEDADIDDKLLSLV----------SHKAIEDIASARPLIFVMVCYREMLKWCSISLNTFHNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIYFY----IKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQISNAIFSLGG---NSHQVKLINSQSIPSLE 4226
            ERR     Q  A++ + ++G+    + E   + S ++  S++   F L        LAR TC  L  +L  +  PK+   +  R   + +I    GF VWEPY+D + V+   L    D E   + +KL  L           +  A+  IA+ARP  F+    RE+ +   ++ NT  +  ++ TS T+ R K                       N ++ +   L +     ++D+L E++++ +Y      IK +        + +F  VS  E   +++VGS  G++ L+D++ GK  +   H   I    F+ DGR +A+YS +++ +  WQ++ ++    G   ++ Q++ + +  +P + 
Sbjct: 1083 ERRK----QATAIVLLGVIGAEFGAEIEPPKLPSRTRHTSQVPEGFGLTTGGSNYSLARHTCKALTYLLLQAPAPKLPAHSTIRRTAIDLI--GRGFTVWEPYMDVSAVLMGLLELCADGEK-HLPNKLPVLPLSPAADSARSARHALSLIATARPPAFITTIAREVHRHTVLAANT-QSQPNVHTS-TLSRAK-----------------------NEILRVVEILIEKMPSDVVDLLVEVMDIVMYCLEGSLIKKKGLQECFSAICRFYMVSSCEKSNRIAVGSRHGSMALYDIRTGKCQTIQGHSGPITAVGFAPDGRYLATYSNADSHISFWQMNTSLLGSIGMLNSAPQLRCMKTYQVPPIH 1417          
BLAST of WD repeat-containing protein 7 vs. TrEMBL
Match: A0A4W3HGW4 (Uncharacterized protein OS=Callorhinchus milii OX=7868 PE=4 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 1.471e-47
Identity = 163/675 (24.15%), Postives = 294/675 (43.56%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQ-KSIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETA-----NPSKISHNPYSSSIFLIITSCQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCDN-IPNLLVEFPQPEN---------TASFRHKIEIQNQEDVIIIWKGFSNGNIYKWE------FTKQSKLITQNRFCLDDSWEKITKAPTSLTKSIQ---GIDTAGSVTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDST-----SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
            GN+ +    LW  +AP H IS+L+ +     +V+GC +G I +W       ++ P   L GH + I+   L+ +S  ++ +Y VS S  GE+ LW+  +GR IEF  ++ +   IQ+ + F +   ++  +LC     EI V+++ SL  + +LV   +P+W SS++  +    ++D ++A S++G++ +W +          I  + D +   + E+      N   +S   Y+    L++ S  ++VF      +L    C  G  +  G F+S D +++ T  G  F+YQLP    P S  FR       +N IP LL      ++         T  F  + E  ++    ++ +G S+G I  W        T    +      CL D+++K++  P  +   +    G +    VT+ ++I     +V G E+G II+     T      + +         +  L+GHR  VTCLL+P             +    Q C         L SGGVD+++ +WD+   +M  +F  H   +T L                          V   E  S  ++  I          +A +  + ++S+ ++K ++  S H  P++ L W     YL++   + +V+VW + +G +DR   G  A  ++  C
Sbjct:    3 GNNLVLPIVLWGRKAPTHCISTLLLMDDLATIVTGCHDGQICLWDLTPE-IEILPRALLFGHTASIT--CLSKASATSDKQYVVSASESGEMCLWDVNDGRCIEFAKLACTHTGIQF-YQFSNGTQREGRLLCYGHYPEILVVDATSLEVLYSLVSKIAPDWISSMSIIRSPRTQEDTVVAVSLTGILKVWIIT-------AEINRLQDIEPLFEEESKPIYCLNCQSVSFCTYTQQSLLVVCSKYWRVFDAGDFSLLCSVPCESGQSWTGGDFVSVDKVVIWTEDGSSFMYQLPSSCLPASESFRSDVGKAIENSIPPLLFNVLDRKDKSLLICSPVTRFFYGRREPFHK----LLVQGDSSGRISMWSILDTAGLTGSGDVRVTTSACLQDAFDKLSPRPAGIIDQLSVLPGNEEPLKVTASVYIPSHGRLVCGREDGSIIIVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLYPHQV----------SARYDQRC---------LVSGGVDFSVIIWDILSGEMKHIFCVHGGEITQL--------------------------VVPPENCSSRVQYCI--------CSVASDHSVGLLSLRERKCIMLASRHLFPIQVLKWRPSDDYLVVGCSDGSVYVWQMDTGALDRCVMGITAVEILNAC 609          

HSP 2 Score: 94.3597 bits (233), Expect = 1.846e-15
Identity = 87/367 (23.71%), Postives = 165/367 (44.96%), Query Frame = 3
Query: 3207 ERRNLSKIQIKALLNIALVGSHLKPD-ENNDINSDSKLFSKL---FTLDKSF----LARITCDFLMSVL--SKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLEDADIDDKLLSLV----------SHKAIEDIASARPLIFVMVCYREMLKWCSISLNTFHNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIYFY----IKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQISNAIFSLGG---NSHQVKLINSQSIPSLE 4226
            ERR     Q  A++ + ++G+    + E   + S ++  S++   F L        LAR TC  L  +L  +  PK+   +  R   + +I    GF VWEPY+D + V+   L    D E   + +KL  L           +  A+  IA+ARP  F+    RE+ +   ++ NT  +  ++ TS T+ R K                       N ++ +   L +     ++D+L E++++ +Y      IK +        + +F  VS  E   +++VGS  G++ L+D++ GK  +   H   I    F+ DGR +A+YS +++ +  WQ++ ++    G   ++ Q++ + +  +P + 
Sbjct: 1088 ERRK----QATAIVLLGVIGAEFGAEIEPPKLPSRTRHTSQVPEGFGLTTGGSNYSLARHTCKALTYLLLQAPAPKLPAHSTIRRTAIDLI--GRGFTVWEPYMDVSAVLMGLLELCADGEK-HLPNKLPVLPLSPAADSARSARHALSLIATARPPAFITTIAREVHRHTVLAANT-QSQPNVHTS-TLSRAK-----------------------NEILRVVEILIEKMPSDVVDLLVEVMDIVMYCLEGSLIKKKGLQECFSAICRFYMVSSCEKSNRIAVGSRHGSMALYDIRTGKCQTIQGHSGPITAVGFAPDGRYLATYSNADSHISFWQMNTSLLGSIGMLNSAPQLRCMKTYQVPPIH 1422          
BLAST of WD repeat-containing protein 7 vs. TrEMBL
Match: A0A4W3HEM3 (Uncharacterized protein OS=Callorhinchus milii OX=7868 PE=4 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 4.556e-47
Identity = 163/677 (24.08%), Postives = 294/677 (43.43%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQ-KSIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETA-----NPSKISHNPYSSSIFLIITSCQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCDN-IPNLLVEFPQPEN---------TASFRHKIEIQNQEDVIIIWKGFSNGNIYKWEFT--------KQSKLITQNRFCLDDSWEKITKAPTSLTKSIQ---GIDTAGSVTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDST-----SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
            GN+ +    LW  +AP H IS+L+ +     +V+GC +G I +W       ++ P   L GH + I+   L+ +S  ++ +Y VS S  GE+ LW+  +GR IEF  ++ +   IQ+ + F +   ++  +LC     EI V+++ SL  + +LV   +P+W SS++  +    ++D ++A S++G++ +W +          I  + D +   + E+      N   +S   Y+    L++ S  ++VF      +L    C  G  +  G F+S D +++ T  G  F+YQLP    P S  FR       +N IP LL      ++         T  F  + E  ++    ++ +G S+G I  W            Q  +      CL D+++K++  P  +   +    G +    VT+ ++I     +V G E+G II+     T      + +         +  L+GHR  VTCLL+P             +    Q C         L SGGVD+++ +WD+   +M  +F  H   +T L                          V   E  S  ++  I          +A +  + ++S+ ++K ++  S H  P++ L W     YL++   + +V+VW + +G +DR   G  A  ++  C
Sbjct:    3 GNNLVLPIVLWGRKAPTHCISTLLLMDDLATIVTGCHDGQICLWDLTPE-IEILPRALLFGHTASIT--CLSKASATSDKQYVVSASESGEMCLWDVNDGRCIEFAKLACTHTGIQF-YQFSNGTQREGRLLCYGHYPEILVVDATSLEVLYSLVSKIAPDWISSMSIIRSPRTQEDTVVAVSLTGILKVWIIT-------AEINRLQDIEPLFEEESKPIYCLNCQSVSFCTYTQQSLLVVCSKYWRVFDAGDFSLLCSVPCESGQSWTGGDFVSVDKVVIWTEDGSSFMYQLPSSCLPASESFRSDVGKAIENSIPPLLFNVLDRKDKSLLICSPVTRFFYGRREPFHK----LLVQGDSSGRISMWSILDTAGDQKHSQGLMEVTTSACLQDAFDKLSPRPAGIIDQLSVLPGNEEPLKVTASVYIPSHGRLVCGREDGSIIIVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLYPHQV----------SARYDQRC---------LVSGGVDFSVIIWDILSGEMKHIFCVHGGEITQL--------------------------VVPPENCSSRVQYCI--------CSVASDHSVGLLSLRERKCIMLASRHLFPIQVLKWRPSDDYLVVGCSDGSVYVWQMDTGALDRCVMGITAVEILNAC 611          

