SMED30008063

Overview
NameSMED30008063
Smed IDSMED30008063
Length (bp)2117
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30008063 (SMED30008063) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30008063 (SMED30008063) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30008063 (SMED30008063) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30008063 (SMED30008063) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008063

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 26

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30008063h1SMcG0020362 Contig2181GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008063h1SMcG0022755 Contig2181GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008063h1SMcG0020362 Contig2181GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008063h1SMcG0022755 Contig2181GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30008063h1SMcG0001385 Contig4054GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30008063h1SMcG0020362 dd_Smed_v4_1685_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30008063h1SMcG0020362 dd_Smed_v4_1685_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30008063h1SMcG0020362 dd_Smed_v4_1685_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008063h1SMcG0020362 dd_Smed_v4_1685_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008063h1SMcG0020362 dd_Smed_v4_1685_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30008063h1SMcG0020362 dd_Smed_v4_1685_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008063h1SMcG0020362 dd_Smed_v4_1685_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008063h1SMcG0020362 Contig4054GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008063h1SMcG0022755 Contig4054GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008063h1SMcG0001385 Contig4054GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30008063h1SMcG0020362 dd_Smed_v4_1685_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30008063h1SMcG0020362 dd_Smed_v4_1685_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30008063h1SMcG0020362 dd_Smed_v4_1685_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008063h1SMcG0020362 dd_Smed_v4_1685_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008063h1SMcG0020362 dd_Smed_v4_1685_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30008063h1SMcG0020362 dd_Smed_v4_1685_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008063h1SMcG0020362 dd_Smed_v4_1685_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008063h1SMcG0020362 Contig4054GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008063h1SMcG0022755 Contig4054GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30008063h1SMcG0020362 dd_Smed_v6_1685_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30008063h1SMcG0020362 dd_Smed_v6_1685_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30008063 vs. Ensembl Human
Match: NCSTN (nicastrin [Source:HGNC Symbol;Acc:HGNC:17091])

HSP 1 Score: 131.339 bits (329), Expect = 4.859e-31
Identity = 129/503 (25.65%), Postives = 215/503 (42.74%), Query Frame = -2
Query:  623 LTFILTICLTIFAV-QCNEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLNYLKENTILVISSSLFIKQNLTDSIL-KNKFIKGLVVFERDNCSDLFCNDSNESFSEDYSIPNEAYSFNHNHSYNPS------------GTKYAFRNWPFPVTLIDSRHKVEQDKIIECYSKFNKNPKSSRK----CSLEIRNFMAAVKSLKTCLDFLEIQRKFIDYFHHVNFCRELTGENY--VVHAFDKTKSAKPNP-VIVLISRIDSLSMFERSAFNVHGTVTXXXXXXXXXXXXXSQPEFRNPKALKKDVLFLFLDNESYDYLGSDRFVWELNNNYLVNFTGVPVNFTNLDLLLEFGEMGFSNFSQTSFFYPQFPGQDKINNKTLNYFTKLWTFFERYGFGSSYT-------NHDLPPASIQYFLLRNKTIPSIVMSDHRKSFKNMFYNSYLDSKFPRNIS-------EELLAIVNSVASFVYQEAT 2026
            L  +L+ C+ +  + + N ++ +IY  IP+   + CVR LN T  IGC S  +G+ G+I +   + +L   L        +V+  S    ++L + +  +   I GL V        L        FS     PN+ +   +++SY P             G   A+ ++ FP+ L++  +  E   I +CY   N +   S      C++++ + M AV S  TC+    IQ  F    +    C  L+  N   ++   + T + KP+  V+V  +R+DS S F   A      V S    L+  + L   P+      L ++V+F+F   E++DY+GS R V+++           PV   N+D  +E G++     +    +    P   K N    N    L    E+ G G           +  LPP+S+Q F LR + I  +V++DH  +F N +Y S  D+    N+S       EE L  V   A  +   AT
Sbjct:   17 LLRLLSFCVLLAGLCRGNSVERKIY--IPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAV-------SLTKPSPASGFSPSVQCPNDGFGV-YSNSYGPEFAHCREIQWNSLGNGLAYEDFSFPIFLLEDEN--ETKVIKQCYQDHNLSQNGSAPTFPLCAMQLFSHMHAVISTATCMRRSSIQSTF--SINPEIVCDPLSDYNVWSMLKPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALQKAPDV---TTLPRNVMFVFFQGETFDYIGSSRMVYDMEKGKF------PVQLENVDSFVELGQVALR--TSLELWMHTDPVSQK-NESVRNQVEDLLATLEKSGAGVPAVILRRPNQSQPLPPSSLQRF-LRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFVTDTAKALADVAT 492          
BLAST of SMED30008063 vs. Ensembl Human
Match: NCSTN (nicastrin [Source:HGNC Symbol;Acc:HGNC:17091])

