DAO domain-containing protein

Overview
NameDAO domain-containing protein
Smed IDSMED30008070
Length (bp)1489
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DAO domain-containing protein (SMED30008070) t-SNE clustered cells

Violin plots show distribution of expression levels for DAO domain-containing protein (SMED30008070) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DAO domain-containing protein (SMED30008070) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DAO domain-containing protein (SMED30008070) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008070

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30008070SMESG000037253.1 SmedASXL_015945SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermal cellSMED30008070SMESG000037253.1 dd_Smed_v4_10791_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30008070SMESG000037253.1 dd_Smed_v6_10791_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30008070SMESG000037253.1 dd_Smed_v4_10791_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30008070SMESG000037253.1 dd_Smed_v4_10791_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DAO domain-containing protein vs. Ensembl Human
Match: FOXRED1 (FAD dependent oxidoreductase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26927])

HSP 1 Score: 327.405 bits (838), Expect = 1.110e-106
Identity = 172/410 (41.95%), Postives = 246/410 (60.00%), Query Frame = 3
Query:  192 SSAYWLKKENPK---LKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQGLGNKL-----KRAIIKLNDE---------KYAEIKFLNVINASGCWASDIAILAERAIGLSGS--DYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKESSGL-FLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            S AYWLKK   +   +++LVVE+D  Y Q ST LSVGG+  QFS+ ENIQ+SLF+   + N+ +Y ++ +   +D++F   GYLLL+ ++    +  N  +QR  GA ++L++  ++R+ +PWINT+ +    YG++ EGWFDPW LL  +R+K   LGV    G +  F     ++     K  ++K   E         +Y  ++   VINA+G W++ IA LA    G  G+     L V   KRYVY +H    P  + TP+V D++G YFR+E  G  +L G SP   +EP+  NL+VD+++F  ++WP L  RVP  E LKV+SAWAGYYDYNT DQN +VG HP + N Y   G SGHG+Q A  IGRA  E+++ G FQTI+L  F + RF   E I E+NI
Sbjct:   63 SVAYWLKKLESRRGAIRVLVVERDHTYSQASTGLSVGGICQQFSLPENIQLSLFSASFLRNINEYLAVVDAPPLDLRFNPSGYLLLASEKDAAAMESNVKVQRQEGAKVSLMSPDQLRNKFPWINTEGVALASYGMEDEGWFDPWCLLQGLRRKVQSLGVLFCQGEVTRFVSSSQRMLTTDDKAVVLKRIHEVHVKMDRSLEYQPVECAIVINAAGAWSAQIAALAGVGEGPPGTLQGTKLPVEPRKRYVYVWHCPQGP-GLETPLVADTSGAYFRREGLGSNYLGGRSPTEQEEPDPANLEVDHDFFQDKVWPHLALRVPAFETLKVQSAWAGYYDYNTFDQNGVVGPHPLVVNMYFATGFSGHGLQQAPGIGRAVAEMVLKGRFQTIDLSPFLFTRFYLGEKIQENNI 471          
BLAST of DAO domain-containing protein vs. Ensembl Human
Match: FOXRED1 (FAD dependent oxidoreductase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26927])

HSP 1 Score: 327.791 bits (839), Expect = 1.250e-106
Identity = 172/410 (41.95%), Postives = 246/410 (60.00%), Query Frame = 3
Query:  192 SSAYWLKKENPK---LKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQGLGNKL-----KRAIIKLNDE---------KYAEIKFLNVINASGCWASDIAILAERAIGLSGS--DYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKESSGL-FLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            S AYWLKK   +   +++LVVE+D  Y Q ST LSVGG+  QFS+ ENIQ+SLF+   + N+ +Y ++ +   +D++F   GYLLL+ ++    +  N  +QR  GA ++L++  ++R+ +PWINT+ +    YG++ EGWFDPW LL  +R+K   LGV    G +  F     ++     K  ++K   E         +Y  ++   VINA+G W++ IA LA    G  G+     L V   KRYVY +H    P  + TP+V D++G YFR+E  G  +L G SP   +EP+  NL+VD+++F  ++WP L  RVP  E LKV+SAWAGYYDYNT DQN +VG HP + N Y   G SGHG+Q A  IGRA  E+++ G FQTI+L  F + RF   E I E+NI
Sbjct:   77 SVAYWLKKLESRRGAIRVLVVERDHTYSQASTGLSVGGICQQFSLPENIQLSLFSASFLRNINEYLAVVDAPPLDLRFNPSGYLLLASEKDAAAMESNVKVQRQEGAKVSLMSPDQLRNKFPWINTEGVALASYGMEDEGWFDPWCLLQGLRRKVQSLGVLFCQGEVTRFVSSSQRMLTTDDKAVVLKRIHEVHVKMDRSLEYQPVECAIVINAAGAWSAQIAALAGVGEGPPGTLQGTKLPVEPRKRYVYVWHCPQGP-GLETPLVADTSGAYFRREGLGSNYLGGRSPTEQEEPDPANLEVDHDFFQDKVWPHLALRVPAFETLKVQSAWAGYYDYNTFDQNGVVGPHPLVVNMYFATGFSGHGLQQAPGIGRAVAEMVLKGRFQTIDLSPFLFTRFYLGEKIQENNI 485          
BLAST of DAO domain-containing protein vs. Ensembl Human
Match: FOXRED1 (FAD dependent oxidoreductase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26927])

HSP 1 Score: 81.2629 bits (199), Expect = 3.368e-17
Identity = 45/109 (41.28%), Postives = 67/109 (61.47%), Query Frame = 3
Query:  192 SSAYWLKKENPK---LKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAAL 509
            S AYWLKK   +   +++LVVE+D  Y Q ST LSVGG+  QFS+ ENIQ+SLF+   + N+  Y ++ +   +D++F   GYLLL+ ++    +  N  +QR  G  L
Sbjct:   77 SVAYWLKKLESRRGAIRVLVVERDHTYSQASTGLSVGGICQQFSLPENIQLSLFSASFLRNI-NYLAVVDAPPLDLRFNPSGYLLLASEKDAAAMESNVKVQRDGGRRL 184          
BLAST of DAO domain-containing protein vs. Ensembl Human
Match: SARDH (sarcosine dehydrogenase [Source:HGNC Symbol;Acc:HGNC:10536])

HSP 1 Score: 68.1662 bits (165), Expect = 1.530e-11
Identity = 72/324 (22.22%), Postives = 134/324 (41.36%), Query Frame = 3
Query:  390 EEENVDVQFIKRGYLLLSQKEQE-NILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSI-NGSLVEFQGLGNKLKRAIIKLNDEKYAEIKFLNVINASGCWASDIAILAERAIGLSGSDYPLHVTKAKRYVYNFHVADFPPTIITPMVVD-STGVYFRKESSGLFLSGLSP------ETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYG----EFQTINLERFHYN 1322
            EE  +   +I+ G L ++   Q  +   R  +L ++ G   ++L+ +E +  +P +N DD+   +Y +  +G  DP      + + A   G   I N  +   +   +      +   + ++  I+   V+N +G WAS +  +A   + L    +   VT+    + N            P V D    VY R +   L + G         E  D+      D+D+E F   I   +  RVP++E   +KS   G   + T D   ++G+ P +  F+L  G +  G+      G+     II+G    +    ++ RFH++
Sbjct:  139 EETGLHTGWIQNGGLFIASNRQRLDEYKRLMSLGKAYGVESHVLSPAETKTLYPLMNVDDLYGTLY-VPHDGTMDPAGTCTTLARAASARGAQVIENCPVTGIRVWTDDFGVRRVAGVETQHGSIQTPCVVNCAGVWASAVGRMAGVKVPLVAMHHAYVVTERIEGIQNM-----------PNVRDHDASVYLRLQGDALSVGGYEANPIFWEEVSDKFAFGLFDLDWEVFTQHIEGAIN-RVPVLEKTGIKSTVCGPESF-TPDHKPLMGEAPELRGFFLGCGFNSAGMMLGGGCGQELAHWIIHGRPEKDMHGYDIRRFHHS 448          
BLAST of DAO domain-containing protein vs. Ensembl Human
Match: SARDH (sarcosine dehydrogenase [Source:HGNC Symbol;Acc:HGNC:10536])

HSP 1 Score: 68.1662 bits (165), Expect = 2.012e-11
Identity = 72/324 (22.22%), Postives = 134/324 (41.36%), Query Frame = 3
Query:  390 EEENVDVQFIKRGYLLLSQKEQE-NILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSI-NGSLVEFQGLGNKLKRAIIKLNDEKYAEIKFLNVINASGCWASDIAILAERAIGLSGSDYPLHVTKAKRYVYNFHVADFPPTIITPMVVD-STGVYFRKESSGLFLSGLSP------ETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYG----EFQTINLERFHYN 1322
            EE  +   +I+ G L ++   Q  +   R  +L ++ G   ++L+ +E +  +P +N DD+   +Y +  +G  DP      + + A   G   I N  +   +   +      +   + ++  I+   V+N +G WAS +  +A   + L    +   VT+    + N            P V D    VY R +   L + G         E  D+      D+D+E F   I   +  RVP++E   +KS   G   + T D   ++G+ P +  F+L  G +  G+      G+     II+G    +    ++ RFH++
Sbjct:  139 EETGLHTGWIQNGGLFIASNRQRLDEYKRLMSLGKAYGVESHVLSPAETKTLYPLMNVDDLYGTLY-VPHDGTMDPAGTCTTLARAASARGAQVIENCPVTGIRVWTDDFGVRRVAGVETQHGSIQTPCVVNCAGVWASAVGRMAGVKVPLVAMHHAYVVTERIEGIQNM-----------PNVRDHDASVYLRLQGDALSVGGYEANPIFWEEVSDKFAFGLFDLDWEVFTQHIEGAIN-RVPVLEKTGIKSTVCGPESF-TPDHKPLMGEAPELRGFFLGCGFNSAGMMLGGGCGQELAHWIIHGRPEKDMHGYDIRRFHHS 448          
BLAST of DAO domain-containing protein vs. Ensembl Celegans
Match: M04B2.4 (pep chromosome:WBcel235:IV:11518422:11521031:-1 gene:WBGene00010847.1 transcript:M04B2.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M04B2.4)

HSP 1 Score: 239.58 bits (610), Expect = 1.469e-72
Identity = 143/419 (34.13%), Postives = 222/419 (52.98%), Query Frame = 3
Query:  192 SSAYWLKKE--NPKLKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQE-NILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQ-----------GLG-------NKLKRAII-------KLNDEKYAEIKFLNVINASGCWASDIAILAERAIGLSGSDYPLHVTKAKRYVYNFHVADFPPTIITPMVVD-STGVYFRKESSG-LFLSGLSPETHDEPNCD--NLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFE 1352
            S+A+WLK+   +   K++VVE +  + + ST+LS GG+  QFS+ E + MSLF T+ + + G++  I + E  D+ F   GYL L++ ++E  ++   + +Q   GA + LL++ E+   +P++N DD+     G++ EG  D W LL+ IR+K + LGV  + G +  FQ             G       NKL+   I       ++ND     I+   ++NA+G WA  +A +A    G      P+ +   KR V+     D P  +  P ++D STGV+ R+  SG  FL G +P   ++   D  NLDVDY+ F  +IWP L  RVP  +  KVKSAW+GY D NT D   ++G+HP   N ++  G    G+ H++A  RA  E I  G +  +NL +F   R VK + I E
Sbjct:  107 STAFWLKERFRDEDFKVVVVENNDVFTKSSTMLSTGGITQQFSIPEFVDMSLFTTEFLRHAGEHLRILDSEQPDINFFPTGYLRLAKTDEEVEMMRSAWKVQIERGAKVQLLSKDELTKRYPYMNVDDVLLASLGVENEGTIDTWQLLSAIREKNITLGVQYVKGEVEGFQFERHRASSEVHAFGDDATADENKLRAQRISGVLVRPQMNDASARPIRAHLIVNAAGPWAGQVAKMAGIGKGTGLLAVPVPIQPRKRDVFVIFAPDVPSDL--PFIIDPSTGVFCRQTDSGQTFLVGRTPSKEEDAKRDHSNLDVDYDDFYQKIWPVLVDRVPGFQTAKVKSAWSGYQDINTFDDAPVIGEHPLYTNLHMMCGFGERGVMHSMAAARAYAERIFDGAYINVNLRKFDMRRIVKMDPITE 523          
BLAST of DAO domain-containing protein vs. Ensembl Celegans
Match: pdpr-1 (Pyruvate Dehydrogenase Phosphatase Regulatory subunit [Source:UniProtKB/TrEMBL;Acc:Q9U300])

HSP 1 Score: 56.6102 bits (135), Expect = 3.467e-8
Identity = 97/422 (22.99%), Postives = 171/422 (40.52%), Query Frame = 3
Query:  135 TTVDIESDIAXXXXXXXXYSSAYWLKKENPKLKILVVEKDVFYKQCSTVLSVGGLRLQF-----SVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYL-LLSQKEQENILHRNFNLQRSLGAALNLLN-RSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQGLGNKLKRAIIKLNDEKYAEIKFLNVINASGCWASDIAILAERAIGLSGSDYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTG-VYFRKESSGLFLSGLSPET---------------HDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFV 1331
            TT    +D+ + GGGI G S AY L K   K  + +VEKD      +T LS G +         S+Q   Q SL   D+ S+L              ++IK G   L S    E +L R ++        + LL+ +SE+ + WP++ T+D++  ++  + +   DP  L   +   A   G      + V    +G++ +   +     K   I+  + ++A+G WA    + A     +  + YP   +    Y++   +     + +TP+  D  G V  R  S     +G + E+               H EP+ +  D + E        KL  R P++          G   Y T D+   +G+      +++  G +G G+  A  +G+   EL+   +  T ++ R    RF+
Sbjct:   16 TTAVANADVVVCGGGISGTSIAYHLAKRGKK--VALVEKDSIGCSGATGLSAGLVSSPIFWQDTSLQAIAQASL---DLYSHLAT--------TCKFRYIKCGRTYLASSMANEILLRRMYSRGVVHNDKVELLDCQSEMLERWPFLQTEDVQLALFSPE-DVALDPVALCQHLALIAKDYGALIYESNPVLEVHIGDEKQ---VYGVSTKMGFIETSHFVDAAGIWAGSHLVKALPHQHVQTAAYPCTYS----YIHTSKLPTGSVSDMTPIFNDLDGNVMLRTTSFKTLCAGFAEESIRPLARQTGSATPWQHPEPDWNTFDPNLE--------KLISRCPMLGDCNHGDLIVGMEAY-TPDKLPTIGESSQAKGYWVMCGMNGQGLSLAGGLGKILGELMCESQSSTADVARVDVGRFI 407          
BLAST of DAO domain-containing protein vs. Ensembl Fly
Match: CG3270 (gene:FBgn0033093 transcript:FBtr0086123)