HSP 2 Score: 94.3597 bits (233), Expect = 1.862e-15
Identity = 87/367 (23.71%), Postives = 165/367 (44.96%), Query Frame = 3
Query: 3207 ERRNLSKIQIKALLNIALVGSHLKPD-ENNDINSDSKLFSKL---FTLDKSF----LARITCDFLMSVL--SKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLEDADIDDKLLSLV----------SHKAIEDIASARPLIFVMVCYREMLKWCSISLNTFHNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIYFY----IKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQISNAIFSLGG---NSHQVKLINSQSIPSLE 4226
            ERR     Q  A++ + ++G+    + E   + S ++  S++   F L        LAR TC  L  +L  +  PK+   +  R   + +I    GF VWEPY+D + V+   L    D E   + +KL  L           +  A+  IA+ARP  F+    RE+ +   ++ NT  +  ++ TS T+ R K                       N ++ +   L +     ++D+L E++++ +Y      IK +        + +F  VS  E   +++VGS  G++ L+D++ GK  +   H   I    F+ DGR +A+YS +++ +  WQ++ ++    G   ++ Q++ + +  +P + 
Sbjct: 1090 ERRK----QATAIVLLGVIGAEFGAEIEPPKLPSRTRHTSQVPEGFGLTTGGSNYSLARHTCKALTYLLLQAPAPKLPAHSTIRRTAIDLI--GRGFTVWEPYMDVSAVLMGLLELCADGEK-HLPNKLPVLPLSPAADSARSARHALSLIATARPPAFITTIAREVHRHTVLAANT-QSQPNVHTS-TLSRAK-----------------------NEILRVVEILIEKMPSDVVDLLVEVMDIVMYCLEGSLIKKKGLQECFSAICRFYMVSSCEKSNRIAVGSRHGSMALYDIRTGKCQTIQGHSGPITAVGFAPDGRYLATYSNADSHISFWQMNTSLLGSIGMLNSAPQLRCMKTYQVPPIH 1424          
BLAST of WD repeat-containing protein 7 vs. Ensembl Cavefish
Match: WDR7 (WD repeat domain 7 [Source:HGNC Symbol;Acc:HGNC:13490])

HSP 1 Score: 182.956 bits (463), Expect = 5.485e-46
Identity = 160/680 (23.53%), Postives = 296/680 (43.53%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQK-SIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANP------SKISHNPYSSSIFLIITSCQFKVF----YTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCD-NIPNLLVEFPQ---------PENTASFRHKIEIQNQEDVIIIWKGFSNGNIYKWEFTKQSK------LITQNRFCLDDSWEKITKAPTSLTKSIQ---GIDTAGSVTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDST-----SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
            GNS +    LW   AP H ISSL+ +     ++SGC +G I IW    +  ++ P   L GH + ++   L+ +S +++ +Y VS S  GE+ LW+  +GR IEF  ++ +   IQ+ + F     ++  +LC     EI V+++ SL  + +LV   SP+W SS++  +    ++D ++A SV+G++ +W +          +  + D D   + E + P        IS   ++    L++ S  ++VF    ++  C + S  D      +  G FI+ D +I+ T  G  ++Y+LP    P S  FR       + +IP L+              P  T  F  + E  ++    ++ +G S G +  W     S       L   +   L ++++K+T  P  +   +    G +    VT+ ++I     +V G E+G I++     T      + +         +  L+GHR  VTCLL+P         ++   + +S V            SGGVD+++ VWD+   +M  +F  H   +T L +                            E  S  ++  +          +A +  + ++S+ ++K ++  S H  P++ + W     YL++   + +V+VW + +G +DR   G  A  ++  C
Sbjct:    3 GNSLVLPIVLWGRNAPTHCISSLLVMDDLATIISGCHDGQICIWDMTPD-LKINPRALLFGHTASVT--CLSKASASSDKQYMVSASESGEMCLWDVNDGRCIEFTKLACAHTGIQF-YQFTIGTQREGRLLCNGHYPEILVVDATSLEVLYSLVSKISPDWISSMSIIRSHRTQEDTVVAVSVTGILKVWIIT-------AEVSRMQDMDPVFE-EESKPIYCQGCQSISFCTFTQLSLLVVCSKYWRVFDAGDFSLLCSVPSEND----QSWTGGEFIAADKVIIWTEDGCSYIYKLPASCLPASESFRSNVGKTAEGSIPPLVYSIADRADKQLLICPPVTRFFYGRREPFHK----LLVQGDSAGRLSLWSIPDTSPLQPLSSLQVSSTISLQEAFDKLTPLPAGIIDQLSVLPGSEDPVKVTASVYIPSQGRLVCGREDGSIVLVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLYPHQ-------ISPRYDQRSLV------------SGGVDFSVIVWDIFTGEMKHIFCVHGGEITQLLV--------------------------PPENCSTRVQHCV--------CSVASDHSVGLLSLRERKCIMLASRHLFPIQVIKWRPCDDYLVVGCSDGSVYVWQMDTGALDRCVMGITAVEILNAC 609          

HSP 2 Score: 83.1889 bits (204), Expect = 1.880e-15
Identity = 62/285 (21.75%), Postives = 134/285 (47.02%), Query Frame = 3
Query: 3399 PKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLEDA-DIDDKLLSLVSHK-AIEDIASARPLIFVMVCYREMLKWCSISLNTFHNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIYF----YIKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQISNAIFSLGG---NSHQVKLINSQSIPSLE 4226
            PK+   +  R   + +I    GF VWEPY+D + V+   L    D  +   ++    S  S + A+  IA+ARP  F+    +E+ +  ++      +  ++ T+ T+ R K+                        ++ +   L +     ++D+L E++++ +Y      +K +  S     + KF  V++ +   +++VG+ +G++ L+D++ GK      HK  I    F+ DGR +A+YS +++ +  WQ++ ++    G   ++ Q++ I +  +P ++
Sbjct: 1067 PKLPAHSTIRRTAIDLI--GRGFTVWEPYMDVSAVLMGLLELCADHHNGLPLNPAADSARSARHALSLIATARPPAFITTIAKEVHRHTAMQSQGSQSQQNVHTT-TLARAKTE-----------------------ILRVIEILIEKMPSDVVDLLVEVMDIIMYCIEGSLVKKKGLSECFPAICKFYMVAYCDRSYRVAVGARQGSVALYDVRTGKCQHIHGHKGPITAVSFAPDGRYLATYSNADSHICFWQMNTSLLGSIGMLNSAPQLRCIKTYQVPPVQ 1325          
BLAST of WD repeat-containing protein 7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001298.1 (pep scaffold:Pmarinus_7.0:GL478427:159:27262:-1 gene:ENSPMAG00000001166.1 transcript:ENSPMAT00000001298.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 173.711 bits (439), Expect = 1.739e-44
Identity = 161/670 (24.03%), Postives = 285/670 (42.54%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSIT-TFQKSIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYS-SSIFLIITSCQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCD-NIPNLLVEFPQPENTAS---------FRHKIEIQNQEDVIIIWKGFSNGNIYKWEFTK-----QSKLITQNRFCLDDSWEKITKAPTSLTKS---IQGIDTAGSVTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDSTSN-----YVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
            G + +    LW  +AP H IS+L+    +  +V+GC +G + +W    +  Q+ P   L GH S I+   L+ +S      Y VS S +GE+ L +  +GR +EF  ++ S + I Y +   S +T+   +LC     EI V+++ SL  + TLV   SP+W S++T  F    ++D ++A SVSG + +WN+    +  +  I  ++  ++   I   +   I    ++  S+ L+ TSC + VF      +L      +G+ +  G F++ DS+I+ T  G   +Y+LPP   PES  FR     + D + P  L     P +            F  K    +   +++  +G S G +  W         QS +    R  L   +E     P  +      + G      V S ++I     +V G E+G II+     T        +  S      +  L+GH G V+ LL+P                     L+       L SGGVD+++ +WD+   +M+  F  H   +  L +              +G T  + + V                        +A +  +  +S+ +++ ++  S H  PV+++ W     YL++   + +V+VW + +G +DR   G  A  +++ C
Sbjct:    3 GQTLVIPIVLWGRQAPTHCISTLLLTEDHKTLVTGCYDGQVCLWDVTPD-LQIIPRALLFGHASAIT--CLSRASDGPEEVYIVSASENGEMCLSDVSDGRCLEFTKLACSHIAIHY-YQSTSRHTQTGRLLCYGHYPEILVMDAGSLNILFTLVSKISPDWISAMTMAFSSQAQEDKVIAVSVSGNLKVWNLKH--ISNKLQIGEILHEEESKPIHCTDCQDICFCSFTCRSLLLVSTSC-WMVFDAGDFSVLCSVCSEKGERWSGGKFLTADSVIIWTEEGAASVYRLPPSCLPESKHFRSDVGKVIDSSPPKRLYRITCPPDEQPLICLPVMKYFHGKSSSSSSSQLLV--QGDSMGQLTVWRIPAEQAQHQSDVDMTRRVSLKSHFEVAVPRPAGVIDQLSVVPGCSKPLLVMSSIYIPASGQLVCGREDGSIIIVPATQTAAVQLLHGEHASRRGWPPHRTLRGHEGKVSSLLYPYQ-------------------LSPRYDQRWLLSGGVDFSVILWDIVSGEMLHTFCIHGGEILQLLVP------------PEGCTPRVQHCV----------------------CSVASDHSVG-LSLKERRCIMLASRHLFPVQTVKWRPLDDYLVVGCSDGSVYVWQMENGALDRCVMGISAVQILQGC 609          
BLAST of WD repeat-containing protein 7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010446.1 (pep scaffold:Pmarinus_7.0:GL477237:16696:73623:-1 gene:ENSPMAG00000009456.1 transcript:ENSPMAT00000010446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 163.696 bits (413), Expect = 2.542e-42
Identity = 138/649 (21.26%), Postives = 285/649 (43.91%), Query Frame = 3
Query:  126 IFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEFISNSQMNIQ-YVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQ-KSIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTET-CDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPR---ANPESSFFRKQSLNLCDN--IPNLLVEFPQPENTASFRHKIEIQNQEDVI-----IIWKGFSNGNIYKW----------EFTKQSKLITQN---RFCLDDSWEKITKAPTSLTKSIQGIDTAGSVTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTE--NDSTSNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSG 1988
            I    LW   AP H +SSL+     + +V+GC++G + +W+ +++   +TP   L GH + ++   L  ++   +  Y VS   +G++ LW+  +GR +EF  +  ++ + + +     +  +  +LC    S++ +L++++L  + +L    +PNW ++I+  +     +D+++  SV+GL+ +W  N + V         +   + + ++  +   ++   Y+ S  L++ S  +KV   E  C          G +   G F++ + +++ T  G+G++Y+LP R   A    S F + +    DN  IP +        + A  RH   ++  E        ++ +G S G +  W          + + Q   +T +   R   + +      A T+  +S  G + A   T+L++     L+  G  +G I+V        + F +   D    +  L+GH G V+CLL+P    +                      +  L SG  D+++R+WD+  ++++  FH H+  +T L L                             +N H   + +  C    +  +A +  ++++S+ +++ LL  S H  PV+++ W      LL+   + +++VW + SG
Sbjct:    7 ILPMVLWGLHAPNHCVSSLLLTEDQHTIVTGCQDGQLCLWNLDEDLKVITPRALLFGHLAGVT--CLGRANPLRDHPYVVSCDENGQMCLWDISDGRCVEFRQHPYVHTEMHYYKCPYGSADEGWLLCSGCYSDVLILDALTLKVLGSLASKDAPNWMATISVLRCTRTLEDIVVGVSVAGLLKVW--NLSTVLNNIQDSEPVFEKESMAVDGLDAQAVAFCTYTQSTLLLVCSHIWKVLSLENFCARCCMPRTADGPW-TGGDFLAANKVLVWTSRGQGYIYKLPDRCFSALIRLSPFTRSTYIHADNNLIPPVKHILIDRVDRALVRHTPVLRYAEGRTEPFHKLLLRGDSEGRVDTWLIPDVLVPKHDGSVQKLPVTSSGSLRQAFEGTASDAVAAETA--RSAPGAEHAEERTALVYAVPHGLLACGYSDGCILVYPAAAMALTHFLKGARDIGPGHYALQGHGGAVSCLLYPHEAARRYD-------------------SRWLLSGAADFSVRLWDVLSQELLCAFHPHAGSVTQLLLP---------------------------PDNCH---ETVLRC----VCSVASDHSVALLSLTERRPLLLASRHAFPVQAVRWRAADDLLLVCCSDGSLYVWQMDSG 595          
BLAST of WD repeat-containing protein 7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002038.1 (pep scaffold:Pmarinus_7.0:GL477595:70120:96275:1 gene:ENSPMAG00000001829.1 transcript:ENSPMAT00000002038.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.9821 bits (245), Expect = 2.005e-21
Identity = 91/382 (23.82%), Postives = 177/382 (46.34%), Query Frame = 3
Query: 3207 ERRNLSKIQIKALLNIALVGSH---------LKPDENNDINSDSKL---FSKLFTLDKSFLARITCDFLMSVLSKKPKISKSNIGRLINLSMI-CLSNGFLVWEPYLDSNTVICKFLYFAID----LEDADIDDKLLSLV-----SHKAIEDIASARPLIFVMVCYREMLKWCSISLNTFHNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIYF----YIKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQISNAIF-SLG--GNSHQVKLINSQSIPSLEQM----LTAVKIS 4253
            ERR     Q  A++ + ++G+          L+P +++   S S++   F    +   + LAR TC  L  +L  KP   K +    I  + I  +  GF VWEPY+D + V+   L  + D    L +A     L +       +  A+  IA+ARP  F+    RE+ K  +++ N+                ++ P + S +   K+           ++ +   L +   + + D+L E++++ +Y      +K +        + KF+ VS+     +M VG+  G++ L+D++ GK      HK  I    F+ DGR +A+YS+++N +  WQ++ ++  SLG   ++ Q++ I +  +P L+ +    ++A+K++
Sbjct:  205 ERRK----QATAIVLLGVIGAEFGAEIEPAKLQPGKDSRPRSSSQVPEGFGPTTSGTNNSLARHTCKALTHLL--KPANMKLSAHTPIRRAAIDLIGRGFTVWEPYMDVSAVLLGLLELSADSEKHLGNAMSGFPLTAAADTCRSARHALSLIATARPPAFITTIAREVHKHTALAANS----------------QAQPPVHSGLSRAKSE----------ILRVMEILVEKMPNDVADLLVEVMDIIMYCLDASTLKKKGLQECFPSICKFNMVSYCSTSYRMVVGARHGSVALYDIRTGKCQMIQGHKGPITALAFAPDGRYLATYSSTDNRLAFWQMNTSLLGSLGMLNSAPQLRCIKAMEVPPLQPISPGPMSALKLA 554          
BLAST of WD repeat-containing protein 7 vs. Ensembl Medaka
Match: WDR7 (WD repeat domain 7 [Source:NCBI gene;Acc:101162385])