HSP 1 Score: 82.8037 bits (203), Expect = 1.639e-16
Identity = 80/316 (25.32%), Postives = 136/316 (43.04%), Query Frame = -2
Query:  680 YNPSGTKYAFRNWPFPVTLIDSRHKVEQDKIIECYSKFNKNPKSSRKCSLEIRNFMAAVKSLKTCLDFLEIQRKFIDYFHHVNFCRELTGENY--VVHAFDKTKSAKPNP-VIVLISRIDSLSMFERSAFNVHGTVTXXXXXXXXXXXXXSQPEFRNPKALKKDVLFLFLDNESYDYLGSDRFVWELNNNYLVNFTGVPVNFTNLDLLLEFGEMGFSNFSQTSFFYPQFPGQDKINNKTLNYFTKLWTFFERYGFGSSYT-------NHDLPPASIQYFLLRNKTIPSIVMSDHRKSFKNMFYNSYLDSKFPRNIS 1597
            +N  G   A+ ++ FP+ L++  ++    K+I+                 ++ + M AV S  TC+    IQ  F    +    C  L+  N   ++   + T + KP+  V+V  +R+DS S F   A      V S    L+  + L   P+      L ++V+F+F   E++DY+GS R V+++           PV   N+D  +E G++     +    +    P   K N    N    L    E+ G G           +  LPP+S+Q F LR + I  +V++DH  +F N +Y S  D+    N+S
Sbjct:   19 WNSLGNGLAYEDFSFPIFLLEDENET---KVIK-----------------QLFSHMHAVISTATCMRRSSIQSTF--SINPEIVCDPLSDYNVWSMLKPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALQKAPDV---TTLPRNVMFVFFQGETFDYIGSSRMVYDMEKGKF------PVQLENVDSFVELGQVALR--TSLELWMHTDPVSQK-NESVRNQVEDLLATLEKSGAGVPAVILRRPNQSQPLPPSSLQRF-LRARNISGVVLADHSGAFHNKYYQSIYDTAENINVS 299          
BLAST of SMED30008063 vs. Ensembl Human
Match: NCSTN (nicastrin [Source:HGNC Symbol;Acc:HGNC:17091])

HSP 1 Score: 68.1662 bits (165), Expect = 3.396e-12
Identity = 44/156 (28.21%), Postives = 72/156 (46.15%), Query Frame = -2
Query:  680 LKKDVLFLFLDNESYDYLGSDRFVWELNNNYLVNFTGVPVNFTNLDLLLEFGEMGFSNFSQTSFFYPQFPGQDKINNKTLNYFTKLWTFFERYGFGSSYT-------NHDLPPASIQYFLLRNKTIPSIVMSDHRKSFKNMFYNSYLDSKFPRNIS 1126
            L ++V+F+F   E++DY+GS R V+++           PV   N+D  +E G++     +    +    P   K N    N    L    E+ G G           +  LPP+S+Q F LR + I  +V++DH  +F N +Y S  D+    N+S
Sbjct:   65 LPRNVMFVFFQGETFDYIGSSRMVYDMEKGKF------PVQLENVDSFVELGQVALR--TSLELWMHTDPVSQK-NESVRNQVEDLLATLEKSGAGVPAVILRRPNQSQPLPPSSLQRF-LRARNISGVVLADHSGAFHNKYYQSIYDTAENINVS 210          
BLAST of SMED30008063 vs. Ensembl Human
Match: NCSTN (nicastrin [Source:HGNC Symbol;Acc:HGNC:17091])