HSP 1 Score: 305.064 bits (780), Expect = 8.399e-99
Identity = 164/400 (41.00%), Postives = 235/400 (58.75%), Query Frame = 3
Query:  192 SSAYWLKKE----NPKLKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQ-GLGNKLKRAIIKLNDEKYAEIKFLNVINASGCWASDIAILA---ERAIGLSGSDYPLHVTKAKRYVYNFHV-ADFPPTIITPMVVDSTGVYFRKES-SGLFLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            SSA+WLK        KL +LVVE+D  Y   STVLSVGG+R QFS+ ENI+MSLF  + + N  ++       +VD+ +   GYL+L+ ++  +IL +N  LQ  LGA   LL    +R  +PW++T+ +E G +GID EGWFDPW LL   +KKA  LG    NGS+V F+      L  A++   D     +KF   + A+G ++  +A LA   ++    +     L V   KRYVY         P + TP+ VD  G YFR++   G FL G SP   +EP C+ LDVD+ +F+ ++WP L  RVP  E++K++S+WAG+YD+NT D N ++G+HP   N ++  G SGHGIQ   A+GRA  ELI+ G+F T++L R  + R V  + + E NI
Sbjct:   45 SSAFWLKSRALQLGRKLNVLVVERDAGYTSASTVLSVGGVRQQFSLAENIEMSLFGYNFVVNGREHLG-----DVDLCYQPNGYLILASEKGAHILAKNSKLQNELGARNELLGPEALRQRFPWLSTEGVELGCHGIDKEGWFDPWALLMGYKKKARALGANFANGSVVGFEWNDSGGLSGAVVDAGDVLQRTVKFDTCVLAAGAYSGQVARLAGIGDKEAKEASLSVALPVEPRKRYVYVVSTQGKNCPGLATPLTVDPDGTYFRRDGLCGNFLCGRSPNEDEEPECETLDVDHGYFETDVWPTLANRVPAFESVKIQSSWAGFYDHNTFDANGVIGRHPHYSNLFIAAGFSGHGIQQTPAVGRAISELILDGKFTTLDLSRLGFERLVNQQPMHEVNI 439          
BLAST of DAO domain-containing protein vs. Ensembl Fly
Match: l(2)37Bb (gene:FBgn0002021 transcript:FBtr0081177)

HSP 1 Score: 262.307 bits (669), Expect = 2.536e-81
Identity = 152/406 (37.44%), Postives = 225/406 (55.42%), Query Frame = 3
Query:  198 AYWLK-KENPKLKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQ-----------------GLGNKLKRAIIKLNDEKYAEIKFLNVINASGCWASDIAILAERAIGLSGSDYPLHVTKAKRYVYNFHV-ADFPPTIITPMVVDSTGVYFRKESSGLFLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESN 1358
            AYWLK K    L ++VVEKD  Y Q +T +SVGGL  QFS+ ENIQMSLFA D + +  K+F  GEE  V +QF   G+L+L+ +E    L R+  LQ  LGA   LL    +   +PW+NT  I  G  G++ EGWF+P  LL+  R+ A   G   I+G +V+F+                 G    L++A+I+L D      KF   + ++G  +  IA LA   +G      PL +   KRY+Y  +  A   P +  PM +D +G++ R++  G     +   T +    ++  +D ++F   I P LY R+P++   +V  +WAG YD+N  D+N I+G HP   N YL  G SGHG+Q +LA+GRA  ELI+ G+F+TI+L R  ++R + ++ +FE N
Sbjct:  113 AYWLKEKARDGLNVVVVEKDDTYAQSATRVSVGGLCQQFSLPENIQMSLFAADFLRSARKHF--GEE--VPLQFTPHGHLMLAGEEHAESLKRSSQLQNELGARNELLTADRLTARFPWLNTKGIALGCLGLEKEGWFNPLALLSNFRRSASGYGAHFISGQVVDFEFKSQTDISVVTDLGSNEGAYTGLEKAVIQLPDGTRRTCKFALCVISAGASSEQIARLARIGVGPGILRVPLPINARKRYMYAINSQAQSAPGMNMPMTIDPSGIFIRRDGLGGNYICVQDSTEE---YNSAMIDPQYFAQHIRPHLYNRIPVLGEAQVVDSWAGCYDHNVYDENGILGAHPYYNNLYLATGFSGHGVQQSLAVGRAISELIMDGQFRTIDLSRLSFDRLIVDQPMFELN 511          
BLAST of DAO domain-containing protein vs. Ensembl Fly
Match: CG3626 (gene:FBgn0029706 transcript:FBtr0070652)

HSP 1 Score: 54.6842 bits (130), Expect = 1.866e-7
Identity = 102/451 (22.62%), Postives = 185/451 (41.02%), Query Frame = 3
Query:   78 ILSQNFNKYVISKLLCSMSTTVDIESDIAXXXXXXXXYSSAYWLKKENPKLKILVVEKDVFYKQCS-TVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQK-EQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSI-NGSLVEFQGLGNKLKRAIIKLNDEKYAEIKFLNVINASGCWASDIAILAERAIGLSGSDYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKESSGLFLSG----------------LSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVP---------LMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYG----EFQTINLERF---HYNR 1325
            +  + F     + L   ++  + ++S + I GGGI G S AY L       + L+VE+D    +   T   + G R + S  E ++++ ++ D+I  L        E  +   +   G L L++  ++    +R  +   + G    +L+  +   +   ++ D IE G++ I  +G  DP L+      +A +LGV  + + ++ +      K++       D    E ++   +N +G WA ++  L++  + +     PL   +   Y++   +    P   TP V D  G  F +E  G  L+G                LS      P       D++ F HE+   L  RVP         L  +L+V S           D   I+G+ P I N+Y+  G+   G+  +  IGR   +LI  G    +   +++ RF   H NR
Sbjct:   44 LRKRKFQPQQAADLSEELAGQLPVKSRVVICGGGITGASVAYHLGLRGWGGETLLVEQDRVGGELPWTACGLAG-RFEPSYTE-LKLAEYSIDLIKRLA-------ENGLPTGWRPVGSLNLARSWDRMTAFNRMKSQALAWGMHCEILSPEQCAQHCELLSLDGIEGGLW-IPEDGVCDPQLVCQAYMIEAQRLGVRIVEHCAIKKIHSEHGKVRSVETTAGD---VECEYF--VNCTGFWAREVGTLSKPVVKV-----PLKAVE-HHYLHTKPIEGLSPD--TPFVRDFDGRIFFRECEGHILAGGFEREAKMVYEDGVIPLSQTARQHPP------DWDHF-HELLDALLLRVPSFRDATLDRLTNSLQVFSP----------DCKWILGEAPEIQNYYVAAGNKTMGVSASGGIGRVLTDLITKGSTYLDLHILDISRFLGLHNNR 454          
BLAST of DAO domain-containing protein vs. Ensembl Zebrafish
Match: foxred1 (FAD-dependent oxidoreductase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-080204-64])

HSP 1 Score: 302.753 bits (774), Expect = 5.411e-97
Identity = 165/411 (40.15%), Postives = 250/411 (60.83%), Query Frame = 3
Query:  189 YSSAYWLKKE---NPKLKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQ--------GLGN-----KLKRAIIKL-NDEKYAEIKFLNVINASGCWASDIAILAERAIGL--SGSDYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKES-SGLFLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            +S AYW+K++      L+++VVEKD  Y Q STVLS GG+R QFS++ENI +SL + D + N+ K+  +  E+ VD+QF   GYL L+ ++  +++  N++ QR  GA + LL+ S++++ +PW+NT+ +     G++ EGWFDPW LLN  R+KAL +GV    G +  F+          G+     ++K   +++ N  +Y  ++   V+NA+G  +  IA +    +G   S S  P  V   KR+ Y  H  D  P + TP ++D +GVY R+E   G +++G+SPE  +EP+  NLDVD+E+F  ++W  L  R+P  E LKV SAWAG+YDYNT DQN I+G HP + N Y   G SGHG+Q + A+GRA  ELI+   ++TI+L  F   R +K + I E NI
Sbjct:   82 WSIAYWIKRKERTRGALRVVVVEKDPTYSQASTVLSCGGIRQQFSLKENILLSLESADFLRNINKHLWVTNEDPVDLQFNHSGYLFLASEKSAHVMEENYSTQRYAGAKVVLLSPSQLKERFPWMNTEGVALASLGLENEGWFDPWSLLNAFRRKALSMGVYQCFGEVTGFRYSTQIAEVAEGDFVDFRRIKCVNVRMPNSLEYQPVECPVVVNAAGANSGKIAAMLGIGLGPEESVSGIPFPVEPRKRFAYVVHCPD-GPGLDTPFLIDYSGVYLRREGLGGNYIAGMSPEETEEPDISNLDVDHEFFQEKVWHHLAHRIPAFEKLKVSSAWAGFYDYNTFDQNGILGLHPLVANMYFATGFSGHGLQQSPAVGRAIAELILDRGYKTIDLSAFGIKRIIKKKPILERNI 491          
BLAST of DAO domain-containing protein vs. Ensembl Zebrafish
Match: foxred1 (FAD-dependent oxidoreductase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-080204-64])

HSP 1 Score: 302.753 bits (774), Expect = 5.411e-97
Identity = 165/411 (40.15%), Postives = 250/411 (60.83%), Query Frame = 3
Query:  189 YSSAYWLKKE---NPKLKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQ--------GLGN-----KLKRAIIKL-NDEKYAEIKFLNVINASGCWASDIAILAERAIGL--SGSDYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKES-SGLFLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            +S AYW+K++      L+++VVEKD  Y Q STVLS GG+R QFS++ENI +SL + D + N+ K+  +  E+ VD+QF   GYL L+ ++  +++  N++ QR  GA + LL+ S++++ +PW+NT+ +     G++ EGWFDPW LLN  R+KAL +GV    G +  F+          G+     ++K   +++ N  +Y  ++   V+NA+G  +  IA +    +G   S S  P  V   KR+ Y  H  D  P + TP ++D +GVY R+E   G +++G+SPE  +EP+  NLDVD+E+F  ++W  L  R+P  E LKV SAWAG+YDYNT DQN I+G HP + N Y   G SGHG+Q + A+GRA  ELI+   ++TI+L  F   R +K + I E NI
Sbjct:   82 WSIAYWIKRKERTRGALRVVVVEKDPTYSQASTVLSCGGIRQQFSLKENILLSLESADFLRNINKHLWVTNEDPVDLQFNHSGYLFLASEKSAHVMEENYSTQRYAGAKVVLLSPSQLKERFPWMNTEGVALASLGLENEGWFDPWSLLNAFRRKALSMGVYQCFGEVTGFRYSTQIAEVAEGDFVDFRRIKCVNVRMPNSLEYQPVECPVVVNAAGANSGKIAAMLGIGLGPEESVSGIPFPVEPRKRFAYVVHCPD-GPGLDTPFLIDYSGVYLRREGLGGNYIAGMSPEETEEPDISNLDVDHEFFQEKVWHHLAHRIPAFEKLKVSSAWAGFYDYNTFDQNGILGLHPLVANMYFATGFSGHGLQQSPAVGRAIAELILDRGYKTIDLSAFGIKRIIKKKPILERNI 491          
BLAST of DAO domain-containing protein vs. Ensembl Zebrafish
Match: foxred1 (FAD-dependent oxidoreductase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-080204-64])

HSP 1 Score: 153.68 bits (387), Expect = 5.378e-44
Identity = 80/171 (46.78%), Postives = 109/171 (63.74%), Query Frame = 3
Query:  852 PLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKES-SGLFLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            P  V   KR+ Y  H  D  P + TP ++D +GVY R+E   G +++G+SPE  +EP+  NLDVD+E+F  ++W  L  R+P  E LKV SAWAG+YDYNT DQN I+G HP + N Y   G SGHG+Q + A+GRA  ELI+   ++TI+L  F   R +K + I E NI
Sbjct:    3 PFPVEPRKRFAYVVHCPD-GPGLDTPFLIDYSGVYLRREGLGGNYIAGMSPEETEEPDISNLDVDHEFFQEKVWHHLAHRIPAFEKLKVSSAWAGFYDYNTFDQNGILGLHPLVANMYFATGFSGHGLQQSPAVGRAIAELILDRGYKTIDLSAFGIKRIIKKKPILERNI 172          
BLAST of DAO domain-containing protein vs. Ensembl Zebrafish
Match: sardh (sarcosine dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-040426-996])