HSP 1 Score: 179.104 bits (453), Expect = 9.050e-45
Identity = 157/669 (23.47%), Postives = 298/669 (44.54%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQK-SIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVF----YTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCD-NIPNLLVEFPQ---------PENTASFRHKIEIQNQEDVIIIWKGFSNGNIYKWEFTKQS-KLITQNRFCLDDSWEKITKAPTSLTKSIQ---GIDTAGSVTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDST-----SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
            GN+ +    LW   AP H ISSL+ +   + +V+GC +G I +W       Q+ P   L GH + I+   L+ +S +++ +Y VS S  GE+ LW+  +GR IEF  ++ +   IQ+ + F     K+  +LC     EI V+++ SL  + +LV    P+W SS++  +    ++D ++A SV+G++ +W +   +V    ++  V + ++   I       IS   ++ S  L++ S  ++VF    Y+  C + S  D      +  G F++ D +I+ T  G   +Y+LP      S  FR+      + +IP L+ +  +         P  T  F  + E  ++    ++ +G S G +  W     + KL   +   L ++++K+      +   +    G +    VT+ ++I     +V G E+G II+     T      + +         +  L+GHR  VTC+L+P         +++  + +S V            SGGVD+++ VWD+   +M  +F  H   +T L                          +   E  S  ++  +          +A +  + ++S+ ++K ++  S H  P++ + W     YL++   + +V+VW + +G +DR   G  A  ++  C
Sbjct:    3 GNNLVLPIVLWSRTAPTHCISSLLVMDDFSTIVTGCHDGQICLWDMTPE-LQICPRAMLFGHTASIT--CLSKASASSDKQYIVSASESGEMCLWDVNDGRCIEFTKLACAHTGIQF-YQFTIGTEKEGRLLCNGHYPEILVVDATSLEVLYSLVSKICPDWISSMSIIRSHRTQEDTVVAVSVTGILKVWIIT-AEVSKMQDLDPVFE-EESKPIHCQGCQSISFCSFTQSSLLVVCSKYWRVFDAGDYSLLCSVASEND----QSWTGGEFVAADRVIIWTEDGCSCIYKLPASCLSASEHFRRDIGKTKEGSIPPLIYKIAERADKQLLICPPVTRFFFGRREPFHK----LLIQGDSAGRLSLWSVPDATPKLQVSSTISLQEAFDKLKPVSAGIIDQLSVLPGKEEPIKVTASVYIPSQGRLVCGREDGSIILVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCVLYPYQ-------VSARYDQRSLV------------SGGVDFSVIVWDIFTGEMKHIFCVHGGEITQL--------------------------IVPPENCSTRVQHCV--------CSVASDHSVGLLSLRERKCIMLASRHLFPIQVIKWRPADDYLVVGCSDGSVYVWQMDTGALDRCVMGITAVEILNAC 604          

HSP 2 Score: 92.4337 bits (228), Expect = 2.858e-18
Identity = 79/368 (21.47%), Postives = 160/368 (43.48%), Query Frame = 3
Query: 3195 NTDHERRNLSKIQIKALLNIALVGSHLKPDENNDINSDSKLFSKLFTLDKSF-----LARITCDFLMSVL--SKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLEDADIDDKLLSLV----------SHKAIEDIASARPLIFVMVCYREMLKWCSISLNTFHNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIYF----YIKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQISNAIFSLGG---NSHQVKLINSQSIPSLE 4226
            N+  ERR  +   +   +  A  G+ ++P + +       L  + F           LAR TC  L  +L     PK+   +  R   + +I    GF VWEPY+D + V+   L    D E   + +  + L           +  A+  IA+ARP  F+    RE+ +  +   N+    +  +T  T+ R K+                        ++ + + L +     ++D+L E++++ +Y      +K +        + KF  V + +   +++VG+ +G++ L+D++ GK  +   HK  I    F+ DGR +A+YS +++ +  WQ++ ++    G   ++ Q++ I +  +P ++
Sbjct: 1029 NSYEERRKQATAIVLLGVIGAEFGAEIEPPKGSGRARPGGLVPEGFGPTSGASSNYSLARHTCKALTFLLLQPPSPKLPAHSTIRRTAIDLI--GRGFTVWEPYMDVSAVLMGLLELCADAEK-QLGNVSMGLPLNPPADSARSARHALSLIATARPPAFITTIAREVHRHNAAQANSQSQQNVHTT--TLARAKAE-----------------------ILRVIDILIEKMPGDVVDLLVEVMDIIMYCIEGSLVKKKGLQECFPAICKFYMVGYCDRSHRIAVGARQGSVALYDVRTGKCQNIHGHKGPITAVSFAPDGRYLATYSNADSHISFWQMNTSLLGQIGMLNSAPQLRCIKTYQVPPVQ 1368          
BLAST of WD repeat-containing protein 7 vs. Ensembl Medaka
Match: WDR7 (WD repeat domain 7 [Source:NCBI gene;Acc:101162385])

HSP 1 Score: 173.711 bits (439), Expect = 4.102e-43
Identity = 157/677 (23.19%), Postives = 296/677 (43.72%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQK-SIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVF----YTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCD-NIPNLLVEFPQ---------PENTASFRHKIEIQNQEDVIIIWKGFSNGNIYKWEFTKQ---------SKLITQNRFCLDDSWEKITKAPTSLTKSIQ---GIDTAGSVTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDST-----SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
            GN+ +    LW   AP H ISSL+ +   + +V+GC +G I +W       Q+ P   L GH + I+   L+ +S +++ +Y VS S  GE+ LW+  +GR IEF  ++ +   IQ+ + F     K+  +LC     EI V+++ SL  + +LV    P+W SS++  +    ++D ++A SV+G++ +W +   +V    ++  V + ++   I       IS   ++ S  L++ S  ++VF    Y+  C + S  D      +  G F++ D +I+ T  G   +Y+LP      S  FR+      + +IP L+ +  +         P  T  F  + E  ++    ++ +G S G +  W              ++L   +   L ++++K+      +   +    G +    VT+ ++I     +V G E+G II+     T      + +         +  L+GHR  VTC+L+P                  QV     + +  L SGGVD+++ VWD+   +M  +F  H   +T L                          +   E  S  ++  +          +A +  + ++S+ ++K ++  S H  P++ + W     YL++   + +V+VW + +G +DR   G  A  ++  C
Sbjct:    3 GNNLVLPIVLWSRTAPTHCISSLLVMDDFSTIVTGCHDGQICLWDMTPE-LQICPRAMLFGHTASIT--CLSKASASSDKQYIVSASESGEMCLWDVNDGRCIEFTKLACAHTGIQF-YQFTIGTEKEGRLLCNGHYPEILVVDATSLEVLYSLVSKICPDWISSMSIIRSHRTQEDTVVAVSVTGILKVWIIT-AEVSKMQDLDPVFE-EESKPIHCQGCQSISFCSFTQSSLLVVCSKYWRVFDAGDYSLLCSVASEND----QSWTGGEFVAADRVIIWTEDGCSCIYKLPASCLSASEHFRRDIGKTKEGSIPPLIYKIAERADKQLLICPPVTRFFFGRREPFHK----LLIQGDSAGRLSLWSVPDATPSRTAATCTELQVSSTISLQEAFDKLKPVSAGIIDQLSVLPGKEEPIKVTASVYIPSQGRLVCGREDGSIILVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCVLYP-----------------YQVSARYDQRS--LVSGGVDFSVIVWDIFTGEMKHIFCVHGGEITQL--------------------------IVPPENCSTRVQHCV--------CSVASDHSVGLLSLRERKCIMLASRHLFPIQVIKWRPADDYLVVGCSDGSVYVWQMDTGALDRCVMGITAVEILNAC 612          