HSP 1 Score: 53.5286 bits (127), Expect = 3.639e-7
Identity = 44/175 (25.14%), Postives = 75/175 (42.86%), Query Frame = -2
Query: 1493 NEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLNYLKENTILVISSSLFIKQNLTDSI-LKNKFIKGLVVFERDNCSDLFCNDSNESFSEDYSIPNEAYSFNHNHSYNPS------------GTKYAFRNWPFPVTLIDSRHKVEQDKIIECY 1978
            N ++ +IY  IP+   + CVR LN T  IGC S  +G+ G+I +   + +L   L        +V+  S    ++L + +  +   I GL V        L        FS     PN+ +   +++SY P             G   A+ ++ FP+ L++  +  E   I +CY
Sbjct:   67 NSVERKIY--IPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAV-------SLTKPSPASGFSPSVQCPNDGFGV-YSNSYGPEFAHCREIQWNSLGNGLAYEDFSFPIFLLEDEN--ETKVIKQCY 229          
BLAST of SMED30008063 vs. Ensembl Human
Match: NCSTN (nicastrin [Source:HGNC Symbol;Acc:HGNC:17091])

HSP 1 Score: 52.7582 bits (125), Expect = 7.541e-7
Identity = 43/184 (23.37%), Postives = 81/184 (44.02%), Query Frame = -2
Query: 1517 LTFILTICLTIFAV-QCNEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLNYLKENTILVISSSLFIKQNLTDSIL-KNKFIKGLVVFERDNCSDLFCNDSNESFSEDYSIPNEAYSFNHNHSYNPS------------GTKYAFRNWPFPVTLIDSRHKVE 2026
            L  +L+ C+ +  + + N ++ +IY  IP+   + CVR LN T  IGC S  +G+ G+I +   + +L   L        +V+  S    ++L + +  +   I GL V        L        FS     PN+ +   +++SY P             G   A+ ++ FP+ L++  ++ +
Sbjct:   17 LLRLLSFCVLLAGLCRGNSVERKIY--IPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAV-------SLTKPSPASGFSPSVQCPNDGFGV-YSNSYGPEFAHCREIQWNSLGNGLAYEDFSFPIFLLEDENETK 190          
BLAST of SMED30008063 vs. Ensembl Celegans
Match: aph-2 (Nicastrin [Source:UniProtKB/Swiss-Prot;Acc:Q23316])