HSP 1 Score: 72.4034 bits (176), Expect = 6.261e-13
Identity = 86/393 (21.88%), Postives = 163/393 (41.48%), Query Frame = 3
Query:  234 ILVVEKDVFYKQCSTVLSVGGLRLQFSVQEN-IQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLL-SQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVT-----SINGSLVEFQGLGNKLKRAIIKLNDEKYAEIKFLNVINASGCWASDIAILAERAIGLSGSDYPLHVTKAKRYVYNFHVADFPPTIITPMVVD-STGVYFRKESSGLFLSGLSP------ETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYG----EFQTINLERFHYNRFVKNELIFESN 1358
            ++++E+D       T     GL  Q    +  +++     +V+S+      + EE  ++  +I+ G L + S K++ +   R  +L +  G   ++L+ +E +D +P +N  D+   +Y +  +G  DP      + + A   G T      + G  V+   LG K  +A+       +  I+   V+N +G WA+ +  +A   + L    +   VT+    + N            P V D    VY R +   L + G         +  D+      D+D++ F   I   +  RVP +E   +KS   G   + T D   ++G+ P +  F+L  G +  G+      G+     II+G    +    ++ RFH++    N  I E +
Sbjct:   90 VVLLERDRL--TAGTTWHTAGLLWQLRPSDTEVELLAHTRNVVSS-----ELKEETGLETGWIQNGGLFIASNKQRLDEYKRLMSLGKVYGIESHVLSPAETKDLYPLMNVKDLYGTLY-VPKDGTMDPAGTCTTLSRAATARGATVIENCPVTGIQVKVDDLGVKRVKAV----QTPHGTIRTPCVVNCAGVWATKLGEMAGVNVPLIAMHHAYVVTERIEGIQNM-----------PNVRDHDASVYLRLQGDALSVGGYEQNPIFWDDVSDKFAFSLFDLDWDVFMQHIDGAVN-RVPALEQTGIKSTVCGPESF-TADHKPLMGEAPEVRGFFLGCGFNSAGMMLGGGCGKELAHWIIHGRPEKDMYGYDIRRFHHSLTNNNRWIRERS 457          
BLAST of DAO domain-containing protein vs. Ensembl Zebrafish
Match: sardh (sarcosine dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-040426-996])

HSP 1 Score: 72.4034 bits (176), Expect = 6.307e-13
Identity = 86/393 (21.88%), Postives = 163/393 (41.48%), Query Frame = 3
Query:  234 ILVVEKDVFYKQCSTVLSVGGLRLQFSVQEN-IQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLL-SQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVT-----SINGSLVEFQGLGNKLKRAIIKLNDEKYAEIKFLNVINASGCWASDIAILAERAIGLSGSDYPLHVTKAKRYVYNFHVADFPPTIITPMVVD-STGVYFRKESSGLFLSGLSP------ETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYG----EFQTINLERFHYNRFVKNELIFESN 1358
            ++++E+D       T     GL  Q    +  +++     +V+S+      + EE  ++  +I+ G L + S K++ +   R  +L +  G   ++L+ +E +D +P +N  D+   +Y +  +G  DP      + + A   G T      + G  V+   LG K  +A+       +  I+   V+N +G WA+ +  +A   + L    +   VT+    + N            P V D    VY R +   L + G         +  D+      D+D++ F   I   +  RVP +E   +KS   G   + T D   ++G+ P +  F+L  G +  G+      G+     II+G    +    ++ RFH++    N  I E +
Sbjct:   90 VVLLERDRL--TAGTTWHTAGLLWQLRPSDTEVELLAHTRNVVSS-----ELKEETGLETGWIQNGGLFIASNKQRLDEYKRLMSLGKVYGIESHVLSPAETKDLYPLMNVKDLYGTLY-VPKDGTMDPAGTCTTLSRAATARGATVIENCPVTGIQVKVDDLGVKRVKAV----QTPHGTIRTPCVVNCAGVWATKLGEMAGVNVPLIAMHHAYVVTERIEGIQNM-----------PNVRDHDASVYLRLQGDALSVGGYEQNPIFWDDVSDKFAFSLFDLDWDVFMQHIDGAVN-RVPALEQTGIKSTVCGPESF-TADHKPLMGEAPEVRGFFLGCGFNSAGMMLGGGCGKELAHWIIHGRPEKDMYGYDIRRFHHSLTNNNRWIRERS 457          
BLAST of DAO domain-containing protein vs. Ensembl Xenopus
Match: foxred1 (FAD-dependent oxidoreductase domain containing 1 [Source:NCBI gene;Acc:100125144])

HSP 1 Score: 354.369 bits (908), Expect = 2.023e-117
Identity = 176/411 (42.82%), Postives = 258/411 (62.77%), Query Frame = 3
Query:  189 YSSAYWLK-KENPK--LKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQGLGNKLKRA--------------IIKLNDEKYAEIKFLNVINASGCWASDIAILAERAIGLSGS--DYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKES-SGLFLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            +S AYWLK KEN +  L+++VVE+D  Y + STVLS GG+R QFS  ENI MSLF+   + N+ ++  +  E+++D+QF   GYL L+ +E   ++  N+N+QR  GA + LL+  +++  +PW+NT+ +    YG++ EGWFDPW LLN  R+KAL +GV   +G + +F     ++  A              ++  N  +   ++   VINA+G W+S++A LA   IG S S     L V   KRY++  H  D P  +  P+++DS+GVYFR+E   G +++G SP   +EP+  N++VDY++F  ++WP L  RVP  E+LKVK+AWAGYYDYNT DQN +VG HP + N +   G SGHG+QH+ A+GRA  ELI+ G FQTI+L  F + RFV  E + E NI
Sbjct:   45 WSIAYWLKQKENRRGALRVVVVERDPTYSRASTVLSAGGIRQQFSRPENIHMSLFSAQFLRNINEHLGVVNEDHIDIQFNPSGYLFLASEEGATVMEENYNVQRECGAQVTLLSPHQLKKKFPWVNTNGVALASYGLENEGWFDPWTLLNAFRRKALSMGVYHCHGEVTDFSTTKREMMTADGDPVTFSRIGHVTVLMPNSLESQNVECALVINAAGAWSSNVAELAGIGIGPSDSLESVKLPVEPKKRYIFVVHCPDGP-GLDCPLLIDSSGVYFRREGLGGNYIAGKSPTEEEEPDISNMEVDYDFFQQKVWPLLAHRVPAFESLKVKTAWAGYYDYNTYDQNGVVGMHPLVNNLFFATGFSGHGLQHSPAVGRAVAELIVDGSFQTIDLSSFSFRRFVSEEPLLERNI 454          
BLAST of DAO domain-containing protein vs. Ensembl Xenopus
Match: foxred1 (FAD-dependent oxidoreductase domain containing 1 [Source:NCBI gene;Acc:100125144])

HSP 1 Score: 353.984 bits (907), Expect = 4.266e-117
Identity = 176/411 (42.82%), Postives = 258/411 (62.77%), Query Frame = 3
Query:  189 YSSAYWLK-KENPK--LKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQGLGNKLKRA--------------IIKLNDEKYAEIKFLNVINASGCWASDIAILAERAIGLSGS--DYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKES-SGLFLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            +S AYWLK KEN +  L+++VVE+D  Y + STVLS GG+R QFS  ENI MSLF+   + N+ ++  +  E+++D+QF   GYL L+ +E   ++  N+N+QR  GA + LL+  +++  +PW+NT+ +    YG++ EGWFDPW LLN  R+KAL +GV   +G + +F     ++  A              ++  N  +   ++   VINA+G W+S++A LA   IG S S     L V   KRY++  H  D  P +  P+++DS+GVYFR+E   G +++G SP   +EP+  N++VDY++F  ++WP L  RVP  E+LKVK+AWAGYYDYNT DQN +VG HP + N +   G SGHG+QH+ A+GRA  ELI+ G FQTI+L  F + RFV  E + E NI
Sbjct:   64 WSIAYWLKQKENRRGALRVVVVERDPTYSRASTVLSAGGIRQQFSRPENIHMSLFSAQFLRNINEHLGVVNEDHIDIQFNPSGYLFLASEEGATVMEENYNVQRECGAQVTLLSPHQLKKKFPWVNTNGVALASYGLENEGWFDPWTLLNAFRRKALSMGVYHCHGEVTDFSTTKREMMTADGDPVTFSRIGHVTVLMPNSLESQNVECALVINAAGAWSSNVAELAGIGIGPSDSLESVKLPVEPKKRYIFVVHCPD-GPGLDCPLLIDSSGVYFRREGLGGNYIAGKSPTEEEEPDISNMEVDYDFFQQKVWPLLAHRVPAFESLKVKTAWAGYYDYNTYDQNGVVGMHPLVNNLFFATGFSGHGLQHSPAVGRAVAELIVDGSFQTIDLSSFSFRRFVSEEPLLERNI 473          
BLAST of DAO domain-containing protein vs. Ensembl Xenopus
Match: foxred1 (FAD-dependent oxidoreductase domain containing 1 [Source:NCBI gene;Acc:100125144])

HSP 1 Score: 354.369 bits (908), Expect = 9.850e-117
Identity = 176/411 (42.82%), Postives = 258/411 (62.77%), Query Frame = 3
Query:  189 YSSAYWLK-KENPK--LKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQGLGNKLKRA--------------IIKLNDEKYAEIKFLNVINASGCWASDIAILAERAIGLSGS--DYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKES-SGLFLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            +S AYWLK KEN +  L+++VVE+D  Y + STVLS GG+R QFS  ENI MSLF+   + N+ ++  +  E+++D+QF   GYL L+ +E   ++  N+N+QR  GA + LL+  +++  +PW+NT+ +    YG++ EGWFDPW LLN  R+KAL +GV   +G + +F     ++  A              ++  N  +   ++   VINA+G W+S++A LA   IG S S     L V   KRY++  H  D  P +  P+++DS+GVYFR+E   G +++G SP   +EP+  N++VDY++F  ++WP L  RVP  E+LKVK+AWAGYYDYNT DQN +VG HP + N +   G SGHG+QH+ A+GRA  ELI+ G FQTI+L  F + RFV  E + E NI
Sbjct:   94 WSIAYWLKQKENRRGALRVVVVERDPTYSRASTVLSAGGIRQQFSRPENIHMSLFSAQFLRNINEHLGVVNEDHIDIQFNPSGYLFLASEEGATVMEENYNVQRECGAQVTLLSPHQLKKKFPWVNTNGVALASYGLENEGWFDPWTLLNAFRRKALSMGVYHCHGEVTDFSTTKREMMTADGDPVTFSRIGHVTVLMPNSLESQNVECALVINAAGAWSSNVAELAGIGIGPSDSLESVKLPVEPKKRYIFVVHCPD-GPGLDCPLLIDSSGVYFRREGLGGNYIAGKSPTEEEEPDISNMEVDYDFFQQKVWPLLAHRVPAFESLKVKTAWAGYYDYNTYDQNGVVGMHPLVNNLFFATGFSGHGLQHSPAVGRAVAELIVDGSFQTIDLSSFSFRRFVSEEPLLERNI 503          
BLAST of DAO domain-containing protein vs. Ensembl Xenopus
Match: foxred1 (FAD-dependent oxidoreductase domain containing 1 [Source:NCBI gene;Acc:100125144])

HSP 1 Score: 353.599 bits (906), Expect = 9.952e-117
Identity = 176/411 (42.82%), Postives = 258/411 (62.77%), Query Frame = 3
Query:  189 YSSAYWLK-KENPK--LKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQGLGNKLKRA--------------IIKLNDEKYAEIKFLNVINASGCWASDIAILAERAIGLSGS--DYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKES-SGLFLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            +S AYWLK KEN +  L+++VVE+D  Y + STVLS GG+R QFS  ENI MSLF+   + N+ ++  +  E+++D+QF   GYL L+ +E   ++  N+N+QR  GA + LL+  +++  +PW+NT+ +    YG++ EGWFDPW LLN  R+KAL +GV   +G + +F     ++  A              ++  N  +   ++   VINA+G W+S++A LA   IG S S     L V   KRY++  H  D  P +  P+++DS+GVYFR+E   G +++G SP   +EP+  N++VDY++F  ++WP L  RVP  E+LKVK+AWAGYYDYNT DQN +VG HP + N +   G SGHG+QH+ A+GRA  ELI+ G FQTI+L  F + RFV  E + E NI
Sbjct:   76 WSIAYWLKQKENRRGALRVVVVERDPTYSRASTVLSAGGIRQQFSRPENIHMSLFSAQFLRNINEHLGVVNEDHIDIQFNPSGYLFLASEEGATVMEENYNVQRECGAQVTLLSPHQLKKKFPWVNTNGVALASYGLENEGWFDPWTLLNAFRRKALSMGVYHCHGEVTDFSTTKREMMTADGDPVTFSRIGHVTVLMPNSLESQNVECALVINAAGAWSSNVAELAGIGIGPSDSLESVKLPVEPKKRYIFVVHCPD-GPGLDCPLLIDSSGVYFRREGLGGNYIAGKSPTEEEEPDISNMEVDYDFFQQKVWPLLAHRVPAFESLKVKTAWAGYYDYNTYDQNGVVGMHPLVNNLFFATGFSGHGLQHSPAVGRAVAELIVDGSFQTIDLSSFSFRRFVSEEPLLERNI 485          
BLAST of DAO domain-containing protein vs. Ensembl Xenopus
Match: foxred1 (FAD-dependent oxidoreductase domain containing 1 [Source:NCBI gene;Acc:100125144])