HSP 2 Score: 92.4337 bits (228), Expect = 2.703e-18
Identity = 79/368 (21.47%), Postives = 160/368 (43.48%), Query Frame = 3
Query: 3195 NTDHERRNLSKIQIKALLNIALVGSHLKPDENNDINSDSKLFSKLFTLDKSF-----LARITCDFLMSVL--SKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLEDADIDDKLLSLV----------SHKAIEDIASARPLIFVMVCYREMLKWCSISLNTFHNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIYF----YIKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQISNAIFSLGG---NSHQVKLINSQSIPSLE 4226
            N+  ERR  +   +   +  A  G+ ++P + +       L  + F           LAR TC  L  +L     PK+   +  R   + +I    GF VWEPY+D + V+   L    D E   + +  + L           +  A+  IA+ARP  F+    RE+ +  +   N+    +  +T  T+ R K+                        ++ + + L +     ++D+L E++++ +Y      +K +        + KF  V + +   +++VG+ +G++ L+D++ GK  +   HK  I    F+ DGR +A+YS +++ +  WQ++ ++    G   ++ Q++ I +  +P ++
Sbjct: 1073 NSYEERRKQATAIVLLGVIGAEFGAEIEPPKGSGRARPGGLVPEGFGPTSGASSNYSLARHTCKALTFLLLQPPSPKLPAHSTIRRTAIDLI--GRGFTVWEPYMDVSAVLMGLLELCADAEK-QLGNVSMGLPLNPPADSARSARHALSLIATARPPAFITTIAREVHRHNAAQANSQSQQNVHTT--TLARAKAE-----------------------ILRVIDILIEKMPGDVVDLLVEVMDIIMYCIEGSLVKKKGLQECFPAICKFYMVGYCDRSHRIAVGARQGSVALYDVRTGKCQNIHGHKGPITAVSFAPDGRYLATYSNADSHISFWQMNTSLLGQIGMLNSAPQLRCIKTYQVPPVQ 1412          
BLAST of WD repeat-containing protein 7 vs. Ensembl Medaka
Match: WDR7 (WD repeat domain 7 [Source:NCBI gene;Acc:101162385])

HSP 1 Score: 173.711 bits (439), Expect = 4.171e-43
Identity = 157/677 (23.19%), Postives = 296/677 (43.72%), Query Frame = 3
Query:  114 GNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEF--ISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQK-SIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVF----YTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCD-NIPNLLVEFPQ---------PENTASFRHKIEIQNQEDVIIIWKGFSNGNIYKWEFTKQ---------SKLITQNRFCLDDSWEKITKAPTSLTKSIQ---GIDTAGSVTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDST-----SNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENC 2042
            GN+ +    LW   AP H ISSL+ +   + +V+GC +G I +W       Q+ P   L GH + I+   L+ +S +++ +Y VS S  GE+ LW+  +GR IEF  ++ +   IQ+ + F     K+  +LC     EI V+++ SL  + +LV    P+W SS++  +    ++D ++A SV+G++ +W +   +V    ++  V + ++   I       IS   ++ S  L++ S  ++VF    Y+  C + S  D      +  G F++ D +I+ T  G   +Y+LP      S  FR+      + +IP L+ +  +         P  T  F  + E  ++    ++ +G S G +  W              ++L   +   L ++++K+      +   +    G +    VT+ ++I     +V G E+G II+     T      + +         +  L+GHR  VTC+L+P                  QV     + +  L SGGVD+++ VWD+   +M  +F  H   +T L                          +   E  S  ++  +          +A +  + ++S+ ++K ++  S H  P++ + W     YL++   + +V+VW + +G +DR   G  A  ++  C
Sbjct:    3 GNNLVLPIVLWSRTAPTHCISSLLVMDDFSTIVTGCHDGQICLWDMTPE-LQICPRAMLFGHTASIT--CLSKASASSDKQYIVSASESGEMCLWDVNDGRCIEFTKLACAHTGIQF-YQFTIGTEKEGRLLCNGHYPEILVVDATSLEVLYSLVSKICPDWISSMSIIRSHRTQEDTVVAVSVTGILKVWIIT-AEVSKMQDLDPVFE-EESKPIHCQGCQSISFCSFTQSSLLVVCSKYWRVFDAGDYSLLCSVASEND----QSWTGGEFVAADRVIIWTEDGCSCIYKLPASCLSASEHFRRDIGKTKEGSIPPLIYKIAERADKQLLICPPVTRFFFGRREPFHK----LLIQGDSAGRLSLWSVPDATPSRTAATCTELQVSSTISLQEAFDKLKPVSAGIIDQLSVLPGKEEPIKVTASVYIPSQGRLVCGREDGSIILVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCVLYP-----------------YQVSARYDQRS--LVSGGVDFSVIVWDIFTGEMKHIFCVHGGEITQL--------------------------IVPPENCSTRVQHCV--------CSVASDHSVGLLSLRERKCIMLASRHLFPIQVIKWRPADDYLVVGCSDGSVYVWQMDTGALDRCVMGITAVEILNAC 612          

HSP 2 Score: 92.4337 bits (228), Expect = 2.555e-18
Identity = 79/368 (21.47%), Postives = 160/368 (43.48%), Query Frame = 3
Query: 3195 NTDHERRNLSKIQIKALLNIALVGSHLKPDENNDINSDSKLFSKLFTLDKSF-----LARITCDFLMSVL--SKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLEDADIDDKLLSLV----------SHKAIEDIASARPLIFVMVCYREMLKWCSISLNTFHNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIYF----YIKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQISNAIFSLGG---NSHQVKLINSQSIPSLE 4226
            N+  ERR  +   +   +  A  G+ ++P + +       L  + F           LAR TC  L  +L     PK+   +  R   + +I    GF VWEPY+D + V+   L    D E   + +  + L           +  A+  IA+ARP  F+    RE+ +  +   N+    +  +T  T+ R K+                        ++ + + L +     ++D+L E++++ +Y      +K +        + KF  V + +   +++VG+ +G++ L+D++ GK  +   HK  I    F+ DGR +A+YS +++ +  WQ++ ++    G   ++ Q++ I +  +P ++
Sbjct: 1117 NSYEERRKQATAIVLLGVIGAEFGAEIEPPKGSGRARPGGLVPEGFGPTSGASSNYSLARHTCKALTFLLLQPPSPKLPAHSTIRRTAIDLI--GRGFTVWEPYMDVSAVLMGLLELCADAEK-QLGNVSMGLPLNPPADSARSARHALSLIATARPPAFITTIAREVHRHNAAQANSQSQQNVHTT--TLARAKAE-----------------------ILRVIDILIEKMPGDVVDLLVEVMDIIMYCIEGSLVKKKGLQECFPAICKFYMVGYCDRSHRIAVGARQGSVALYDVRTGKCQNIHGHKGPITAVSFAPDGRYLATYSNADSHISFWQMNTSLLGQIGMLNSAPQLRCIKTYQVPPVQ 1456          
BLAST of WD repeat-containing protein 7 vs. Planmine SMEST
Match: SMESG000032157.1 (SMESG000032157.1)