HSP 1 Score: 77.411 bits (189), Expect = 1.716e-14
Identity = 120/555 (21.62%), Postives = 218/555 (39.28%), Query Frame = -2
Query:  518 LTICLTIFAVQCNEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLN------YLK-ENTILVISSSLFIKQNLTDSILKNKFIKGLVVFERDNCSDLFCNDSNESFSEDYSIPNEA---YSFNHNHSY-----NPSG--TKYAFR--NWPFPVTLIDSRHKVEQDKIIE-CYSKFNKNPKSSRK-----CSLEIRNFMAAVKSLKTCLDFLEIQRKF----IDYFHHVNFCRELTGENYVVHAFDKTKSAKP-NPVIV------LISRIDSLSMFERSAFNVHGTVTXXXXXXXXXXXXXSQPE--FRNPKALKKDVLFLFLDNESYDYLGSDRFVWELNNNYLVNFTGV------PVNFTNLDLLLEFGEMGFSNFSQTSFFYPQFPGQDKINNKTL--NYFTKLWTFFERYGFG---SSYTNHDLPPASIQYFLLRNKTIPSIVMSDHRKSFKNMFYNSYLDS-KFPRNISEELLAIVNSVASFVYQEAT---GNNLTRLMNKSDDANPFSIIDCFTNN---VHCDLFKKV 2014
            L I L I  ++C+   +Q++  + I   + C R  N T   GC +      G+I +  +K E    L+      Y K       +     I+++    +  +K + G+V++  ++   +   D + + S D   PN A   Y  + N  Y     N  G  T+      +W   +  ID+   +E   IIE CYS FNK PK         C +  R    A  + + C    +   K     ID       C  +  +N  + AF       P N  I+      + +R+DS  M    +      +TS   +L+  + + +Q E   +      ++V F F + ES DY+GS    +++ N               P+    LD +LE  ++G +   +   +Y    G+    NKT       ++      + F     S +   +PPAS   F   +  + S++++ + K ++    NS LD  ++  +  E+ +  + +V++ +   A    G     ++ K D     +I DC   +     CD  +K+
Sbjct:    5 LVIVLIIAGIRCDGFSDQVFRTLFIGEGNACYRTFNKTHEFGCQANRENENGLI-VRIDKQEDFKNLDSCWNSFYPKYSGKYWALLPVNLIRRDTISQLKSSKCLSGIVLY--NSGESIHPGDESTAASHDAECPNAASDYYLQDKNEEYCERKINSRGAITRDGLMKIDWRIQMVFIDNSTDLE---IIEKCYSMFNK-PKEDGSSGYPYCGMSFRLANMAAGNSEICYRRGKNDAKLFQMNIDSGDAPQLCGAMHSDN--IFAFPTPIPTSPTNETIITSKYMMVTARMDSFGMIPEISVGEVSVLTSIISVLAAARSMGTQIEKWQKASNTSNRNVFFAFFNGESLDYIGSGAAAYQMENGKFPQMIRSDRTHIHPIRPNELDYILEVQQIGVAKGRK---YYVHVDGERYQQNKTQTDRVIDRIERGLRSHAFDLEKPSGSGDRVPPASWHSFAKADAHVQSVLLAPYGKEYEYQRVNSILDKNEWTEDEREKAIQEIEAVSTAILAAAADYVGVETDEVVAKVDKKLITTIFDCLITSNFWFDCDFMQKL 547          
BLAST of SMED30008063 vs. Ensembl Celegans
Match: aph-2 (Nicastrin [Source:UniProtKB/Swiss-Prot;Acc:Q23316])