HSP 1 Score: 349.362 bits (895), Expect = 2.800e-115
Identity = 177/414 (42.75%), Postives = 258/414 (62.32%), Query Frame = 3
Query:  189 YSSAYWLK-KENPK--LKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGV-----------------TSINGSLVEFQGLGNKLKRAIIKLNDEKYAEIKFLNVINASGCWASDIAILAERAIGLSGS--DYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKES-SGLFLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            +S AYWLK KEN +  L+++VVE+D  Y + STVLS GG+R QFS  ENI MSLF+   + N+ ++  +  E+++D+QF   GYL L+ +E   ++  N+N+QR  GA + LL+  +++  +PW+NT+ +    YG++ EGWFDPW LLN  R+KAL +GV                  + +G  V F  +G+     ++  N  +   ++   VINA+G W+S++A LA   IG S S     L V   KRY++  H  D P  +  P+++DS+GVYFR+E   G +++G SP   +EP+  N++VDY++F  ++WP L  RVP  E+LKVK+AWAGYYDYNT DQN +VG HP + N +   G SGHG+QH+ A+GRA  ELI+ G FQTI+L  F + RFV  E + E NI
Sbjct:   63 WSIAYWLKQKENRRGALRVVVVERDPTYSRASTVLSAGGIRQQFSRPENIHMSLFSAQFLRNINEHLGVVNEDHIDIQFNPSGYLFLASEEGATVMEENYNVQRECGAQVTLLSPHQLKKKFPWVNTNGVALASYGLENEGWFDPWTLLNAFRRKALSMGVYHCHGEVTGTYTTKREMMTADGDPVTFSRIGHV---TVLMPNSLESQNVECALVINAAGAWSSNVAELAGIGIGPSDSLESVKLPVEPKKRYIFVVHCPDGP-GLDCPLLIDSSGVYFRREGLGGNYIAGKSPTEEEEPDISNMEVDYDFFQQKVWPLLAHRVPAFESLKVKTAWAGYYDYNTYDQNGVVGMHPLVNNLFFATGFSGHGLQHSPAVGRAVAELIVDGSFQTIDLSSFSFRRFVSEEPLLERNI 472          
BLAST of DAO domain-containing protein vs. Ensembl Mouse
Match: Foxred1 (FAD-dependent oxidoreductase domain containing 1 [Source:MGI Symbol;Acc:MGI:2446262])

HSP 1 Score: 294.664 bits (753), Expect = 6.839e-94
Identity = 169/425 (39.76%), Postives = 252/425 (59.29%), Query Frame = 3
Query:  150 ESDIAXXXXXXXXYSSAYWLKKENPK---LKILVVEKDVFY-KQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQGLGNKLKRAI-------------IKLNDE-KYAEIKFLNVINASGCWASDIAILAERAIGLSGS--DYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKESSGL-FLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            ++D+ IIGGGI+G S A+WLKK   +   +++LVVE+D  Y +  ST  SVGG+  QFSV EN+Q+SLF+ + + N+ +Y ++ +   V++QF   G LLL+ ++    L  N  +QR  GA + L++  +++  +PWIN + +    YG++ EGWFD W LL  +R+K   +GV    G +  F      +K                +K++   +Y  ++   VINA+G W+  IA LA    GL G+     L V   KRYV+ +H    P  + TP+V D +GVYFR+E  G  +L G SP   +EP+  NL+VD+++F +++WP L  RVP  + L+V+SAWAGYYDYNT DQN +VG HP + N Y   G SG G+QHA  IGRA  E+++ G F+TI++  F + RF   E + E NI
Sbjct:   63 QADVVIIGGGILGLSVAFWLKKLESRRGAIRVLVVEQDHTYSRASSTGPSVGGIWQQFSVPENVQLSLFSINFLRNINEYLAVVDAPPVELQFNPSGCLLLASEKDAATLENNVKMQRQEGAKVCLMSPEQLQTKFPWINVEGVALASYGLEDEGWFDAWSLLQGLRRKVQSMGVFFCQGEVTRFITSSTPMKTPTGEHVVLRRINNVHVKMDKSLEYQPVECAVVINAAGAWSGKIAELAGVGKGLPGTLQGTKLPVEPRKRYVHLWHCPQGP-GLETPLVADISGVYFRREGLGSNYLGGCSPTEEEEPDPTNLNVDHDFFQNKVWPHLVQRVPSFKTLEVQSAWAGYYDYNTFDQNGVVGPHPLVVNMYFATGFSGRGLQHAPGIGRAVAEIMLEGHFKTIDMSPFLFTRFYLGEKLQEYNI 486          
BLAST of DAO domain-containing protein vs. Ensembl Mouse
Match: Foxred1 (FAD-dependent oxidoreductase domain containing 1 [Source:MGI Symbol;Acc:MGI:2446262])

HSP 1 Score: 287.345 bits (734), Expect = 4.086e-91
Identity = 169/431 (39.21%), Postives = 252/431 (58.47%), Query Frame = 3
Query:  150 ESDIAXXXXXXXXYSSAYWLKKENPK---LKILVVEKDVFY-KQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQGLGNKLKRAI-------------IKLNDE-KYAEIKFLNVINASGCWASDIAILAERAIGLSGS--DYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKESSGL-FLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEA------LKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            ++D+ IIGGGI+G S A+WLKK   +   +++LVVE+D  Y +  ST  SVGG+  QFSV EN+Q+SLF+ + + N+ +Y ++ +   V++QF   G LLL+ ++    L  N  +QR  GA + L++  +++  +PWIN + +    YG++ EGWFD W LL  +R+K   +GV    G +  F      +K                +K++   +Y  ++   VINA+G W+  IA LA    GL G+     L V   KRYV+ +H     P + TP+V D +GVYFR+E  G  +L G SP   +EP+  NL+VD+++F +++WP L  RVP  +       L+V+SAWAGYYDYNT DQN +VG HP + N Y   G SG G+QHA  IGRA  E+++ G F+TI++  F + RF   E + E NI
Sbjct:   63 QADVVIIGGGILGLSVAFWLKKLESRRGAIRVLVVEQDHTYSRASSTGPSVGGIWQQFSVPENVQLSLFSINFLRNINEYLAVVDAPPVELQFNPSGCLLLASEKDAATLENNVKMQRQEGAKVCLMSPEQLQTKFPWINVEGVALASYGLEDEGWFDAWSLLQGLRRKVQSMGVFFCQGEVTRFITSSTPMKTPTGEHVVLRRINNVHVKMDKSLEYQPVECAVVINAAGAWSGKIAELAGVGKGLPGTLQGTKLPVEPRKRYVHLWHCPQG-PGLETPLVADISGVYFRREGLGSNYLGGCSPTEEEEPDPTNLNVDHDFFQNKVWPHLVQRVPSFKTLEHLLHLQVQSAWAGYYDYNTFDQNGVVGPHPLVVNMYFATGFSGRGLQHAPGIGRAVAEIMLEGHFKTIDMSPFLFTRFYLGEKLQEYNI 492          
BLAST of DAO domain-containing protein vs. Ensembl Mouse
Match: Foxred1 (FAD-dependent oxidoreductase domain containing 1 [Source:MGI Symbol;Acc:MGI:2446262])

HSP 1 Score: 93.2041 bits (230), Expect = 3.741e-22
Identity = 52/127 (40.94%), Postives = 76/127 (59.84%), Query Frame = 3
Query:  744 KYAEIKFLNVINASGCWASDIAILAERAIGLSGS--DYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKESSGL-FLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKV 1115
            +Y  ++   VINA+G W+  IA LA    GL G+     L V   KRYV+ +H     P + TP+V D +GVYFR+E  G  +L G SP   +EP+  NL+VD+++F +++WP L  RVP  + L+V
Sbjct:   12 EYQPVECAVVINAAGAWSGKIAELAGVGKGLPGTLQGTKLPVEPRKRYVHLWHCPQ-GPGLETPLVADISGVYFRREGLGSNYLGGCSPTEEEEPDPTNLNVDHDFFQNKVWPHLVQRVPSFKTLEV 137          
BLAST of DAO domain-containing protein vs. Ensembl Mouse
Match: Foxred1 (FAD-dependent oxidoreductase domain containing 1 [Source:MGI Symbol;Acc:MGI:2446262])

HSP 1 Score: 73.559 bits (179), Expect = 9.113e-15
Identity = 49/118 (41.53%), Postives = 77/118 (65.25%), Query Frame = 3
Query:  150 ESDIAXXXXXXXXYSSAYWLKKENPK---LKILVVEKDVFY-KQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQR 491
            ++D+ IIGGGI+G S A+WLKK   +   +++LVVE+D  Y +  ST  SVGG+  QFSV EN+Q+SLF+ + + N+ +Y ++ +   V++QF   G LLL+ ++    L  N  +QR
Sbjct:   63 QADVVIIGGGILGLSVAFWLKKLESRRGAIRVLVVEQDHTYSRASSTGPSVGGIWQQFSVPENVQLSLFSINFLRNINEYLAVVDAPPVELQFNPSGCLLLASEKDAATLENNVKMQR 180          
BLAST of DAO domain-containing protein vs. Ensembl Mouse
Match: Foxred1 (FAD-dependent oxidoreductase domain containing 1 [Source:MGI Symbol;Acc:MGI:2446262])

HSP 1 Score: 73.559 bits (179), Expect = 1.259e-14
Identity = 49/118 (41.53%), Postives = 77/118 (65.25%), Query Frame = 3
Query:  150 ESDIAXXXXXXXXYSSAYWLKKENPK---LKILVVEKDVFY-KQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQR 491
            ++D+ IIGGGI+G S A+WLKK   +   +++LVVE+D  Y +  ST  SVGG+  QFSV EN+Q+SLF+ + + N+ +Y ++ +   V++QF   G LLL+ ++    L  N  +QR
Sbjct:   63 QADVVIIGGGILGLSVAFWLKKLESRRGAIRVLVVEQDHTYSRASSTGPSVGGIWQQFSVPENVQLSLFSINFLRNINEYLAVVDAPPVELQFNPSGCLLLASEKDAATLENNVKMQR 180          
BLAST of DAO domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6DCP1|FXRD1_XENLA (FAD-dependent oxidoreductase domain-containing protein 1 OS=Xenopus laevis OX=8355 GN=foxred1 PE=2 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 8.088e-112
Identity = 190/474 (40.08%), Postives = 283/474 (59.70%), Query Frame = 3
Query:   21 SICIIFQ*SFR*MLTKSYKILSQNFNKYVISKLLCSMSTTVDI---ESDIAXXXXXXXXYSSAYWLK-KENPK--LKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQGLGNKLKRAIIKLNDEK-------YAEIKFLN-----------VINASGCWASDIAILAERAIGLSGS--DYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKES-SGLFLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            S C + Q  F   L +++  L +     + S      + T D+    +D+ I+GGG++G+S AYWLK KEN +  LK++VVE+D  Y + STVLS GG+R QFS  ENIQMSLF+   + N+ ++  +  E+ +D+QF   GYL L+ +E   I+  N+N+QR  GA + L+   +++  +PWINT+ +    YG++ EGWFDPW LLN  R+KAL +GV   +G + +F    +  KR +I  + +        +  ++  N           VINA+G W+S +A LA    G S S     L V   KRYVY  H  + P  +  P+++D++G YFR+E   G +++G SP   +EP+  N++VD+++F  ++WP L  RVP  E+LKVK++WAGYYDYNT DQN +VG HP + N +   G SGHG+QH+ A+GRA  ELI+ G F+T+NL  F + RF   E + E NI
Sbjct:   30 SACALKQDDFIKELDQNFVRLQKKLMDSLPSSDWSPFTPTGDLPPERADVVIVGGGVMGWSIAYWLKQKENRRGALKVVVVERDPTYSRASTVLSAGGIRQQFSRPENIQMSLFSAQFLRNINEHLGVVNEDRIDIQFNPSGYLFLASEEGATIMEENYNVQRECGAQVTLMLPDQLKKKFPWINTNGVALASYGLENEGWFDPWTLLNAFRRKALSMGVYQCHGEVTDF----STAKREMITADGDPVTFSRIGHVTVQMPNSLESQSVECSLVINAAGAWSSKVAELAGIGTGPSNSLEGIKLPVEPKKRYVYVVHCPNGP-GLDCPLLIDNSGAYFRREGLGGNYIAGKSPAEEEEPDISNMEVDHDFFQEKVWPLLAHRVPAFESLKVKTSWAGYYDYNTYDQNGVVGMHPLVNNLFFATGFSGHGLQHSPAVGRAVAELIVDGGFKTLNLSSFSFRRFWSQEPLLERNI 498          
BLAST of DAO domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96CU9|FXRD1_HUMAN (FAD-dependent oxidoreductase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FOXRED1 PE=1 SV=2)

HSP 1 Score: 327.791 bits (839), Expect = 6.002e-106
Identity = 172/410 (41.95%), Postives = 246/410 (60.00%), Query Frame = 3
Query:  192 SSAYWLKKENPK---LKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQGLGNKL-----KRAIIKLNDE---------KYAEIKFLNVINASGCWASDIAILAERAIGLSGS--DYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKESSGL-FLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            S AYWLKK   +   +++LVVE+D  Y Q ST LSVGG+  QFS+ ENIQ+SLF+   + N+ +Y ++ +   +D++F   GYLLL+ ++    +  N  +QR  GA ++L++  ++R+ +PWINT+ +    YG++ EGWFDPW LL  +R+K   LGV    G +  F     ++     K  ++K   E         +Y  ++   VINA+G W++ IA LA    G  G+     L V   KRYVY +H    P  + TP+V D++G YFR+E  G  +L G SP   +EP+  NL+VD+++F  ++WP L  RVP  E LKV+SAWAGYYDYNT DQN +VG HP + N Y   G SGHG+Q A  IGRA  E+++ G FQTI+L  F + RF   E I E+NI
Sbjct:   77 SVAYWLKKLESRRGAIRVLVVERDHTYSQASTGLSVGGICQQFSLPENIQLSLFSASFLRNINEYLAVVDAPPLDLRFNPSGYLLLASEKDAAAMESNVKVQRQEGAKVSLMSPDQLRNKFPWINTEGVALASYGMEDEGWFDPWCLLQGLRRKVQSLGVLFCQGEVTRFVSSSQRMLTTDDKAVVLKRIHEVHVKMDRSLEYQPVECAIVINAAGAWSAQIAALAGVGEGPPGTLQGTKLPVEPRKRYVYVWHCPQGP-GLETPLVADTSGAYFRREGLGSNYLGGRSPTEQEEPDPANLEVDHDFFQDKVWPHLALRVPAFETLKVQSAWAGYYDYNTFDQNGVVGPHPLVVNMYFATGFSGHGLQQAPGIGRAVAEMVLKGRFQTIDLSPFLFTRFYLGEKIQENNI 485          
BLAST of DAO domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5EA45|FXRD1_BOVIN (FAD-dependent oxidoreductase domain-containing protein 1 OS=Bos taurus OX=9913 GN=FOXRED1 PE=2 SV=1)