HSP 1 Score: 2711.79 bits (7028), Expect = 0.000e+0
Identity = 1425/1425 (100.00%), Postives = 1425/1425 (100.00%), Query Frame = 3
Query:  102 MTEIGNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEFISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQKSIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCDNIPNLLVEFPQPENTASFRHKIEIQNQEDVIIIWKGFSNGNIYKWEFTKQSKLITQNRFCLDDSWEKITKAPTSLTKSIQGIDTAGSVTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDSTSNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENCPLITKLRSKTSNLLYSSKSVRRHXXXXXXXXXXXXXXXXXXXXXRSQFIHSGSFTRLVPVLIVNISTXXXXXXXXXXXXXXXXXXXXXVEXXXXXXXXXXXXXXXXXVSELDLLMDDVKTDKHNFNXXXXXXXXXXSMTSLSKFNFSFSPIAFNSDRISWSVGQVNSKTGCIGFDLKSLFQDHNPETSLSVENMLIQLXXXXXXXXXXXXALYDPFLNIYFKNDKNENSNHFSKASRSNSCGYQLTDPHGSSFSTVKSFKIHRKKILNKLLMDLLNSFEGEIDDLSFNVLEKIFNRLIVGILDICDTISKSALQLLARVIDNLKDQQIQNYILIWRSFLSPNMDNYCLEDGRTFLNKIQPFLDKFIEFSYFSSDWIWWFSIDQINTDHERRNLSKIQIKALLNIALVGSHLKPDENNDINSDSKLFSKLFTLDKSFLARITCDFLMSVLSKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLEDADIDDKLLSLVSHKAIEDIASARPLIFVMVCYREMLKWCSISLNTFHNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIYFYIKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQISNAIFSLGGNSHQVKLINSQSIPSLEQMLTAVKISSKYMTVDHLLDKDCDIYLEWDSDNKTLYIKINAAVLRQIKL 4376
            MTEIGNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEFISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQKSIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCDNIPNLLVEFPQPENTASFRHKIEIQNQEDVIIIWKGFSNGNIYKWEFTKQSKLITQNRFCLDDSWEKITKAPTSLTKSIQGIDTAGSVTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDSTSNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENCPLITKLRSKTSNLLYSSKSVRRHSLSNIIISDSSSSHGSNNKLLRSQFIHSGSFTRLVPVLIVNISTLLDSLNSCNNISNSICDILDDVESSLSLKNNNKSHKKRKSVSELDLLMDDVKTDKHNFNLKILLIKIILSMTSLSKFNFSFSPIAFNSDRISWSVGQVNSKTGCIGFDLKSLFQDHNPETSLSVENMLIQLSISNKIISFSKSALYDPFLNIYFKNDKNENSNHFSKASRSNSCGYQLTDPHGSSFSTVKSFKIHRKKILNKLLMDLLNSFEGEIDDLSFNVLEKIFNRLIVGILDICDTISKSALQLLARVIDNLKDQQIQNYILIWRSFLSPNMDNYCLEDGRTFLNKIQPFLDKFIEFSYFSSDWIWWFSIDQINTDHERRNLSKIQIKALLNIALVGSHLKPDENNDINSDSKLFSKLFTLDKSFLARITCDFLMSVLSKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLEDADIDDKLLSLVSHKAIEDIASARPLIFVMVCYREMLKWCSISLNTFHNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIYFYIKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQISNAIFSLGGNSHQVKLINSQSIPSLEQMLTAVKISSKYMTVDHLLDKDCDIYLEWDSDNKTLYIKINAAVLRQIKL
Sbjct:    1 MTEIGNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWEAKEGRNIEFISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQKSIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTETCDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSFFRKQSLNLCDNIPNLLVEFPQPENTASFRHKIEIQNQEDVIIIWKGFSNGNIYKWEFTKQSKLITQNRFCLDDSWEKITKAPTSLTKSIQGIDTAGSVTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDSTSNYVILKGHRGPVTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENCPLITKLRSKTSNLLYSSKSVRRHSLSNIIISDSSSSHGSNNKLLRSQFIHSGSFTRLVPVLIVNISTLLDSLNSCNNISNSICDILDDVESSLSLKNNNKSHKKRKSVSELDLLMDDVKTDKHNFNLKILLIKIILSMTSLSKFNFSFSPIAFNSDRISWSVGQVNSKTGCIGFDLKSLFQDHNPETSLSVENMLIQLSISNKIISFSKSALYDPFLNIYFKNDKNENSNHFSKASRSNSCGYQLTDPHGSSFSTVKSFKIHRKKILNKLLMDLLNSFEGEIDDLSFNVLEKIFNRLIVGILDICDTISKSALQLLARVIDNLKDQQIQNYILIWRSFLSPNMDNYCLEDGRTFLNKIQPFLDKFIEFSYFSSDWIWWFSIDQINTDHERRNLSKIQIKALLNIALVGSHLKPDENNDINSDSKLFSKLFTLDKSFLARITCDFLMSVLSKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLEDADIDDKLLSLVSHKAIEDIASARPLIFVMVCYREMLKWCSISLNTFHNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIYFYIKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQISNAIFSLGGNSHQVKLINSQSIPSLEQMLTAVKISSKYMTVDHLLDKDCDIYLEWDSDNKTLYIKINAAVLRQIKL 1425          
BLAST of WD repeat-containing protein 7 vs. Planmine SMEST
Match: SMESG000002835.1 (SMESG000002835.1)

HSP 1 Score: 194.126 bits (492), Expect = 1.264e-49
Identity = 171/686 (24.93%), Postives = 309/686 (45.04%), Query Frame = 3
Query:  102 MTEIGNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFE--YFVSFSIDGEIALWEAKEGRNIEFISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQKSIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVF----YTETCDIL-SYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRAN-PESSFFRKQSLNLCDNIPNLLVEFPQPENTASFRHKIEIQNQEDVIIIWKGFSNGNIYKWEF----------TKQSKLITQNRFCLDDSWEKITKAPTSLTKSIQGIDTAGSVTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTEND-STSNYVILKGHRGPVTCLLH---PSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMN-------AFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENCPLITKLRSKT 2072
            M  +  +    F L+ N  P H I+S + +  N F+V+G E G ++IW  N + D ++   YL+GH SKI +     +S + +FE    V+FS   EIA+W   +GR I F     +   Y  S++ A+    L+LCC K   I +L++++L    +L     PNW  SI  F+      V+L  SV G   +W ++  D   +  I  + + +  + +E  +P  IS  P      L+ +    +++    +T  C ++ S + C++   FID       +I++ T+ G  +LYQLP   + P       QS++L +    LL      ++  +    + I     + ++W G  NG I  W++               +   + F L+  W+   K   S+T     +     VT   F+  ++ ++LGMENG I++ ++   + + F +   S+  + +L+GHR  +  LL+   P    K                         +WSG  DY++R+W+ + EK + +F+CHS P+  +      + S +      G T A +      ++N  ++++ +   +N          V    ++GI+ +S+  Q+++L    + S + S+ W  D     +E  + +V +W+L +  MDR  SG  A+ L+E     T LR  T
Sbjct:    1 MDALSGNCCIPFGLFGNSNPDHKITS-VEIIDNEFIVTGDEIGQVLIWKMNTSAD-VSICWYLVGHSSKILNICSIPNSED-DFENRCCVTFSTSKEIAVWNCVDGRCIRFDRQVALEHLYAMSYKPASRGSSLLLCCGKYPGIMLLDALTLKSTISLKSRGYPNWIQSICAFEHHQSVHVVLGLSVVGAAILWTIDNLDRSVELQI--IYETESRMLLELISPVMISMCPTKPRFVLVTSPNVIQIYDAANWTVFCQLIASPKSCFQAGKFIDS-----KTIMLQTKDGNIYLYQLPISLDVPLECRGESQSIDLIE--IGLLGTLADNDHCTT----MNITQGGKLTVVW-GHGNGMIKLWQYQLDGNNGTDKVVNGDICASSSFSLEKQWKH--KKYLSITDLFSHL---WKVTCCHFVRSINCLILGMENGDIVISDMLHMICATFFQTQISSVLHRVLRGHRLAILSLLYEEIPQEDKK--------------------STWQWIWSGSADYSVRLWEFQSEKCLRIFYCHSGPVKCI------IKSPIL-----GLTKAKYEGHIRAQKNKENVEREVLKPINFSSWIGPHVYVSADTDNGIAFLSLETQRIVLKVQCN-SEIVSISWKKDHILSYLECADGSVTIWELGASCMDRCISGQLARDLLEGSSNRTLLRHMT 632          

HSP 2 Score: 144.436 bits (363), Expect = 2.348e-34
Identity = 144/551 (26.13%), Postives = 257/551 (46.64%), Query Frame = 3
Query: 2838 ILNKLLMDLLNSFEGEID-DLSFNVLEKIFNRLIVGILDICDTISKSALQLLARVIDNLKDQQ---------IQNYILIWRSFLSPNMDNYCLEDGRTF-LNKIQPFLDKFIEFSYFSSDWIWWFSIDQINTDHERRNLSKIQIKALLNIALVGSHL-KPDENNDINSD--SKLFSKL----------FTLDKSFLARITCDFLMSVLSKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYF---AIDLEDADIDDKLLS------LVSHKAIEDIASARPLIFVMVCYREMLKWCSISLNTFHNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIY----FYIKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQI-SNAIFSLGGNSHQVKLINSQSIPSLEQMLTAVKISSKYMTVDHLLDKDCDIYLEWDSDNKTLYIKINAAVLRQIKL 4376
            ++  +L +LL  + G I   L  ++++ +  + +    D C  I ++A  L    +D L  +Q         IQ+ IL +   +SP       E  R F  + +    D  +   +  S WI       +   ++   +S++Q+  +  +A+VGS     D ++ + S+  S +  K           F ++   LARITC  LM +L   P    ++   +  L++  L  GF VWEPYL+  T+  K L     +I         +LL+           A+  IA +RP +F  V   E+LK   + + T  N +S      I    STP   S       ++P  L  R+ +V I   LC+ ++ ++ +V PE++++ +       ++  D      P+L F   S +   G++ VG+  G++  +D+K+GKY ++  HK ++    FS DG+ VASYS  +NSV IWQ+ S+ +F + G+SHQVKL +  ++P +    T  +  S  +           ++LEW  +N+++++  NA ++ +IKL
Sbjct:  822 LVTSVLPNLL--YSGNISLPLRVSIIQLVLQQFLKKYQDRCLEIREAARTLFHASMDCLTIEQRIEVVQRWVIQSRILEYSGDVSP-------EKVRDFQRSSMSSIHDMPVISDWRGSGWI-------LGELYDLNEISRMQVITIAFLAVVGSRYGSTDASSPLGSNTVSPVVGKRQLAKEKTIPGFGIEDYRLARITCGHLMRLLVYVPH-GNTSWPEMRRLAISLLGQGFPVWEPYLEIGTLFNKLLEIVSGSIKTIGGWSQGQLLTDEMDACRAGKSALLSIALSRPKVFATVLSIEVLK---LQVQTVPNSNS---PIQISNGVSTPR--SFASPPNQSQPPLLAARHEVVDIITVLCERKTREMHEVFPEIMDILLACLNKLDLRQYDLQQLFPPILLFRIASSHTASGKVCVGTRTGHVVFYDVKLGKYNTSPGHKSAVTSVTFSPDGKQVASYSMPDNSVCIWQLFSSGLFGM-GSSHQVKLASHLNVPPVAVSQTVSEEDSSLL-----------LWLEW-YENRSIHLVTNAGLVNKIKL 1334          
BLAST of WD repeat-containing protein 7 vs. Planmine SMEST
Match: SMESG000002835.1 (SMESG000002835.1)