HSP 1 Score: 77.411 bits (189), Expect = 1.975e-14
Identity = 120/555 (21.62%), Postives = 218/555 (39.28%), Query Frame = -2
Query:  518 LTICLTIFAVQCNEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLN------YLK-ENTILVISSSLFIKQNLTDSILKNKFIKGLVVFERDNCSDLFCNDSNESFSEDYSIPNEA---YSFNHNHSY-----NPSG--TKYAFR--NWPFPVTLIDSRHKVEQDKIIE-CYSKFNKNPKSSRK-----CSLEIRNFMAAVKSLKTCLDFLEIQRKF----IDYFHHVNFCRELTGENYVVHAFDKTKSAKP-NPVIV------LISRIDSLSMFERSAFNVHGTVTXXXXXXXXXXXXXSQPE--FRNPKALKKDVLFLFLDNESYDYLGSDRFVWELNNNYLVNFTGV------PVNFTNLDLLLEFGEMGFSNFSQTSFFYPQFPGQDKINNKTL--NYFTKLWTFFERYGFG---SSYTNHDLPPASIQYFLLRNKTIPSIVMSDHRKSFKNMFYNSYLDS-KFPRNISEELLAIVNSVASFVYQEAT---GNNLTRLMNKSDDANPFSIIDCFTNN---VHCDLFKKV 2014
            L I L I  ++C+   +Q++  + I   + C R  N T   GC +      G+I +  +K E    L+      Y K       +     I+++    +  +K + G+V++  ++   +   D + + S D   PN A   Y  + N  Y     N  G  T+      +W   +  ID+   +E   IIE CYS FNK PK         C +  R    A  + + C    +   K     ID       C  +  +N  + AF       P N  I+      + +R+DS  M    +      +TS   +L+  + + +Q E   +      ++V F F + ES DY+GS    +++ N               P+    LD +LE  ++G +   +   +Y    G+    NKT       ++      + F     S +   +PPAS   F   +  + S++++ + K ++    NS LD  ++  +  E+ +  + +V++ +   A    G     ++ K D     +I DC   +     CD  +K+
Sbjct:    5 LVIVLIIAGIRCDGFSDQVFRTLFIGEGNACYRTFNKTHEFGCQANRENENGLI-VRIDKQEDFKNLDSCWNSFYPKYSGKYWALLPVNLIRRDTISQLKSSKCLSGIVLY--NSGESIHPGDESTAASHDAECPNAASDYYLQDKNEEYCERKINSRGAITRDGLMKIDWRIQMVFIDNSTDLE---IIEKCYSMFNK-PKEDGSSGYPYCGMSFRLANMAAGNSEICYRRGKNDAKLFQMNIDSGDAPQLCGAMHSDN--IFAFPTPIPTSPTNETIITSKYMMVTARMDSFGMIPEISVGEVSVLTSIISVLAAARSMGTQIEKWQKASNTSNRNVFFAFFNGESLDYIGSGAAAYQMENGKFPQMIRSDRTHIHPIRPNELDYILEVQQIGVAKGRK---YYVHVDGERYQQNKTQTDRVIDRIERGLRSHAFDLEKPSGSGDRVPPASWHSFAKADAHVQSVLLAPYGKEYEYQRVNSILDKNEWTEDEREKAIQEIEAVSTAILAAAADYVGVETDEVVAKVDKKLITTIFDCLITSNFWFDCDFMQKL 547          
BLAST of SMED30008063 vs. Ensembl Fly
Match: Nct (gene:FBgn0039234 transcript:FBtr0301865)

HSP 1 Score: 115.161 bits (287), Expect = 2.936e-26
Identity = 149/626 (23.80%), Postives = 256/626 (40.89%), Query Frame = -2
Query:  344 FILTICLTIFAVQCNEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLNYLKENTIL-VISSSLFIKQNLTDSILKNKFIKGLVVFERDNCSDLFCNDSNE--SFSEDYSIPNEAYSFNHN----------HSYNPSGTKYAFRNWPFPVTLIDSRHKVEQDKIIECYSKFNKNPKSSRK----CSLEIRNFMAAVKSLKTCLDFLEIQRKFIDYFHHVNFCRELTGENYVVHAFDKTKSAKPN--------PVIVLISRIDSLSMFERSAFNVHGTVTXXXXXXXXXXXXXSQPEFRNPKALK-KDVLFLFLDNESYDYLGSDRFVWELNN-NYLVNFTGV-PVNFTNLDLLLEFGEM-GFSNFSQTSFFYPQFPGQ--DKINNKTLNYFTKLWTFFERYGFG---SSYTNHDLPPASIQYFLLRNKTIPSIVMSDHRKSFKNMFYNSYLD--------------------------SKFPRNISEELLAIVNSVASFVYQEATGNNLTRLMNKSDDANPF---SIIDCFTNNVHCDLFKKV-LPTTLIDNLHSL---GTPIPTQEHSSKSEKYLRYRFSSLLENLITLFSGEKVNNSDCTNCP 2020
             IL+   TI   Q    ++++Y   PI   S C RRLN T   GCSS  +G+VG++ +   + +L   L+         +I   LF + NL    LK    K + V        L  N +N+   FS + + PN+    N             ++NP GT     ++PFP+  I    +V   K+ +C+  FN +   +      C++E+++FM+A  + + C+     +  FI+      +C  L G N     + +  + + N          I++  R+D+ +MF+       G + S         +     +   P++    +VLF+  + ESYDY+GS RFV+++    +    TG  P+ F N+D +L+ G +   SN    +        Q  +++NN         +    RYGF     S  +  LPP S Q FL R+    +++++       N +Y+S  D                          S  P ++  ++  + + VA  +YQ  TG   T     +  ANP      + CF  +  C LFK    P + + NL  +        +QE S  + + L Y  S L  +         ++  +CT+ P
Sbjct:   13 LILSYGATI--AQGERTRDKMYE--PIGGAS-CFRRLNGTHQTGCSSTYSGSVGVLHLINVEADLEFLLSSPPSPPYAPMIPPHLFTRNNLMR--LKEAGPKNISVV-------LLINRTNQMKQFSHELNCPNQYSGLNSTSETCDASNPAKNWNPWGTGLLHEDFPFPIYYIADLDQVT--KLEKCFQDFNNHNYETHALRSLCAVEVKSFMSAAVNTEVCMR----RTNFINNLGGSKYCDPLEGRNVYATLYPRKPAIENNLETVHTNEKFILVTCRLDTTTMFDGVGL---GAMDSLMGFAVFTHVAYLLKQLLPPQSKDLHNVLFVTFNGESYDYIGSQRFVYDMEKLQFPTESTGTPPIAFDNIDFMLDIGTLDDISNIKLHALNGTTLAQQILERLNN---------YAKSPRYGFNLNIQSEMSAHLPPTSAQSFLRRDPNFNALILNARP---TNKYYHSIYDDADNVDFTYANTSKDFTQLTEVNDFKSLNPDSLQMKVRNVSSIVAMALYQTITGKEYT----GTKVANPLMADEFLYCFLQSADCPLFKAASYPGSQLTNLPPMRYISVLGGSQESSGYTYRLLGYLLSQLQPD---------IHRDNCTDLP 590          
BLAST of SMED30008063 vs. Ensembl Fly
Match: Nct (gene:FBgn0039234 transcript:FBtr0084705)