HSP 1 Score: 324.709 bits (831), Expect = 8.680e-105
Identity = 167/410 (40.73%), Postives = 248/410 (60.49%), Query Frame = 3
Query:  192 SSAYWLK---KENPKLKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQGLGNKLKRAI-------------IKLN-DEKYAEIKFLNVINASGCWASDIAILAERAIGLSGS--DYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKESSGL-FLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            S AYWLK   K+   +++LVVE+D  Y + STVLSVGG+R QFS+ +N+Q+SLF+ + + N+ +Y ++ ++  +D+QF   GYLLL+ +E   I+ RN  +QR  GA + L++  +++  +PWINT+ +    YG++ EGWFDPW LL  +R+K   +GV    G +  F    + ++ A              +K++  +++  ++   V+NA+G W+  IA LA    G  G+     L V   KRYVY +H    P  +  P+V D +G YFR+E  G  ++   SP   +EP+  NL+VDY++F  ++WP+L  RVP  E LKV+SAWAGYYDYNT DQN +VG HP + N Y   G SGHG+Q A A+GRA  E+++ G FQTINL  F ++RF   E   E  I
Sbjct:   77 SVAYWLKRLEKQQGAIRVLVVERDHTYARASTVLSVGGIRQQFSLPQNVQLSLFSAEFLRNINEYLAVVDDPPLDLQFNPSGYLLLASEEGAAIMERNVKMQRQEGAKVCLMSPEQLQKKFPWINTEGVALASYGLENEGWFDPWCLLQGLRRKLQSMGVLFCQGEVTRFISSSSHMETASGEQLTLKRIHEVHVKMDHSQEFQPVECAIVVNAAGAWSGQIAELAGVGNGPPGTMQGTKLPVEPRKRYVYLWHCPQGP-GLEAPLVADPSGAYFRREGLGNNYVGSCSPTEEEEPDPGNLEVDYDFFQEKVWPRLAQRVPAFETLKVRSAWAGYYDYNTFDQNGVVGPHPLVVNMYFATGFSGHGLQQAPAVGRAVAEMVLEGHFQTINLSPFLFSRFYFGEKAQEHCI 485          
BLAST of DAO domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4R510|FXRD1_MACFA (FAD-dependent oxidoreductase domain-containing protein 1 OS=Macaca fascicularis OX=9541 GN=FOXRED1 PE=2 SV=1)

HSP 1 Score: 322.783 bits (826), Expect = 5.186e-104
Identity = 169/410 (41.22%), Postives = 247/410 (60.24%), Query Frame = 3
Query:  192 SSAYWLKK-ENPK--LKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQGLGNKL-------------KRAIIKLNDE-KYAEIKFLNVINASGCWASDIAILAERAIGLSGS--DYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKESSGL-FLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            S AYWLK+ EN +  +++LVVE+D  Y Q ST LSVGG+  QFS+ ENIQ+SLF+   + N+ +Y ++     +D+QF   GYLLL+ ++    +  N  +Q+  GA + L++  ++R+ +PWINT+ +    YG++ EGWFDPW LL+ +R+K + +GV    G +  F     ++                 +K++   +Y  ++   VINA+G W++ IA LA    G  G+     L V   KRYVY +H    P  + TP+V D++G YFR+E  G  +L G SP   +EP+  NL+VD+++F  ++WP L  RVP  E LKV++AWAGYYDYNT DQN +VG HP + N Y   G SGHG+Q A  +GRA  E+I+ G FQTI+L  F +NRF   E   E+NI
Sbjct:   77 SVAYWLKQLENRRGGMRVLVVERDHTYSQASTGLSVGGICQQFSLPENIQLSLFSASFLRNINEYLAVTNAPPLDLQFNPSGYLLLASEKDAAAMESNVKVQKQEGAKVCLMSPDQLRNKFPWINTEGVALASYGMENEGWFDPWCLLHGLRQKLMSMGVFFCQGEVTRFVTSSQRMMTTDDEMVTLKSIHEVHVKMDHSLEYQPVECAIVINAAGAWSAQIAALAGIGKGPPGTLQGTKLPVEPRKRYVYVWHCPQGP-GLETPLVADTSGAYFRREGLGSNYLGGRSPAEEEEPDPANLEVDHDFFQEKVWPHLALRVPAFETLKVQTAWAGYYDYNTFDQNGVVGPHPLVVNMYFATGFSGHGLQQAPGVGRAVAEMILEGSFQTIDLSPFLFNRFYLGEKTQENNI 485          
BLAST of DAO domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3TQB2|FXRD1_MOUSE (FAD-dependent oxidoreductase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Foxred1 PE=1 SV=1)

HSP 1 Score: 294.664 bits (753), Expect = 4.784e-93
Identity = 169/425 (39.76%), Postives = 252/425 (59.29%), Query Frame = 3
Query:  150 ESDIAXXXXXXXXYSSAYWLKKENPK---LKILVVEKDVFY-KQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQGLGNKLKRAI-------------IKLNDE-KYAEIKFLNVINASGCWASDIAILAERAIGLSGS--DYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKESSGL-FLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            ++D+ IIGGGI+G S A+WLKK   +   +++LVVE+D  Y +  ST  SVGG+  QFSV EN+Q+SLF+ + + N+ +Y ++ +   V++QF   G LLL+ ++    L  N  +QR  GA + L++  +++  +PWIN + +    YG++ EGWFD W LL  +R+K   +GV    G +  F      +K                +K++   +Y  ++   VINA+G W+  IA LA    GL G+     L V   KRYV+ +H    P  + TP+V D +GVYFR+E  G  +L G SP   +EP+  NL+VD+++F +++WP L  RVP  + L+V+SAWAGYYDYNT DQN +VG HP + N Y   G SG G+QHA  IGRA  E+++ G F+TI++  F + RF   E + E NI
Sbjct:   63 QADVVIIGGGILGLSVAFWLKKLESRRGAIRVLVVEQDHTYSRASSTGPSVGGIWQQFSVPENVQLSLFSINFLRNINEYLAVVDAPPVELQFNPSGCLLLASEKDAATLENNVKMQRQEGAKVCLMSPEQLQTKFPWINVEGVALASYGLEDEGWFDAWSLLQGLRRKVQSMGVFFCQGEVTRFITSSTPMKTPTGEHVVLRRINNVHVKMDKSLEYQPVECAVVINAAGAWSGKIAELAGVGKGLPGTLQGTKLPVEPRKRYVHLWHCPQGP-GLETPLVADISGVYFRREGLGSNYLGGCSPTEEEEPDPTNLNVDHDFFQNKVWPHLVQRVPSFKTLEVQSAWAGYYDYNTFDQNGVVGPHPLVVNMYFATGFSGRGLQHAPGIGRAVAEIMLEGHFKTIDMSPFLFTRFYLGEKLQEYNI 486          
BLAST of DAO domain-containing protein vs. TrEMBL
Match: A0A1B6F1W8 (DAO domain-containing protein (Fragment) OS=Cuerna arida OX=1464854 GN=g.22005 PE=4 SV=1)

HSP 1 Score: 360.533 bits (924), Expect = 4.986e-117
Identity = 185/406 (45.57%), Postives = 253/406 (62.32%), Query Frame = 3
Query:  192 SSAYWLKKEN-PKLKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQ--------------GLGNKLKRAIIKLNDEKYAEIKFLNVINASGCWASDIAILAERAIGLSGSDYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKE-SSGLFLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            S AYWLK+     L ++V+EKD  Y Q ST LSVGGLR QFS+ ENI+MS+F  + + N+G Y S+  +E  DVQF   GYL L+ ++  +IL RN  LQ+SLGA   LL +++I+  +PW+N D IE G +G++ EGW DPW LL   ++KA+ LG   I G L +F+              G    +  AI+KL D +   I F  ++ A+GC + ++  LA    G      P+ V   KRYVY FH     P + TP+VVD +G+Y R+E +S  +L G SP+  DEP+C+NLDVDY++F+ +IWP L  RVP+ E+LKVKSAWAGYYDYNT D N ++G HP+  N  +  G SGHG+Q A AIGRA MEL+I G ++TI+L R  + R    E + E NI
Sbjct:   21 SIAYWLKQRALSGLHVVVLEKDASYTQASTPLSVGGLRQQFSLPENIEMSVFGAEFMRNIGDYLSVEGQEPPDVQFTPNGYLFLATEKSAHILERNSKLQQSLGAKNELLTQNKIKQKFPWLNVDGIELGCHGLENEGWIDPWSLLMAFKRKAIALGAEYITGELDQFKFRQMTDIVMDNVPLGEYEGINEAIVKLPDGRTESITFSQLVIAAGCRSGEVGQLARMGNGPGFLCLPIPVEPRKRYVYCFHCPGG-PGLKTPLVVDPSGMYVRREGTSDNYLCGRSPDPEDEPSCENLDVDYDYFNEKIWPTLANRVPVFESLKVKSAWAGYYDYNTFDNNALIGPHPSYMNVLIATGCSGHGLQQAPAIGRAIMELMIDGHYKTIDLTRMQFERIFHEEYLLEDNI 425          
BLAST of DAO domain-containing protein vs. TrEMBL
Match: A0A1B6JCU1 (DAO domain-containing protein OS=Homalodisca liturata OX=320908 GN=g.13225 PE=4 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 2.665e-114
Identity = 200/458 (43.67%), Postives = 279/458 (60.92%), Query Frame = 3
Query:   60 LTKSYKILSQNFNKYVISKLLCSMSTTVDIES--------DIAXXXXXXXXYSSAYWLKKEN-PKLKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQ--------------GLGNKLKRAIIKLNDEKYAEIKFLNVINASGCWASDIAILAERAIGLSGSDYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKE-SSGLFLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            L K+ +IL  +  KY+I KL+   +T  +++         D+ I+GGG+IG S AYWLK+     L ++V+EKD  Y Q ST LSVGGLR QFS+ ENI+MS+F  + + N+G Y ++   E  +VQF   GYL L+ ++  +IL RN  LQ+SLGA   LL +++I+  +PW+N D IE G +G++ EGW DPW LL   +KKA+ LG   I G L  F+              G    L  AI+ L D +   I F  ++ A+GC + ++  LA    G      P+ V   KRYVY FH    P  + TP+VVD +G Y R+E +S  +L G SP+  DEP+C+NL+VDY++F+ +IWP L  RVP+ E+LKVKSAWAGYYDYNT D+N ++G HP+  N  +  G SGHG+Q A AIGRA MEL+I G ++TI+L R  + R    E + E NI
Sbjct:   64 LRKTMRILKSDM-KYLI-KLIDGQATVENLKPSDHFPNHCDVLIVGGGVIGSSIAYWLKQRALSGLHVVVLEKDASYTQASTPLSVGGLRQQFSLPENIEMSVFGAEFMRNIGDYLTVEGHEPPNVQFTPNGYLFLATEKSAHILERNSKLQQSLGAKNELLTQNKIKKKFPWLNVDGIELGCHGLENEGWIDPWSLLMAFKKKAIALGAEYITGDLDHFKFRRMSDIVMDNIPLGEYEGLNEAIVTLPDGQTESITFSQLVIAAGCRSGEVGQLARMGNGPGFLGLPIPVEPRKRYVYCFHCPGGP-GLKTPLVVDPSGTYVRREGTSDNYLCGRSPDAEDEPSCENLEVDYDYFNEKIWPTLANRVPVFESLKVKSAWAGYYDYNTFDKNALIGPHPSYMNVLIATGCSGHGLQQAPAIGRAIMELMIDGHYKTIDLTRMQFERIFHEEYLLEDNI 518          
BLAST of DAO domain-containing protein vs. TrEMBL
Match: F6TNC8 (DAO domain-containing protein OS=Xenopus tropicalis OX=8364 GN=cntd2 PE=4 SV=1)

HSP 1 Score: 354.369 bits (908), Expect = 3.177e-114
Identity = 176/411 (42.82%), Postives = 258/411 (62.77%), Query Frame = 3
Query:  189 YSSAYWLK-KENPK--LKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQGLGNKLKRA--------------IIKLNDEKYAEIKFLNVINASGCWASDIAILAERAIGLSGS--DYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKES-SGLFLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            +S AYWLK KEN +  L+++VVE+D  Y + STVLS GG+R QFS  ENI MSLF+   + N+ ++  +  E+++D+QF   GYL L+ +E   ++  N+N+QR  GA + LL+  +++  +PW+NT+ +    YG++ EGWFDPW LLN  R+KAL +GV   +G + +F     ++  A              ++  N  +   ++   VINA+G W+S++A LA   IG S S     L V   KRY++  H  D P  +  P+++DS+GVYFR+E   G +++G SP   +EP+  N++VDY++F  ++WP L  RVP  E+LKVK+AWAGYYDYNT DQN +VG HP + N +   G SGHG+QH+ A+GRA  ELI+ G FQTI+L  F + RFV  E + E NI
Sbjct:   45 WSIAYWLKQKENRRGALRVVVVERDPTYSRASTVLSAGGIRQQFSRPENIHMSLFSAQFLRNINEHLGVVNEDHIDIQFNPSGYLFLASEEGATVMEENYNVQRECGAQVTLLSPHQLKKKFPWVNTNGVALASYGLENEGWFDPWTLLNAFRRKALSMGVYHCHGEVTDFSTTKREMMTADGDPVTFSRIGHVTVLMPNSLESQNVECALVINAAGAWSSNVAELAGIGIGPSDSLESVKLPVEPKKRYIFVVHCPDGP-GLDCPLLIDSSGVYFRREGLGGNYIAGKSPTEEEEPDISNMEVDYDFFQQKVWPLLAHRVPAFESLKVKTAWAGYYDYNTYDQNGVVGMHPLVNNLFFATGFSGHGLQHSPAVGRAVAELIVDGSFQTIDLSSFSFRRFVSEEPLLERNI 454          
BLAST of DAO domain-containing protein vs. TrEMBL
Match: F6XJA2 (DAO domain-containing protein OS=Xenopus tropicalis OX=8364 GN=dach2 PE=4 SV=2)