HSP 1 Score: 192.971 bits (489), Expect = 3.361e-49
Identity = 172/686 (25.07%), Postives = 308/686 (44.90%), Query Frame = 3
Query:  102 MTEIGNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFE--YFVSFSIDGEIALWEAKEGRNIEFISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQKSIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVF----YTETCD-ILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRAN-PESSFFRKQSLNLCDNIPNLLVEFPQPENTASFRHKIEIQNQEDVIIIWKGFSNGNIYKWEF----------TKQSKLITQNRFCLDDSWEKITKAPTSLTKSIQGIDTAGSVTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTEND-STSNYVILKGHRGPVTCLLH---PSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMN-------AFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENCPLITKLRSKT 2072
            M  +  +    F L+ N  P H I+S + +  N F+V+G E G ++IW  N + D ++   YL+GH SKI +     +S + +FE    V+FS   EIA+W   +GR I F     +   Y  S++ A+    L+LCC K   I +L++++L    +L     PNW  SI  F+      V+L  SV G   +W ++  D   +  I  + + +  + +E  +P  IS  P      L+ +    +++    +T  C  I S + C++      G FI   +I++ T+ G  +LYQLP   + P       QS++L +    LL      ++  +    + I     + ++W G  NG I  W++               +   + F L+  W+   K   S+T     +     VT   F+  ++ ++LGMENG I++ ++   + + F +   S+  + +L+GHR  +  LL+   P    K                         +WSG  DY++R+W+ + EK + +F+CHS P+  +      + S +      G T A +      ++N  ++++ +   +N          V    ++GI+ +S+  Q+++L    + S + S+ W  D     +E  + +V +W+L +  MDR  SG  A+ L+E     T LR  T
Sbjct:    1 MDALSGNCCIPFGLFGNSNPDHKITS-VEIIDNEFIVTGDEIGQVLIWKMNTSAD-VSICWYLVGHSSKILNICSIPNSED-DFENRCCVTFSTSKEIAVWNCVDGRCIRFDRQVALEHLYAMSYKPASRGSSLLLCCGKYPGIMLLDALTLKSTISLKSRGYPNWIQSICAFEHHQSVHVVLGLSVVGAAILWTIDNLDRSVELQI--IYETESRMLLELISPVMISMCPTKPRFVLVTSPNVIQIYDAANWTVFCQLIASPKSCFQA-----GKFIDSKTIMLQTKDGNIYLYQLPISLDVPLECRGESQSIDLIEI--GLLGTLADNDHCTT----MNITQGGKLTVVW-GHGNGMIKLWQYQLDGNNGTDKVVNGDICASSSFSLEKQWKH--KKYLSITDLFSHL---WKVTCCHFVRSINCLILGMENGDIVISDMLHMICATFFQTQISSVLHRVLRGHRLAILSLLYEEIPQEDKK--------------------STWQWIWSGSADYSVRLWEFQSEKCLRIFYCHSGPVKCI------IKSPIL-----GLTKAKYEGHIRAQKNKENVEREVLKPINFSSWIGPHVYVSADTDNGIAFLSLETQRIVLKVQCN-SEIVSISWKKDHILSYLECADGSVTIWELGASCMDRCISGQLARDLLEGSSNRTLLRHMT 632          

HSP 2 Score: 140.969 bits (354), Expect = 3.225e-33
Identity = 142/546 (26.01%), Postives = 253/546 (46.34%), Query Frame = 3
Query: 2838 ILNKLLMDLLNSFEGEID-DLSFNVLEKIFNRLIVGILDICDTISKSALQLLARVIDNLKDQQ---------IQNYILIWRSFLSPNMDNYCLEDGRTF-LNKIQPFLDKFIEFSYFSSDWIWWFSIDQINTDHERRNLSKIQIKALLNIALVGSHL-KPDENNDINSD--SKLFSKL----------FTLDKSFLARITCDFLMSVLSKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYF---AIDLEDADIDDKLLS------LVSHKAIEDIASARPLIFVMVCYREMLKWCSISLNTFHNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIY----FYIKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQI-SNAIFSLGGNSHQVKLINSQSIPSLEQMLTAVKISSKYMTVDHLLDKDCDIYLEWDSDNKTLYIKINAAVL 4361
            ++  +L +LL  + G I   L  ++++ +  + +    D C  I ++A  L    +D L  +Q         IQ+ IL +   +SP       E  R F  + +    D  +   +  S WI       +   ++   +S++Q+  +  +A+VGS     D ++ + S+  S +  K           F ++   LARITC  LM +L   P    ++   +  L++  L  GF VWEPYL+  T+  K L     +I         +LL+           A+  IA +RP +F  V   E+LK   + + T  N +S      I    STP   S       ++P  L  R+ +V I   LC+ ++ ++ +V PE++++ +       ++  D      P+L F   S +   G++ VG+  G++  +D+K+GKY ++  HK ++    FS DG+ VASYS  +NSV IWQ+ S+ +F + G+SHQVKL +  ++P +    T  +  S  +           ++LEW  +N+++++  NA +L
Sbjct:  822 LVTSVLPNLL--YSGNISLPLRVSIIQLVLQQFLKKYQDRCLEIREAARTLFHASMDCLTIEQRIEVVQRWVIQSRILEYSGDVSP-------EKVRDFQRSSMSSIHDMPVISDWRGSGWI-------LGELYDLNEISRMQVITIAFLAVVGSRYGSTDASSPLGSNTVSPVVGKRQLAKEKTIPGFGIEDYRLARITCGHLMRLLVYVPH-GNTSWPEMRRLAISLLGQGFPVWEPYLEIGTLFNKLLEIVSGSIKTIGGWSQGQLLTDEMDACRAGKSALLSIALSRPKVFATVLSIEVLK---LQVQTVPNSNS---PIQISNGVSTPR--SFASPPNQSQPPLLAARHEVVDIITVLCERKTREMHEVFPEIMDILLACLNKLDLRQYDLQQLFPPILLFRIASSHTASGKVCVGTRTGHVVFYDVKLGKYNTSPGHKSAVTSVTFSPDGKQVASYSMPDNSVCIWQLFSSGLFGM-GSSHQVKLASHLNVPPVAVSQTVSEEDSSLL-----------LWLEW-YENRSIHLVTNAGLL 1329          
BLAST of WD repeat-containing protein 7 vs. Planmine SMEST
Match: SMESG000002835.1 (SMESG000002835.1)

HSP 1 Score: 192.971 bits (489), Expect = 3.534e-49
Identity = 172/686 (25.07%), Postives = 308/686 (44.90%), Query Frame = 3
Query:  102 MTEIGNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQNKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFE--YFVSFSIDGEIALWEAKEGRNIEFISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSLAHICTLVCTSSPNWFSSITTFQKSIKDDVILATSVSGLISIWNVNFTDVFTQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVF----YTETCD-ILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRAN-PESSFFRKQSLNLCDNIPNLLVEFPQPENTASFRHKIEIQNQEDVIIIWKGFSNGNIYKWEF----------TKQSKLITQNRFCLDDSWEKITKAPTSLTKSIQGIDTAGSVTSLLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTEND-STSNYVILKGHRGPVTCLLH---PSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVWDMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVNDDEENSHDIKQMINMCMN-------AFMVGIAENDGISIISIMKQKVLLFTSDHKSPVRSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENCPLITKLRSKT 2072
            M  +  +    F L+ N  P H I+S + +  N F+V+G E G ++IW  N + D ++   YL+GH SKI +     +S + +FE    V+FS   EIA+W   +GR I F     +   Y  S++ A+    L+LCC K   I +L++++L    +L     PNW  SI  F+      V+L  SV G   +W ++  D   +  I  + + +  + +E  +P  IS  P      L+ +    +++    +T  C  I S + C++      G FI   +I++ T+ G  +LYQLP   + P       QS++L +    LL      ++  +    + I     + ++W G  NG I  W++               +   + F L+  W+   K   S+T     +     VT   F+  ++ ++LGMENG I++ ++   + + F +   S+  + +L+GHR  +  LL+   P    K                         +WSG  DY++R+W+ + EK + +F+CHS P+  +      + S +      G T A +      ++N  ++++ +   +N          V    ++GI+ +S+  Q+++L    + S + S+ W  D     +E  + +V +W+L +  MDR  SG  A+ L+E     T LR  T
Sbjct:    1 MDALSGNCCIPFGLFGNSNPDHKITS-VEIIDNEFIVTGDEIGQVLIWKMNTSAD-VSICWYLVGHSSKILNICSIPNSED-DFENRCCVTFSTSKEIAVWNCVDGRCIRFDRQVALEHLYAMSYKPASRGSSLLLCCGKYPGIMLLDALTLKSTISLKSRGYPNWIQSICAFEHHQSVHVVLGLSVVGAAILWTIDNLDRSVELQI--IYETESRMLLELISPVMISMCPTKPRFVLVTSPNVIQIYDAANWTVFCQLIASPKSCFQA-----GKFIDSKTIMLQTKDGNIYLYQLPISLDVPLECRGESQSIDLIEI--GLLGTLADNDHCTT----MNITQGGKLTVVW-GHGNGMIKLWQYQLDGNNGTDKVVNGDICASSSFSLEKQWKH--KKYLSITDLFSHL---WKVTCCHFVRSINCLILGMENGDIVISDMLHMICATFFQTQISSVLHRVLRGHRLAILSLLYEEIPQEDKK--------------------STWQWIWSGSADYSVRLWEFQSEKCLRIFYCHSGPVKCI------IKSPIL-----GLTKAKYEGHIRAQKNKENVEREVLKPINFSSWIGPHVYVSADTDNGIAFLSLETQRIVLKVQCN-SEIVSISWKKDHILSYLECADGSVTIWELGASCMDRCISGQLARDLLEGSSNRTLLRHMT 632          