HSP 1 Score: 115.161 bits (287), Expect = 2.936e-26
Identity = 149/626 (23.80%), Postives = 256/626 (40.89%), Query Frame = -2
Query:  344 FILTICLTIFAVQCNEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLNYLKENTIL-VISSSLFIKQNLTDSILKNKFIKGLVVFERDNCSDLFCNDSNE--SFSEDYSIPNEAYSFNHN----------HSYNPSGTKYAFRNWPFPVTLIDSRHKVEQDKIIECYSKFNKNPKSSRK----CSLEIRNFMAAVKSLKTCLDFLEIQRKFIDYFHHVNFCRELTGENYVVHAFDKTKSAKPN--------PVIVLISRIDSLSMFERSAFNVHGTVTXXXXXXXXXXXXXSQPEFRNPKALK-KDVLFLFLDNESYDYLGSDRFVWELNN-NYLVNFTGV-PVNFTNLDLLLEFGEM-GFSNFSQTSFFYPQFPGQ--DKINNKTLNYFTKLWTFFERYGFG---SSYTNHDLPPASIQYFLLRNKTIPSIVMSDHRKSFKNMFYNSYLD--------------------------SKFPRNISEELLAIVNSVASFVYQEATGNNLTRLMNKSDDANPF---SIIDCFTNNVHCDLFKKV-LPTTLIDNLHSL---GTPIPTQEHSSKSEKYLRYRFSSLLENLITLFSGEKVNNSDCTNCP 2020
             IL+   TI   Q    ++++Y   PI   S C RRLN T   GCSS  +G+VG++ +   + +L   L+         +I   LF + NL    LK    K + V        L  N +N+   FS + + PN+    N             ++NP GT     ++PFP+  I    +V   K+ +C+  FN +   +      C++E+++FM+A  + + C+     +  FI+      +C  L G N     + +  + + N          I++  R+D+ +MF+       G + S         +     +   P++    +VLF+  + ESYDY+GS RFV+++    +    TG  P+ F N+D +L+ G +   SN    +        Q  +++NN         +    RYGF     S  +  LPP S Q FL R+    +++++       N +Y+S  D                          S  P ++  ++  + + VA  +YQ  TG   T     +  ANP      + CF  +  C LFK    P + + NL  +        +QE S  + + L Y  S L  +         ++  +CT+ P
Sbjct:   13 LILSYGATI--AQGERTRDKMYE--PIGGAS-CFRRLNGTHQTGCSSTYSGSVGVLHLINVEADLEFLLSSPPSPPYAPMIPPHLFTRNNLMR--LKEAGPKNISVV-------LLINRTNQMKQFSHELNCPNQYSGLNSTSETCDASNPAKNWNPWGTGLLHEDFPFPIYYIADLDQVT--KLEKCFQDFNNHNYETHALRSLCAVEVKSFMSAAVNTEVCMR----RTNFINNLGGSKYCDPLEGRNVYATLYPRKPAIENNLETVHTNEKFILVTCRLDTTTMFDGVGL---GAMDSLMGFAVFTHVAYLLKQLLPPQSKDLHNVLFVTFNGESYDYIGSQRFVYDMEKLQFPTESTGTPPIAFDNIDFMLDIGTLDDISNIKLHALNGTTLAQQILERLNN---------YAKSPRYGFNLNIQSEMSAHLPPTSAQSFLRRDPNFNALILNARP---TNKYYHSIYDDADNVDFTYANTSKDFTQLTEVNDFKSLNPDSLQMKVRNVSSIVAMALYQTITGKEYT----GTKVANPLMADEFLYCFLQSADCPLFKAASYPGSQLTNLPPMRYISVLGGSQESSGYTYRLLGYLLSQLQPD---------IHRDNCTDLP 590          
BLAST of SMED30008063 vs. Ensembl Fly
Match: Nct (gene:FBgn0039234 transcript:FBtr0334570)