HSP 1 Score: 353.984 bits (907), Expect = 6.699e-114
Identity = 176/411 (42.82%), Postives = 258/411 (62.77%), Query Frame = 3
Query:  189 YSSAYWLK-KENPK--LKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQGLGNKLKRA--------------IIKLNDEKYAEIKFLNVINASGCWASDIAILAERAIGLSGS--DYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKES-SGLFLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            +S AYWLK KEN +  L+++VVE+D  Y + STVLS GG+R QFS  ENI MSLF+   + N+ ++  +  E+++D+QF   GYL L+ +E   ++  N+N+QR  GA + LL+  +++  +PW+NT+ +    YG++ EGWFDPW LLN  R+KAL +GV   +G + +F     ++  A              ++  N  +   ++   VINA+G W+S++A LA   IG S S     L V   KRY++  H  D  P +  P+++DS+GVYFR+E   G +++G SP   +EP+  N++VDY++F  ++WP L  RVP  E+LKVK+AWAGYYDYNT DQN +VG HP + N +   G SGHG+QH+ A+GRA  ELI+ G FQTI+L  F + RFV  E + E NI
Sbjct:   64 WSIAYWLKQKENRRGALRVVVVERDPTYSRASTVLSAGGIRQQFSRPENIHMSLFSAQFLRNINEHLGVVNEDHIDIQFNPSGYLFLASEEGATVMEENYNVQRECGAQVTLLSPHQLKKKFPWVNTNGVALASYGLENEGWFDPWTLLNAFRRKALSMGVYHCHGEVTDFSTTKREMMTADGDPVTFSRIGHVTVLMPNSLESQNVECALVINAAGAWSSNVAELAGIGIGPSDSLESVKLPVEPKKRYIFVVHCPD-GPGLDCPLLIDSSGVYFRREGLGGNYIAGKSPTEEEEPDISNMEVDYDFFQQKVWPLLAHRVPAFESLKVKTAWAGYYDYNTYDQNGVVGMHPLVNNLFFATGFSGHGLQHSPAVGRAVAELIVDGSFQTIDLSSFSFRRFVSEEPLLERNI 473          
BLAST of DAO domain-containing protein vs. TrEMBL
Match: A0A5G3JTX1 (DAO domain-containing protein OS=Xenopus tropicalis OX=8364 GN=foxred1 PE=4 SV=1)

HSP 1 Score: 354.369 bits (908), Expect = 1.547e-113
Identity = 176/411 (42.82%), Postives = 258/411 (62.77%), Query Frame = 3
Query:  189 YSSAYWLK-KENPK--LKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQGLGNKLKRA--------------IIKLNDEKYAEIKFLNVINASGCWASDIAILAERAIGLSGS--DYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKES-SGLFLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            +S AYWLK KEN +  L+++VVE+D  Y + STVLS GG+R QFS  ENI MSLF+   + N+ ++  +  E+++D+QF   GYL L+ +E   ++  N+N+QR  GA + LL+  +++  +PW+NT+ +    YG++ EGWFDPW LLN  R+KAL +GV   +G + +F     ++  A              ++  N  +   ++   VINA+G W+S++A LA   IG S S     L V   KRY++  H  D  P +  P+++DS+GVYFR+E   G +++G SP   +EP+  N++VDY++F  ++WP L  RVP  E+LKVK+AWAGYYDYNT DQN +VG HP + N +   G SGHG+QH+ A+GRA  ELI+ G FQTI+L  F + RFV  E + E NI
Sbjct:   94 WSIAYWLKQKENRRGALRVVVVERDPTYSRASTVLSAGGIRQQFSRPENIHMSLFSAQFLRNINEHLGVVNEDHIDIQFNPSGYLFLASEEGATVMEENYNVQRECGAQVTLLSPHQLKKKFPWVNTNGVALASYGLENEGWFDPWTLLNAFRRKALSMGVYHCHGEVTDFSTTKREMMTADGDPVTFSRIGHVTVLMPNSLESQNVECALVINAAGAWSSNVAELAGIGIGPSDSLESVKLPVEPKKRYIFVVHCPD-GPGLDCPLLIDSSGVYFRREGLGGNYIAGKSPTEEEEPDISNMEVDYDFFQQKVWPLLAHRVPAFESLKVKTAWAGYYDYNTYDQNGVVGMHPLVNNLFFATGFSGHGLQHSPAVGRAVAELIVDGSFQTIDLSSFSFRRFVSEEPLLERNI 503          
BLAST of DAO domain-containing protein vs. Ensembl Cavefish
Match: foxred1 (FAD dependent oxidoreductase domain containing 1 [Source:NCBI gene;Acc:103034571])

HSP 1 Score: 327.791 bits (839), Expect = 1.008e-106
Identity = 175/411 (42.58%), Postives = 249/411 (60.58%), Query Frame = 3
Query:  189 YSSAYWLKKE---NPKLKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQGL--------GNKLKRAIIKL------NDEKYAEIKFLNVINASGCWASDIAILAERAIGL--SGSDYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKES-SGLFLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            +S AYWLKK+      +++L+VEKD  Y Q STVLS GG+R QFS++ENI +SL + D + N+ ++  +  E+ VD+QF   GYL L+ +   +I+  N+  QR LGA + LL+ +++++ +PWINTDD+    YG++ EGWFDPW LLN  R+KAL +GV    G +  F           G  L    IK       N  +Y  ++   VINA+G  +  IA +     G   S +  PL V   KRYVY  H  D P  +  P ++D +GVYFR+E   G +++G SPE  +EP+  +L+VD+E+F  ++WP L  RVP  E LKV SAWAG+YDYNT DQN IVG HP + N +   G SGHG+Q + A+GRA  EL++ G+F+TI+L  F   R +  E + E+NI
Sbjct:   91 WSVAYWLKKKERVRDGVRVLLVEKDPSYSQASTVLSAGGIRQQFSLKENILLSLASADFMKNINEHLGVVNEDPVDLQFNHSGYLFLANENVAHIMEENYVTQRDLGAKVALLSPTQLKERFPWINTDDVALASYGLENEGWFDPWTLLNAFRRKALSMGVYQCFGEVTGFTCSTQTAETTDGEMLNVKRIKYINVRMPNSLEYQPVECAVVINAAGAGSGKIAEMVGIGKGPEHSVASVPLPVEPRKRYVYVVHCPDGP-GLECPFLIDYSGVYFRREGLGGNYIAGKSPEEAEEPDVSDLEVDHEFFQEKVWPLLCHRVPSFERLKVSSAWAGFYDYNTFDQNAIVGVHPLVNNMFHATGFSGHGLQQSPAVGRAVAELVLDGDFKTIDLSAFDLRRLIYQEPVLENNI 500          
BLAST of DAO domain-containing protein vs. Ensembl Cavefish
Match: sardh (sarcosine dehydrogenase [Source:NCBI gene;Acc:103038491])

HSP 1 Score: 69.707 bits (169), Expect = 3.601e-12
Identity = 77/339 (22.71%), Postives = 140/339 (41.30%), Query Frame = 3
Query:  393 EENVDVQFIKRGYLLL-SQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVT-----SINGSLVEFQGLGNKLKRAIIKLNDEKYAEIKFLNVINASGCWASDIAILAERAIGLSGSDYPLHVTKAKRYV-YNFHVADFPPTIITPMVVDSTGVYFRKESSGLFLSGLS------PETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYG----EFQTINLERFHYNRFVKNELIFESN 1358
            E  ++  +I+ G L + S K++ +   R  +L +  G    +L+ +E +D +P +N  D+   +Y +  +G  DP      + + A   G T      + G  V    LG +  R +    +  +  I+   V+N +G WA+ +  +A   + L    +   VT+    +   FH        +T M      VY R +   L + G         E  D+      D+D++ F   I   +  RVP +E   +KS   G   + T D   ++G+ P +  F+L  G +  G+      G+     II+G    +    ++ RFH++    N  I E +
Sbjct:  137 ETGLETGWIQNGGLFIASNKQRLDEYKRLMSLGKVYGIESYVLSPAETKDLYPLMNVKDLYGTLY-VPKDGTMDPAGTCTTLSRAATARGATVIENCQVTGIQVHTDDLGVRRVRGV----ETDFGTIETPCVVNCAGVWATKLGEMAGVKVPLIAMHHAYVVTERIEGIQVVFHAR------LTSMRDHDASVYLRLQGDALSVGGYEQNPIFWEEVSDKFAFSLFDLDWDVFMQHIEGAIN-RVPALEQTGIKSTVCGPESF-TADHKPLMGEAPEVRGFFLGCGFNSAGMMLGGGCGKELAHWIIHGRPEKDMYGYDIRRFHHSLSSNNRWIRERS 462          
BLAST of DAO domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005532.1 (pep scaffold:Pmarinus_7.0:GL482206:757:4324:1 gene:ENSPMAG00000005033.1 transcript:ENSPMAT00000005532.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.05 bits (362), Expect = 4.110e-41
Identity = 75/164 (45.73%), Postives = 104/164 (63.41%), Query Frame = 3
Query:  873 KRYVYNFHVADFPPTIITPMVVDSTGVYFRKES-SGLFLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
             RYVY FH  D P  +  P+VVD +G YFR+E  +G ++ G+SP   +EP+ DNLDVDY++F  ++WP L  RVP  ++LKV+SAWAGYY++N  D N ++G  P + N     G SGHG+QHA A GRA  E++  GE  T++L R    R +  E + E  I
Sbjct:    2 PRYVYVFHCPDGP-GLDCPLVVDPSGAYFRREGITGNYIGGMSPPPDEEPSVDNLDVDYDYFQEKVWPLLAHRVPAFQSLKVRSAWAGYYEHNEFDSNGVIGFLPEVPNLLHVGGFSGHGLQHAAAAGRAAAEILADGELTTLDLRRLAPMRILDGEPLLEDYI 164          
BLAST of DAO domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007768.1 (pep scaffold:Pmarinus_7.0:GL477155:1317:9408:-1 gene:ENSPMAG00000007021.1 transcript:ENSPMAT00000007768.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 138.658 bits (348), Expect = 9.604e-38
Identity = 75/184 (40.76%), Postives = 122/184 (66.30%), Query Frame = 3
Query:  150 ESDIAXXXXXXXXYSSAYWLKKENPKLK----ILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLL-SQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLV 686
            E+D+ ++GGG++G+S+AYWL ++   L+    +L+VEKD  YK+ S+VL+VGG+R QFS+ ENI MS++    + N+  + +I  E+  +V F   GYL+L S+KE   +  ++ NL R     ++LL+ ++++  +PWINT+ I    YG++ EGWFDPW LL  +R+KAL +GV   +G + 
Sbjct:  106 ETDVVVVGGGVMGWSTAYWLARKGTTLRKRQRVLLVEKDPQYKRASSVLAVGGIRQQFSLPENIHMSMYGAFFLRNIKDHLTIPGEDPPEVFFNPSGYLMLASEKEAAAMEEKHRNLLRE-KCKVDLLSPTQLKTKFPWINTEGIALATYGLENEGWFDPWALLQALRRKALSMGVYYYSGEVT 288          
BLAST of DAO domain-containing protein vs. Ensembl Sea Lamprey
Match: dmgdh (dimethylglycine dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-080227-8])

HSP 1 Score: 64.6994 bits (156), Expect = 3.038e-11
Identity = 84/351 (23.93%), Postives = 142/351 (40.46%), Query Frame = 3
Query:  375 YFSIGEEENVDVQFIKRGYL-LLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGV-----TSINGSLVEFQGLGNKLKRAIIKLNDEKYAEIKFLNVINASGCWASDIAILAERAIGLSGSDYPLHVTKAKRYVYNF---HVADFPPTIITPMVVDSTGVYF-RKESSGLFLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYF-------------------RVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGE--FQTINLERFHYNRFVK 1334
            Y  +  E    V F + G + L +  E+ +  H      R      +L+   +I++ +P +N D +  G+Y    +G  DP+ L   +   A Q GV       + G     QG  +             +  I+   VIN +G WA ++     R +GL     P+H     +YV       VA  P  +  P++ D  G Y+ R+E  GL             + + + +  EW +  + PK +                    RVP+++  ++ S  AG   Y T D   ++G H  + N+++  G  G+GI HA  +G+   + I+ G+  F  I L+    NRF K
Sbjct:   78 YEQLERETGQAVGFHQPGSIRLATTPERVDEFHYQMTRARWNVTPQSLIGPDKIQELFPLLNMDQVLAGIYN-PGDGHIDPYSLTMALAAGARQRGVRISQPAPVTGLTPTPQGHWDV---------HTPHGTIRAQRVINCTGFWAREVG----RLVGLEHPLVPIH----HQYVVTATIPEVAALPREL--PVIRDLEGSYYLRQERQGLLFGPYE-------SAERMKIQEEWLESGV-PKDFGKELFESDLERIPHMEAAMQRVPVLQKAEIVSVVAGPITY-TPDLLPMLGPHVGLANYWVAVG-FGYGIIHAGGVGKYLSDWIMKGQPPFDLIELDP---NRFGK 395          
BLAST of DAO domain-containing protein vs. Ensembl Nematostella
Match: EDO27778 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8B3])