HSP 2 Score: 139.428 bits (350), Expect = 1.013e-32
Identity = 141/545 (25.87%), Postives = 252/545 (46.24%), Query Frame = 3
Query: 2838 ILNKLLMDLLNSFEGEID-DLSFNVLEKIFNRLIVGILDICDTISKSALQLLARVIDNLKDQQ---------IQNYILIWRSFLSPNMDNYCLEDGRTF-LNKIQPFLDKFIEFSYFSSDWIWWFSIDQINTDHERRNLSKIQIKALLNIALVGSHL-KPDENNDINSD--SKLFSKL----------FTLDKSFLARITCDFLMSVLSKKPKISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYF---AIDLEDADIDDKLLS------LVSHKAIEDIASARPLIFVMVCYREMLKWCSISLNTFHNLSSMSTSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKILDVLPELVELYIY----FYIKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKGNLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQI-SNAIFSLGGNSHQVKLINSQSIPSLEQMLTAVKISSKYMTVDHLLDKDCDIYLEWDSDNKTLYIKINAAV 4358
            ++  +L +LL  + G I   L  ++++ +  + +    D C  I ++A  L    +D L  +Q         IQ+ IL +   +SP       E  R F  + +    D  +   +  S WI       +   ++   +S++Q+  +  +A+VGS     D ++ + S+  S +  K           F ++   LARITC  LM +L   P    ++   +  L++  L  GF VWEPYL+  T+  K L     +I         +LL+           A+  IA +RP +F  V   E+LK   + + T  N +S      I    STP   S       ++P  L  R+ +V I   LC+ ++ ++ +V PE++++ +       ++  D      P+L F   S +   G++ VG+  G++  +D+K+GKY ++  HK ++    FS DG+ VASYS  +NSV IWQ+ S+ +F + G+SHQVKL +  ++P +    T  +  S  +           ++LEW  +N+++++  NA +
Sbjct:  822 LVTSVLPNLL--YSGNISLPLRVSIIQLVLQQFLKKYQDRCLEIREAARTLFHASMDCLTIEQRIEVVQRWVIQSRILEYSGDVSP-------EKVRDFQRSSMSSIHDMPVISDWRGSGWI-------LGELYDLNEISRMQVITIAFLAVVGSRYGSTDASSPLGSNTVSPVVGKRQLAKEKTIPGFGIEDYRLARITCGHLMRLLVYVPH-GNTSWPEMRRLAISLLGQGFPVWEPYLEIGTLFNKLLEIVSGSIKTIGGWSQGQLLTDEMDACRAGKSALLSIALSRPKVFATVLSIEVLK---LQVQTVPNSNS---PIQISNGVSTPR--SFASPPNQSQPPLLAARHEVVDIITVLCERKTREMHEVFPEIMDILLACLNKLDLRQYDLQQLFPPILLFRIASSHTASGKVCVGTRTGHVVFYDVKLGKYNTSPGHKSAVTSVTFSPDGKQVASYSMPDNSVCIWQLFSSGLFGM-GSSHQVKLASHLNVPPVAVSQTVSEEDSSLL-----------LWLEW-YENRSIHLVTNAGL 1328          
The following BLAST results are available for this feature:
BLAST of WD repeat-containing protein 7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR73.915e-4723.63WD repeat domain 7 [Source:HGNC Symbol;Acc:HGNC:13... [more]
WDR74.743e-4723.63WD repeat domain 7 [Source:HGNC Symbol;Acc:HGNC:13... [more]
WDR727.208e-3320.69WD repeat domain 72 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR722.073e-3220.69WD repeat domain 72 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR722.073e-3220.69WD repeat domain 72 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of WD repeat-containing protein 7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rbc-24.101e-1822.59RaBConnectin related [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of WD repeat-containing protein 7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Rbcn-3B1.926e-3822.57gene:FBgn0023510 transcript:FBtr0070316[more]
Rbcn-3B1.926e-3822.57gene:FBgn0023510 transcript:FBtr0344155[more]
back to top
BLAST of WD repeat-containing protein 7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CABZ01045062.17.375e-4323.35WD repeat domain 7 [Source:NCBI gene;Acc:572502][more]
CABZ01045062.12.217e-4223.23WD repeat domain 7 [Source:NCBI gene;Acc:572502][more]
CABZ01045062.15.171e-4125.09WD repeat domain 7 [Source:NCBI gene;Acc:572502][more]
CABZ01045062.11.064e-3825.09WD repeat domain 7 [Source:NCBI gene;Acc:572502][more]
CABZ01073424.11.635e-826.21pep chromosome:GRCz11:21:2721752:2738317:1 gene:EN... [more]
back to top
BLAST of WD repeat-containing protein 7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr71.386e-4624.26WD repeat domain 7 [Source:NCBI gene;Acc:100036723... [more]
wdr71.391e-4624.26WD repeat domain 7 [Source:NCBI gene;Acc:100036723... [more]
wdr71.593e-4624.26WD repeat domain 7 [Source:NCBI gene;Acc:100036723... [more]
wdr71.826e-4624.26WD repeat domain 7 [Source:NCBI gene;Acc:100036723... [more]
wdr72.728e-4624.17WD repeat domain 7 [Source:NCBI gene;Acc:100036723... [more]
back to top
BLAST of WD repeat-containing protein 7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wdr71.431e-4624.08WD repeat domain 7 [Source:MGI Symbol;Acc:MGI:1860... [more]
Wdr71.549e-4624.08WD repeat domain 7 [Source:MGI Symbol;Acc:MGI:1860... [more]
Wdr73.370e-4225.41WD repeat domain 7 [Source:MGI Symbol;Acc:MGI:1860... [more]
Wdr79.748e-3926.08WD repeat domain 7 [Source:MGI Symbol;Acc:MGI:1860... [more]
Wdr721.709e-3321.18WD repeat domain 72 [Source:MGI Symbol;Acc:MGI:358... [more]
back to top
BLAST of WD repeat-containing protein 7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y4E6|WDR7_HUMAN2.278e-4623.63WD repeat-containing protein 7 OS=Homo sapiens OX=... [more]
sp|Q9ERH3|WDR7_RAT3.924e-4623.93WD repeat-containing protein 7 OS=Rattus norvegicu... [more]
sp|Q920I9|WDR7_MOUSE1.083e-4524.08WD repeat-containing protein 7 OS=Mus musculus OX=... [more]
sp|D3YYM4|WDR72_MOUSE1.961e-3221.18WD repeat-containing protein 72 OS=Mus musculus OX... [more]
sp|Q3MJ13|WDR72_HUMAN1.487e-3120.69WD repeat-containing protein 72 OS=Homo sapiens OX... [more]
back to top
BLAST of WD repeat-containing protein 7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4W3HEP66.713e-4824.59Uncharacterized protein OS=Callorhinchus milii OX=... [more]
A0A4W3HEQ07.226e-4824.18Uncharacterized protein OS=Callorhinchus milii OX=... [more]
A0A4W3HBV29.221e-4824.18Uncharacterized protein OS=Callorhinchus milii OX=... [more]
A0A4W3HGW41.471e-4724.15Uncharacterized protein OS=Callorhinchus milii OX=... [more]
A0A4W3HEM34.556e-4724.08Uncharacterized protein OS=Callorhinchus milii OX=... [more]
back to top
BLAST of WD repeat-containing protein 7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
WDR75.485e-4623.53WD repeat domain 7 [Source:HGNC Symbol;Acc:HGNC:13... [more]
back to top
BLAST of WD repeat-containing protein 7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000001298.11.739e-4424.03pep scaffold:Pmarinus_7.0:GL478427:159:27262:-1 ge... [more]
ENSPMAT00000010446.12.542e-4221.26pep scaffold:Pmarinus_7.0:GL477237:16696:73623:-1 ... [more]
ENSPMAT00000002038.12.005e-2123.82pep scaffold:Pmarinus_7.0:GL477595:70120:96275:1 g... [more]
back to top
BLAST of WD repeat-containing protein 7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD repeat-containing protein 7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD repeat-containing protein 7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
WDR79.050e-4523.47WD repeat domain 7 [Source:NCBI gene;Acc:101162385... [more]
WDR74.102e-4323.19WD repeat domain 7 [Source:NCBI gene;Acc:101162385... [more]
WDR74.171e-4323.19WD repeat domain 7 [Source:NCBI gene;Acc:101162385... [more]
back to top
BLAST of WD repeat-containing protein 7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000032157.10.000e+0100.00SMESG000032157.1[more]
SMESG000002835.11.264e-4924.93SMESG000002835.1[more]
SMESG000002835.13.361e-4925.07SMESG000002835.1[more]
SMESG000002835.13.534e-4925.07SMESG000002835.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008079 ID=SMED30008079|Name=WD repeat-containing protein 7|organism=Schmidtea mediterranea sexual|type=transcript|length=4386bp
ATTATTTAATTTATTTTTATTAAGAGAAATTAAATAAAATCTTAGTTTTT
AGTTTATTTATTTTGAATAATTTAAAAACTATATATATATATATTTTTTC
AATGACTGAAATCGGTAATTCTAGTATTTTCTCTTTCGCACTTTGGTTGA
ATGAAGCACCTCTGCATAATATTTCTTCTTTAATATATTTAAGTAAAAAT
AATTTTGTCGTCAGCGGTTGTGAAAATGGTTATATAATAATATGGTCTCA
AAATAAAAATGGCGATCAATTGACACCTATTCATTATCTAATCGGTCATA
AATCGAAAATTTCCGATTTTGTTCTTGCTGGAAGCAGTGTCAATACAAAT
TTCGAATATTTTGTCAGTTTTTCAATTGATGGGGAAATAGCTCTCTGGGA
AGCTAAAGAAGGCCGTAATATTGAATTCATTTCTAATTCCCAGATGAACA
TTCAATATGTATTTTCATTTGAATCCGCCAATACAAAACAGCGGCTGATA
TTGTGCTGTGTAAAAAATAGTGAAATTTGTGTGCTAAATTCAATGTCATT
GGCGCACATCTGCACTCTTGTGTGCACCAGTAGTCCAAATTGGTTTTCAT
CGATAACGACTTTTCAAAAATCGATAAAGGATGACGTTATTCTAGCCACA
AGTGTTTCCGGTCTCATATCAATTTGGAATGTTAATTTCACAGATGTTTT
CACTCAAGGCAATATATGCCTGGTTATCGATGCTGACCAATATATTGACA
TTGAAACAGCTAATCCATCAAAAATATCTCACAATCCATATTCAAGTTCA
ATATTCCTTATCATAACATCATGTCAGTTCAAAGTCTTTTATACTGAAAC
TTGTGATATTCTTTCTTACCAAGATTGTTACAGAGGAGATTATTTTATTG
ATGGGCATTTCATATCATGTGATTCTATCATCATGCATACTCGATCTGGG
AAAGGATTTTTATATCAACTTCCTCCAAGAGCCAATCCCGAGAGTAGTTT
TTTCAGAAAGCAAAGTTTGAATCTTTGTGACAATATTCCGAATCTTTTGG
TTGAGTTTCCTCAACCGGAAAATACTGCTTCTTTTCGTCATAAAATTGAA
ATTCAGAATCAAGAGGATGTTATTATTATTTGGAAGGGATTTTCTAATGG
TAATATTTATAAATGGGAATTCACTAAACAGTCGAAACTTATCACACAAA
ATCGGTTTTGCTTGGATGATTCTTGGGAAAAAATTACGAAAGCACCAACA
TCTCTAACTAAATCTATTCAGGGAATTGATACAGCTGGATCAGTTACTAG
TCTCTTATTCATTCACGATTTGTCTTTAATTGTTCTCGGAATGGAGAATG
GTTGGATTATAGTTAAAAATATCTGTGATACATTAACTTCCGCATTTACT
GAAAATGATTCTACTAGTAATTATGTGATTCTCAAAGGTCACAGAGGGCC
AGTTACATGTTTATTGCATCCCAGTTCCACAATGAAACTTCCAACTCTCA
TGACTTCTGGTGCAAATGTTCAGTCTCAGGTCTGTTTAAATCTATTAAAG
CTGACCCATATATTGTGGTCAGGTGGAGTGGATTATACAATCAGGGTGTG
GGATATGAAAGGGGAAAAAATGGTCACAGTTTTTCATTGTCATTCATCAC
CACTTACAACCTTAAAACTTAATCATTTACCTTTGAATTCTGGAATGTTC
TGTGGCTTTAGTCAAGGTTTTACTGCCGCTATGTTCAATACAGTGAATGA
CGATGAAGAAAATAGCCACGATATCAAGCAAATGATCAATATGTGTATGA
ATGCCTTTATGGTTGGAATTGCTGAAAATGACGGCATTTCAATAATATCT
ATCATGAAACAGAAGGTTTTACTCTTTACATCAGATCACAAATCACCAGT
GCGCAGTCTCGGATGGATGCTTGACTGTGGTTATTTGTTAATTGAAACAA
TAGAGGATACTGTTTTTGTTTGGGATTTAGTTTCTGGAGTAATGGATAGG
TATGAAAGTGGAGATAAAGCTAAATTATTAATAGAAAATTGTCCTTTGAT
AACGAAATTAAGATCGAAGACTTCCAATTTACTTTATTCTTCTAAATCGG
TTCGCCGACACAGTTTGAGTAATATAATTATTTCGGATTCATCATCAAGT
CATGGATCGAACAATAAACTACTGAGATCTCAATTTATTCATAGTGGCAG
CTTCACTCGGCTGGTTCCGGTTTTAATTGTCAATATCAGTACTCTTTTAG
ACTCCTTGAATTCGTGCAATAATATTTCCAATTCAATCTGTGATATTCTT
GATGATGTGGAAAGCAGCCTGTCTTTGAAAAATAATAATAAATCTCACAA
GAAAAGAAAATCTGTTTCCGAGTTGGATTTGTTGATGGATGACGTCAAAA
CTGACAAGCATAACTTCAATTTGAAAATTTTGCTCATAAAGATTATTTTA
TCCATGACAAGTTTGTCGAAATTTAATTTCTCTTTCAGTCCAATCGCTTT
CAATAGTGATCGCATTTCTTGGTCTGTAGGTCAAGTTAATTCTAAAACTG
GATGTATTGGATTCGATTTAAAATCATTATTTCAAGATCACAATCCAGAA
ACAAGTCTGTCAGTGGAAAACATGCTCATACAGTTATCGATATCGAATAA
GATCATCAGTTTTTCCAAATCCGCTCTTTACGATCCATTTTTGAATATTT
ATTTCAAAAATGATAAAAATGAGAATAGTAATCACTTTAGTAAAGCATCT
CGTTCCAATTCATGCGGTTATCAACTCACAGATCCACATGGATCATCATT
TTCAACAGTGAAATCATTTAAAATTCATCGAAAGAAAATATTGAATAAGT
TACTGATGGATCTTTTGAATAGCTTCGAGGGAGAAATTGACGATTTGTCC
TTCAATGTATTGGAAAAAATATTCAATAGATTAATTGTCGGCATTCTTGA
TATTTGTGACACGATTAGTAAAAGTGCTTTGCAATTGCTTGCTAGAGTCA
TTGACAATCTCAAAGACCAGCAAATTCAAAATTATATTTTAATCTGGAGA
TCATTCTTGTCTCCAAATATGGATAATTACTGCTTAGAAGATGGGCGTAC
GTTCTTGAATAAAATCCAACCGTTCTTGGATAAATTTATCGAATTTTCTT
ACTTTTCGTCAGATTGGATTTGGTGGTTTTCCATTGACCAAATCAACACA
GATCATGAAAGACGAAATTTATCGAAAATTCAAATCAAAGCTCTGTTGAA
TATAGCACTTGTTGGATCTCACCTGAAACCCGACGAAAATAATGACATCA
ATAGTGATTCAAAGCTTTTCAGTAAACTCTTTACTCTCGATAAATCATTC
CTGGCAAGAATCACTTGTGACTTTCTAATGTCTGTGTTGTCGAAGAAACC
CAAAATATCTAAGAGTAATATCGGAAGACTCATTAATCTGTCGATGATTT
GTTTAAGTAATGGTTTTCTTGTATGGGAACCTTATTTAGACAGCAATACC
GTTATTTGCAAATTCCTCTATTTTGCCATAGATCTCGAAGATGCTGATAT
TGATGATAAATTGTTATCCCTTGTGTCGCACAAAGCTATTGAAGATATTG
CATCAGCAAGGCCGCTAATATTTGTTATGGTTTGCTATAGAGAAATGCTG
AAATGGTGCTCAATTTCTCTCAACACTTTCCATAATTTGTCGTCTATGTC
TACTTCAAGAACAATTGATCGACGTAAATCAACTCCTTCTTTATCATCTC
TCGTTGACAATGATAAAAATGCAAAACCGTTTTCGTTACTGAATCGCAAC
ATTTTGGTGCCAATATTTAATGATTTATGTCAGCATCAATCAGATAAAAT
ACTGGACGTATTGCCAGAACTGGTGGAATTGTACATATATTTTTATATAA
AGGATGAAGATTTCAGTTCTTTCATGTTACCGGTATTAAAGTTCTCTTCT
GTTTCGTTTAATGAACCCTGTGGTCAAATGAGTGTAGGATCAATCAAAGG
AAATCTGTATTTATTCGATTTGAAAATTGGAAAATATTTTAGCACATTAG
CACACAAAAAGTCAATAAGACTGACGAAATTCAGTGATGACGGCCGGTTA
GTAGCGAGTTATAGTGCGAGCGAAAATTCTGTCAAAATTTGGCAGATATC
GAATGCCATTTTCAGTTTAGGTGGGAATTCTCATCAGGTAAAGTTGATTA
ATTCCCAATCCATTCCGAGTCTAGAGCAAATGTTAACCGCTGTAAAGATT
TCATCAAAATACATGACAGTTGATCATCTATTGGACAAAGATTGTGATAT
TTATCTGGAATGGGACTCGGATAACAAAACTTTGTATATTAAGATTAATG
CGGCTGTTTTACGACAGATAAAACTTTAAAGGAGAT
back to top