HSP 1 Score: 308.145 bits (788), Expect = 4.467e-101
Identity = 159/392 (40.56%), Postives = 228/392 (58.16%), Query Frame = 3
Query:  192 SSAYWLKKENPKLKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQGLGNKLKRAIIKLNDEKYAE--IKFLNVINASGCWASDIAILAERAIGLSGSDYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKESSGLFLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            SSA+ +   +P  ++ V+E+D  Y +CS+ LSVGG+R QFS+ ENIQ+S ++    + + K+ ++   +  D+   +  Y++L+ KE  + L  N+ LQR LG  + LL+   +   +PW+NTDDI+ G  G DCEG FDPW LL+  +KK++ LGV  I+          +K+    I  + +  A   ++   V+N +G WA  IA  A       G D P  V   KRYV+ F   D P    T + VD TGVYFR E  G ++ GLSP   +EP+  +L+VDY++F  +IWP L  RVP  E +K++ AWAGYYDYN  DQN ++G+HP + N     G SGHGIQ + A+GRA  ELI+  EF TI+L    Y R + N  I E NI
Sbjct:    4 SSAFHIASRDPTKRVCVIERDPGYSKCSSTLSVGGIRQQFSMAENIQLSQYSYKFFTEVSKHLTVDPADPADIHLRRGAYVMLASKEGVSTLMENYKLQRDLGCHIKLLDNHGLHKRYPWMNTDDIKLGSVGFDCEGCFDPWALLSSFKKKSISLGVQYIHAEATGMMVSDDKIAGIQIAPSSQPDARYTLRCDTVVNCAGPWAGRIARQA-------GIDLP--VEPRKRYVFVFKCPDQPIRENT-LFVDRTGVYFRPEPQG-YICGLSPNEDEEPDVADLEVDYDFFTEKIWPVLAHRVPAFECIKIQGAWAGYYDYNVLDQNAVIGRHPKLSNMIFATGFSGHGIQQSPAVGRAVSELILDQEFTTIDLRNMGYERVINNAPIREKNI 384          
BLAST of DAO domain-containing protein vs. Ensembl Nematostella
Match: EDO46472 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ00])

HSP 1 Score: 77.7962 bits (190), Expect = 3.970e-15
Identity = 83/339 (24.48%), Postives = 152/339 (44.84%), Query Frame = 3
Query:  375 YFSIGEEENVDVQFIKRGYLLLSQ-KEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGV-----TSINGSLVEFQGLGNKLKRAIIKLNDEKYAEIKFLNVINASGCWASDIAILAERAIGLSGSDYPLHVTKAKRYVYNFHVADFP--PTIITPMVVDSTG-VYFRKESSGLFLSGLSPE-----THDEPNCDNLDV---DYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGE----FQTINLERF--HYN 1322
            Y  +  E   +  F K G LLL++ +++  +L R     R+ G  L+L++  E ++ +P++  DD++  ++  D EG   P  L +   K A   GV     T+I   L +         R +  +  +K  +I     +N +G WA  + +     + +     PLH       V +F++   P   + + PM+ D  G VYFR+   G+   GL P      T   P      +   D++ F+  +  ++  R+P ME  +++    G   + T D   I+G+ P + N+++  G+  +GI +A  +GR   E I  G        ++++RF  H+N
Sbjct:   74 YSQLERETGQETGFKKCGGLLLARTRDRFTLLKRMLVKARAFGIELDLISPEEAKEKFPFMRADDVKGALWLPD-EGVISPSDLCSSFGKGATLNGVKIHQKTAIAEVLTD--------GRDVTGVRTDK-GDISCQIFVNCAGMWARQLGLKCASPVHI-----PLHP------VEHFYIITQPIGASHMLPMLRDPDGHVYFREWGGGICAGGLEPIAKPVFTQGVPRHFEFQLFQEDWDQFEC-LMGEIIHRIPEMERTEIRQMVNGPESF-TPDGRCIMGEAPNVRNYFVAAGACTNGIANAAGVGRLLSEWITKGRPPLNVSCLDIKRFSHHHN 389          
BLAST of DAO domain-containing protein vs. Ensembl Nematostella
Match: EDO41600 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3V0])

HSP 1 Score: 70.4774 bits (171), Expect = 6.463e-13
Identity = 86/362 (23.76%), Postives = 160/362 (44.20%), Query Frame = 3
Query:  312 SVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQ-KEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPW-INTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQGLGNKLKRAIIKLNDEKYAEIKFLNVINASGCWASDIAILAERAIGLSGSDYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTG-VYFRKESSGLFLSGLSPET----HDE-PNCDNLDVDYEWFDH--EIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYG----EFQTINLERF--HYN--RFVKNEL 1343
            S     Q+S + TD+ S L       EE  +   F   G + L++ KE+  +  RN    ++      L++    ++ WP  +N DDI+ G++ +  EG  +P  +   + + A+  GV       V+ Q +    +       D+   +IK    IN +G WA ++   +  A+ +     P+H  +   Y+    V     T+  P + D  G +YFR+ S GL   G  P +    H+  P+     +  E +DH   +  ++  RVP +   +++    G   + T D   I+G+ P + N+++  G    GI  A  +G+A  E I  G    +   +++ RF  H+N  +F+++ +
Sbjct:    3 STMAETQLSNYGTDLYSRLE------EETGLGTGFKTLGGVYLARTKERMTLYKRNLAKCQAYDIKAELISPQRCQELWPVELNLDDIQGGLW-VPEEGVANPSDICQSLARGAIMNGVRIYEK--VQLQSVTTDGQYVDGVKTDK--GDIKCDIFINCAGQWAREVGQKSSPAVSV-----PIHACE-HFYIVTKTVEGVHSTL--PNMRDPDGHIYFREWSGGLMAGGFEPVSKPCFHESVPDKFEFQLLPEDWDHFEVLMEQMLHRVPALHNAEIRQLVNGPESF-TPDGQYILGEAPEVRNYFVAAGMCSSGIASAAGVGKALSEWITEGHPTMDLWPVDIRRFGNHFNNKQFLRDRV 344          
BLAST of DAO domain-containing protein vs. Ensembl Nematostella
Match: EDO32193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVT6])

HSP 1 Score: 65.4698 bits (158), Expect = 3.060e-11
Identity = 105/419 (25.06%), Postives = 175/419 (41.77%), Query Frame = 3
Query:  126 SMSTTVDIESDIAXXXXXXXXYSSAYWLKKENPKLKILVVEKDVFYKQCSTVLSVGGL--RLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQ-KEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYG-----IDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQGLGNKLKRAIIKLN--DEKYAEIKFLNVINASGCWASDIAILAERAIGLSGSDYPLHVTKAKRYVYNFHVADFPPTIITPMVVD-STGVYFRKESSGLFLSGL--SPETHDEPNCDN-----LDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYG----EFQTINLERFH 1316
            S  ++V  E+D+ +IGGG +G S+ Y L K   K  ++++E+D       T     GL  RL+ S QE +++     D+        S+ EE  V   +I+ G L ++  KE+ +   R   L    G   ++L+    ++ +P +N  D+   +Y      ID  GW    L     ++ A       + G   E    G      +++++  D     IK  NV+N  GCWA  +  +A       G   PL V     Y+ +  +         P V D    VY + +  GL + G   +P   +  +  N      D+D++ F   I      RVP++    VKS   G   + T D   ++G+ P +  FYL  G +  GI  A   GR   + ++ G    +    ++ RFH
Sbjct:   53 STPSSVPAEADVVVIGGGSVGTSTLYHLTKMGVK-NVILLERDKL--TSGTTWHSAGLLWRLRPSDQE-VEIIGHTRDLAK------SLEEETGVSPGWIENGGLFIANNKERLDEYKRLMTLGHCYGIDSHVLDPKATKELYPLMNVKDLYGTLYSPGDGTIDPAGWASA-LTRGATKRGAKVFENCPVTGITTEVDDFG------VLRVSGIDTVAGHIKTKNVVNCGGCWAPAVGAMA-------GVKVPL-VAMHHAYIVSERIEGIQS---MPNVRDHDASVYLKLQGDGLSIGGYEQNPIFWENVSVRNFAFSLFDLDWDVFSVHIEGACN-RVPVIAETGVKSTVCGPESF-TSDHKPLMGEAPELRGFYLGCGFNSAGIMLAGGCGRELAKWVVNGHPELDMYGYDIRRFH 441          
BLAST of DAO domain-containing protein vs. Ensembl Medaka
Match: foxred1 (FAD dependent oxidoreductase domain containing 1 [Source:NCBI gene;Acc:101166734])

HSP 1 Score: 342.813 bits (878), Expect = 1.892e-112
Identity = 173/411 (42.09%), Postives = 262/411 (63.75%), Query Frame = 3
Query:  189 YSSAYWLKKE---NPKLKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQGLGN-------------KLKRAIIKL-NDEKYAEIKFLNVINASGCWASDIAILAERAIGL--SGSDYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKES-SGLFLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            +S AYWLK++      ++++VVE+D  Y Q STVLSVGG+R QFS+ ENI +SL + D + N+  +  +  EE VD+QF   GYL L+ ++  +I+  N+N QR  GA ++LL+ +++++ +PWINT+ +    YG++ EGWFDPW LLN  ++KA+ +GVT   G +  F+ L N             ++K   +++ N  +Y  +    V+NA+G ++  +A +    +G   S S  P+ V   KRYVY  H  D P  + TP+++D +GVYFR+E   G +++G+SPE  +EP+ ++L+VD+++F  ++WPKL  RVP  E LKV SAWAG+YDYNT DQN I+G HP I N Y   G SGHG+QH+ A+GRA  ELI+ G F+T++L  F + R V+ E + E NI
Sbjct:  100 WSIAYWLKQKERVRGGVQVIVVERDPTYTQASTVLSVGGIRQQFSLLENIHLSLASADFMRNINDHLGVLNEEPVDLQFNHSGYLFLANEKVAHIMEENYNTQRLAGAKVSLLSPTQVKEKFPWINTEGVALASYGLENEGWFDPWTLLNAFKRKAISMGVTQFCGEVTGFKTLTNIMTTIDDEKVGVQRIKSVKVQMPNSLQYQLVDCAVVVNAAGAFSGKLAEMLGIGLGPKDSFSGIPVPVEPRKRYVYVVHCPDGP-GLDTPLLIDYSGVYFRREGLGGNYITGMSPEEVEEPDTNDLEVDHQFFQDKVWPKLANRVPAFEKLKVSSAWAGFYDYNTFDQNGIIGMHPLINNMYFATGFSGHGLQHSPAVGRAVAELILDGNFKTLDLSNFGFKRIVEQEPMLERNI 509          
BLAST of DAO domain-containing protein vs. Ensembl Medaka
Match: sardh (sarcosine dehydrogenase [Source:NCBI gene;Acc:101171504])

HSP 1 Score: 76.6406 bits (187), Expect = 2.221e-14
Identity = 89/389 (22.88%), Postives = 162/389 (41.65%), Query Frame = 3
Query:  234 ILVVEKDVFYKQCSTVLSVGGLRLQFSVQE-NIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLL-SQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSI-NGSLVEFQGLGNKLKRAIIKLNDEKYAEIKFLNVINASGCWASDIAILAERAIGLSGSDYPLHVTKAKRYVYNFHVADFPPTIITPMVVD-STGVYFRKESSGLFLSGLS------PETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYG----EFQTINLERFHYNRFVKNELIFESN 1358
            ++++E+D       T     GL  Q    +  +++     +VIS       + EE  +   +I+ G L + S K++ +   R  +L +  G    +L+ +E +D +P +N DD+   +Y +  +G  DP      + + A   G T I N  +   Q   + L    +K  +  +  I+   V+N +G WA+ +  +A   + L    +   VT+    + N            P V D    VY R +   L + G         E +D+      D+D++ F   I   +  RVP++E   +KS   G   + T D   ++G+ P +  F+L  G +  G+      GR     II+G    +    ++ RFH++    N  I E +
Sbjct:   90 VVLLERDRL--TAGTTWHTAGLLWQLRPSDVEVELLAHTRNVISK-----DLEEETGLHTGWIQNGGLFIASNKQRLDEYKRLMSLGKVYGIESYVLSPAETKDLYPLMNVDDLYGTLY-VPKDGTMDPAGTCTTLTRAASARGATVIENCPVTGIQVRTDDLGVKKVKAVETAHGTIETQCVVNCAGVWATKLGDMAGVKVPLIAMHHAYVVTERIEGIQNM-----------PNVRDHDASVYLRLQGDALSVGGYEQNPIFWEEVNDKFAFSLFDLDWDVFMQHIEGAIN-RVPVLEQTGIKSTVCGPESF-TADHKPLMGEAPEVRGFFLGCGFNSAGMMLGGGCGRELAHWIIHGRPERDMYGYDIRRFHHSLTDNNRWIRERS 457          
BLAST of DAO domain-containing protein vs. Planmine SMEST
Match: SMESG000037253.1 (SMESG000037253.1)