protein sequence of SMED30008079-orf-1

>SMED30008079-orf-1 ID=SMED30008079-orf-1|Name=SMED30008079-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1426bp
MTEIGNSSIFSFALWLNEAPLHNISSLIYLSKNNFVVSGCENGYIIIWSQ
NKNGDQLTPIHYLIGHKSKISDFVLAGSSVNTNFEYFVSFSIDGEIALWE
AKEGRNIEFISNSQMNIQYVFSFESANTKQRLILCCVKNSEICVLNSMSL
AHICTLVCTSSPNWFSSITTFQKSIKDDVILATSVSGLISIWNVNFTDVF
TQGNICLVIDADQYIDIETANPSKISHNPYSSSIFLIITSCQFKVFYTET
CDILSYQDCYRGDYFIDGHFISCDSIIMHTRSGKGFLYQLPPRANPESSF
FRKQSLNLCDNIPNLLVEFPQPENTASFRHKIEIQNQEDVIIIWKGFSNG
NIYKWEFTKQSKLITQNRFCLDDSWEKITKAPTSLTKSIQGIDTAGSVTS
LLFIHDLSLIVLGMENGWIIVKNICDTLTSAFTENDSTSNYVILKGHRGP
VTCLLHPSSTMKLPTLMTSGANVQSQVCLNLLKLTHILWSGGVDYTIRVW
DMKGEKMVTVFHCHSSPLTTLKLNHLPLNSGMFCGFSQGFTAAMFNTVND
DEENSHDIKQMINMCMNAFMVGIAENDGISIISIMKQKVLLFTSDHKSPV
RSLGWMLDCGYLLIETIEDTVFVWDLVSGVMDRYESGDKAKLLIENCPLI
TKLRSKTSNLLYSSKSVRRHSLSNIIISDSSSSHGSNNKLLRSQFIHSGS
FTRLVPVLIVNISTLLDSLNSCNNISNSICDILDDVESSLSLKNNNKSHK
KRKSVSELDLLMDDVKTDKHNFNLKILLIKIILSMTSLSKFNFSFSPIAF
NSDRISWSVGQVNSKTGCIGFDLKSLFQDHNPETSLSVENMLIQLSISNK
IISFSKSALYDPFLNIYFKNDKNENSNHFSKASRSNSCGYQLTDPHGSSF
STVKSFKIHRKKILNKLLMDLLNSFEGEIDDLSFNVLEKIFNRLIVGILD
ICDTISKSALQLLARVIDNLKDQQIQNYILIWRSFLSPNMDNYCLEDGRT
FLNKIQPFLDKFIEFSYFSSDWIWWFSIDQINTDHERRNLSKIQIKALLN
IALVGSHLKPDENNDINSDSKLFSKLFTLDKSFLARITCDFLMSVLSKKP
KISKSNIGRLINLSMICLSNGFLVWEPYLDSNTVICKFLYFAIDLEDADI
DDKLLSLVSHKAIEDIASARPLIFVMVCYREMLKWCSISLNTFHNLSSMS
TSRTIDRRKSTPSLSSLVDNDKNAKPFSLLNRNILVPIFNDLCQHQSDKI
LDVLPELVELYIYFYIKDEDFSSFMLPVLKFSSVSFNEPCGQMSVGSIKG
NLYLFDLKIGKYFSTLAHKKSIRLTKFSDDGRLVASYSASENSVKIWQIS
NAIFSLGGNSHQVKLINSQSIPSLEQMLTAVKISSKYMTVDHLLDKDCDI
YLEWDSDNKTLYIKINAAVLRQIKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005737cytoplasm
GO:0008021synaptic vesicle
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
IPR011047Quinoprotein_ADH-like_supfam
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0002244hematopoietic progenitor cell differentiation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 1267..1306
e-value: 330.0
score: 1.1
coord: 149..193
e-value: 90.0
score: 4.7
coord: 56..100
e-value: 35.0
score: 7.2
coord: 587..625
e-value: 5.3
score: 12.4
coord: 437..501
e-value: 1.4
score: 16.1
coord: 1309..1348
e-value: 1.8
score: 15.4
coord: 5..49
e-value: 3.4
score: 13.6
IPR001680WD40 repeatPFAMPF00400WD40coord: 443..501
e-value: 0.033
score: 15.1
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 488..510
score: 8.871
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 1175..1384
e-value: 4.4E-8
score: 34.7
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 13..236
e-value: 1.1E-13
score: 52.6
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 276..643
e-value: 5.2E-15
score: 57.4
NoneNo IPR availablePANTHERPTHR44099FAMILY NOT NAMEDcoord: 1067..1409
coord: 13..767
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 488..502
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 17..109
score: 10.1
IPR011047Quinoprotein alcohol dehydrogenase-like superfamilySUPERFAMILYSSF50998Quinoprotein alcohol dehydrogenase-likecoord: 32..630
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 1280..1372