HSP 1 Score: 826.624 bits (2134), Expect = 0.000e+0
Identity = 409/411 (99.51%), Postives = 411/411 (100.00%), Query Frame = 3
Query:  129 MSTTVDIESDIAXXXXXXXXYSSAYWLKKENPKLKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQGLGNKLKRAIIKLNDEKYAEIKFLNVINASGCWASDIAILAERAIGLSGSDYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKESSGLFLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            MSTTVD+ESDIAIIGGGIIGYSSAYWLKKENPKLKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNR+EIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQGLGNKLKRAIIKLNDEKYAEIKFLNVINASGCWASDIAILAERAIGLSGSDYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKESSGLFLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI
Sbjct:    1 MSTTVDVESDIAIIGGGIIGYSSAYWLKKENPKLKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRAEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQGLGNKLKRAIIKLNDEKYAEIKFLNVINASGCWASDIAILAERAIGLSGSDYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVYFRKESSGLFLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 411          
BLAST of DAO domain-containing protein vs. Planmine SMEST
Match: SMESG000009521.1 (SMESG000009521.1)

HSP 1 Score: 266.544 bits (680), Expect = 5.077e-83
Identity = 165/448 (36.83%), Postives = 246/448 (54.91%), Query Frame = 3
Query:  129 MSTTVDIESDIAXXXXXXXXYSSAYWLKKENPKLKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDVISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAALNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQLGVTSINGSLVEFQ---------------GLGNKLKRAIIKLNDEKYAEIKFLNVINASGCWASDIA-ILAERAIGLSGSDYPLHVTKAKRYVYNFHVADFP--------PTIITPMVVDSTGVYFRKESSG------LFLSGLSPETHDEPNCDN-------LDVDYEWFDHEIWPKLYFRVPLMEALKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGRANMELIIYGEFQTINLERFHYNRFVKNELIFESNI 1361
            + + +  E DI IIGGGIIG+S AY+++ ++  + + VVE+D  + +C+TVL +GG+R QFS  ENIQMSLF  + + N+ ++ SI + +  D+QF   G+L L+ +     L   F +QR LGA +  L++ +I+  WPW+   DI  G++G + EGWFDPW L+N +++KA  LGV  I G ++ F+                +  K   A+++L +     ++F  VINA G WA D++ +L    I   G   PL V    R  ++F V+           P I  P +VD  G+  R++  G      L    LS         D+       L V+Y+ F+  I   L  RVP M   KV+S WA Y DYN  DQNLI+G HP + N    NGSSGHGI+H++AIGRA  ELI +G++++I L  F  +RF +N  +FE  +
Sbjct:   66 LDSLIPREVDILIIGGGIIGWSIAYFIR-QHAMMNVAVVERDPSHTRCATVLGIGGIRQQFSEPENIQMSLFGAEFLRNVREHLSILDCDPPDIQFHPHGFLTLASQNGVGQLKHCFEVQRKLGAKVEFLSQDDIKSIWPWMEVSDIGGGIHGFENEGWFDPWQLMNSMQRKASSLGVHKILGEVIGFEFEELNTISGPKITEANMRRKPINALVRLINGNIQPVQFSFVINAGGPWAGDVSRLLGMGEINSDGGLLPLPVE--PRVQHSFVVSPVAASSQSGCVPGIDCPFIVDYNGLNIRRDRLGGDFITFLDTPPLSKHYQRPAKADDHVVGESGLTVNYDLFESRIRSLLAKRVPSMATAKVRSGWASYLDYNYIDQNLIIGNHPVLLNVLFANGSSGHGIEHSVAIGRAIYELIFFGQYKSIELRNFSMDRFYENTPVFEKEV 510          
The following BLAST results are available for this feature:
BLAST of DAO domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOXRED11.110e-10641.95FAD dependent oxidoreductase domain containing 1 [... [more]
FOXRED11.250e-10641.95FAD dependent oxidoreductase domain containing 1 [... [more]
FOXRED13.368e-1741.28FAD dependent oxidoreductase domain containing 1 [... [more]
SARDH1.530e-1122.22sarcosine dehydrogenase [Source:HGNC Symbol;Acc:HG... [more]
SARDH2.012e-1122.22sarcosine dehydrogenase [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of DAO domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
M04B2.41.469e-7234.13pep chromosome:WBcel235:IV:11518422:11521031:-1 ge... [more]
pdpr-13.467e-822.99Pyruvate Dehydrogenase Phosphatase Regulatory subu... [more]
back to top
BLAST of DAO domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG32708.399e-9941.00gene:FBgn0033093 transcript:FBtr0086123[more]
l(2)37Bb2.536e-8137.44gene:FBgn0002021 transcript:FBtr0081177[more]
CG36261.866e-722.62gene:FBgn0029706 transcript:FBtr0070652[more]
back to top
BLAST of DAO domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxred15.411e-9740.15FAD-dependent oxidoreductase domain containing 1 [... [more]
foxred15.411e-9740.15FAD-dependent oxidoreductase domain containing 1 [... [more]
foxred15.378e-4446.78FAD-dependent oxidoreductase domain containing 1 [... [more]
sardh6.261e-1321.88sarcosine dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-... [more]
sardh6.307e-1321.88sarcosine dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of DAO domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxred12.023e-11742.82FAD-dependent oxidoreductase domain containing 1 [... [more]
foxred14.266e-11742.82FAD-dependent oxidoreductase domain containing 1 [... [more]
foxred19.850e-11742.82FAD-dependent oxidoreductase domain containing 1 [... [more]
foxred19.952e-11742.82FAD-dependent oxidoreductase domain containing 1 [... [more]
foxred12.800e-11542.75FAD-dependent oxidoreductase domain containing 1 [... [more]
back to top
BLAST of DAO domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Foxred16.839e-9439.76FAD-dependent oxidoreductase domain containing 1 [... [more]
Foxred14.086e-9139.21FAD-dependent oxidoreductase domain containing 1 [... [more]
Foxred13.741e-2240.94FAD-dependent oxidoreductase domain containing 1 [... [more]
Foxred19.113e-1541.53FAD-dependent oxidoreductase domain containing 1 [... [more]
Foxred11.259e-1441.53FAD-dependent oxidoreductase domain containing 1 [... [more]
back to top
BLAST of DAO domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DCP1|FXRD1_XENLA8.088e-11240.08FAD-dependent oxidoreductase domain-containing pro... [more]
sp|Q96CU9|FXRD1_HUMAN6.002e-10641.95FAD-dependent oxidoreductase domain-containing pro... [more]
sp|Q5EA45|FXRD1_BOVIN8.680e-10540.73FAD-dependent oxidoreductase domain-containing pro... [more]
sp|Q4R510|FXRD1_MACFA5.186e-10441.22FAD-dependent oxidoreductase domain-containing pro... [more]
sp|Q3TQB2|FXRD1_MOUSE4.784e-9339.76FAD-dependent oxidoreductase domain-containing pro... [more]
back to top
BLAST of DAO domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1B6F1W84.986e-11745.57DAO domain-containing protein (Fragment) OS=Cuerna... [more]
A0A1B6JCU12.665e-11443.67DAO domain-containing protein OS=Homalodisca litur... [more]
F6TNC83.177e-11442.82DAO domain-containing protein OS=Xenopus tropicali... [more]
F6XJA26.699e-11442.82DAO domain-containing protein OS=Xenopus tropicali... [more]
A0A5G3JTX11.547e-11342.82DAO domain-containing protein OS=Xenopus tropicali... [more]
back to top
BLAST of DAO domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
foxred11.008e-10642.58FAD dependent oxidoreductase domain containing 1 [... [more]
sardh3.601e-1222.71sarcosine dehydrogenase [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of DAO domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000005532.14.110e-4145.73pep scaffold:Pmarinus_7.0:GL482206:757:4324:1 gene... [more]
ENSPMAT00000007768.19.604e-3840.76pep scaffold:Pmarinus_7.0:GL477155:1317:9408:-1 ge... [more]
dmgdh3.038e-1123.93dimethylglycine dehydrogenase [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of DAO domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DAO domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO277784.467e-10140.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464723.970e-1524.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO416006.463e-1323.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO321933.060e-1125.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DAO domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
foxred11.892e-11242.09FAD dependent oxidoreductase domain containing 1 [... [more]
sardh2.221e-1422.88sarcosine dehydrogenase [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of DAO domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000037253.10.000e+099.51SMESG000037253.1[more]
SMESG000009521.15.077e-8336.83SMESG000009521.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008070 ID=SMED30008070|Name=DAO domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1489bp
CGGCACACTGTTAACATTTTTCTATTTGTATAATTTTTCAGTAAAGTTTC
AGATAAATGTTAACAAAAAGTTATAAGATTTTATCTCAAAATTTTAACAA
ATATGTCATTTCAAAACTATTATGCTCCATGTCGACAACAGTTGATATAG
AATCCGACATCGCTATAATTGGTGGAGGAATCATCGGCTATTCGTCGGCA
TATTGGTTGAAAAAAGAAAATCCAAAATTAAAGATTTTAGTTGTTGAGAA
AGATGTTTTTTATAAACAGTGCTCAACTGTTCTCAGTGTTGGCGGCCTTC
GATTGCAATTTTCCGTTCAGGAAAACATTCAAATGTCGCTCTTTGCCACT
GATGTCATTTCAAATTTGGGCAAATATTTTTCCATCGGAGAAGAAGAAAA
TGTAGATGTTCAGTTTATCAAGAGGGGGTATTTATTATTAAGCCAGAAAG
AGCAAGAAAATATTCTTCATCGAAATTTTAACTTACAAAGATCATTGGGT
GCTGCACTTAATCTACTTAACAGATCAGAAATAAGAGACAACTGGCCATG
GATAAATACAGATGACATTGAATGTGGAGTTTATGGAATTGACTGTGAAG
GTTGGTTTGACCCATGGTTGCTACTGAATGTTATTCGAAAGAAGGCCCTT
CAGCTAGGTGTAACCTCTATAAATGGGTCATTAGTTGAATTCCAAGGGCT
GGGAAATAAATTAAAGCGCGCAATTATCAAATTAAACGATGAAAAATATG
CGGAAATTAAATTCCTAAATGTCATAAATGCTTCCGGCTGTTGGGCAAGT
GATATAGCTATTCTAGCGGAACGCGCAATTGGATTATCTGGATCTGATTA
CCCACTTCATGTCACAAAAGCTAAAAGGTACGTATACAACTTCCATGTTG
CAGATTTTCCACCAACCATTATTACTCCGATGGTGGTTGATTCCACTGGT
GTTTATTTTCGAAAAGAAAGCAGTGGATTGTTTCTCTCTGGATTATCCCC
TGAAACGCACGACGAGCCGAACTGTGATAATCTTGATGTTGATTATGAAT
GGTTTGATCATGAAATTTGGCCGAAATTATATTTTCGTGTTCCACTAATG
GAAGCTTTGAAAGTGAAATCAGCTTGGGCAGGATATTACGATTACAACAC
GAAAGATCAGAATTTAATTGTCGGAAAACATCCGGCAATCGGGAATTTCT
ATTTATGCAACGGATCCAGTGGCCACGGCATCCAGCACGCTCTAGCTATT
GGGAGAGCAAATATGGAATTGATTATCTACGGGGAATTTCAGACAATCAA
TTTAGAGCGCTTCCACTACAACAGATTTGTCAAAAATGAATTAATTTTCG
AAAGCAACATTTTTTAATTTTTTTTGGTACTTTGAAATTTCTATTATTTT
CTATTTGTAAAGAGAATTTTTCAAATTTTTAAAAACTTTTTTATTTAATT
TTTTTTATTTAAATAAATCATTCTGTATTTTAAAAAAAA
back to top

protein sequence of SMED30008070-orf-1

>SMED30008070-orf-1 ID=SMED30008070-orf-1|Name=SMED30008070-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=437bp
MLTKSYKILSQNFNKYVISKLLCSMSTTVDIESDIAIIGGGIIGYSSAYW
LKKENPKLKILVVEKDVFYKQCSTVLSVGGLRLQFSVQENIQMSLFATDV
ISNLGKYFSIGEEENVDVQFIKRGYLLLSQKEQENILHRNFNLQRSLGAA
LNLLNRSEIRDNWPWINTDDIECGVYGIDCEGWFDPWLLLNVIRKKALQL
GVTSINGSLVEFQGLGNKLKRAIIKLNDEKYAEIKFLNVINASGCWASDI
AILAERAIGLSGSDYPLHVTKAKRYVYNFHVADFPPTIITPMVVDSTGVY
FRKESSGLFLSGLSPETHDEPNCDNLDVDYEWFDHEIWPKLYFRVPLMEA
LKVKSAWAGYYDYNTKDQNLIVGKHPAIGNFYLCNGSSGHGIQHALAIGR
ANMELIIYGEFQTINLERFHYNRFVKNELIFESNIF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036188FAD/NAD-bd_sf
IPR023753FAD/NAD-binding_dom
IPR006076FAD-dep_OxRdtase
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0032981mitochondrial respiratory chain complex I assembly
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0005747mitochondrial respiratory chain complex I
GO:0016020membrane
GO:0016021integral component of membrane
GO:0070469respiratory chain
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036188FAD/NAD(P)-binding domain superfamilyGENE3DG3DSA:3.50.50.60coord: 34..404
e-value: 1.6E-85
score: 289.3
IPR036188FAD/NAD(P)-binding domain superfamilySUPERFAMILYSSF51905FAD/NAD(P)-binding domaincoord: 33..429
IPR006076FAD dependent oxidoreductasePFAMPF01266DAOcoord: 34..401
e-value: 2.1E-40
score: 139.4
NoneNo IPR availableGENE3DG3DSA:3.30.9.10coord: 122..364
e-value: 1.6E-85
score: 289.3
NoneNo IPR availablePANTHERPTHR13847:SF44FAD-DEPENDENT OXIDOREDUCTASE DOMAIN-CONTAINING PROTEIN 1coord: 33..435
NoneNo IPR availablePANTHERPTHR13847FAD NAD BINDING OXIDOREDUCTASEScoord: 33..435