HSP 1 Score: 114.775 bits (286), Expect = 4.042e-26
Identity = 149/626 (23.80%), Postives = 256/626 (40.89%), Query Frame = -2
Query:  344 FILTICLTIFAVQCNEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLNYLKENTIL-VISSSLFIKQNLTDSILKNKFIKGLVVFERDNCSDLFCNDSNE--SFSEDYSIPNEAYSFNHN----------HSYNPSGTKYAFRNWPFPVTLIDSRHKVEQDKIIECYSKFNKNPKSSRK----CSLEIRNFMAAVKSLKTCLDFLEIQRKFIDYFHHVNFCRELTGENYVVHAFDKTKSAKPN--------PVIVLISRIDSLSMFERSAFNVHGTVTXXXXXXXXXXXXXSQPEFRNPKALK-KDVLFLFLDNESYDYLGSDRFVWELNN-NYLVNFTGV-PVNFTNLDLLLEFGEM-GFSNFSQTSFFYPQFPGQ--DKINNKTLNYFTKLWTFFERYGFG---SSYTNHDLPPASIQYFLLRNKTIPSIVMSDHRKSFKNMFYNSYLD--------------------------SKFPRNISEELLAIVNSVASFVYQEATGNNLTRLMNKSDDANPF---SIIDCFTNNVHCDLFKKV-LPTTLIDNLHSL---GTPIPTQEHSSKSEKYLRYRFSSLLENLITLFSGEKVNNSDCTNCP 2020
             IL+   TI   Q    ++++Y   PI   S C RRLN T   GCSS  +G+VG++ +   + +L   L+         +I   LF + NL    LK    K + V        L  N +N+   FS + + PN+    N             ++NP GT     ++PFP+  I    +V   K+ +C+  FN +   +      C++E+++FM+A  + + C+     +  FI+      +C  L G N     + +  + + N          I++  R+D+ +MF+       G + S         +     +   P++    +VLF+  + ESYDY+GS RFV+++    +    TG  P+ F N+D +L+ G +   SN    +        Q  +++NN         +    RYGF     S  +  LPP S Q FL R+    +++++       N +Y+S  D                          S  P ++  ++  + + VA  +YQ  TG   T     +  ANP      + CF  +  C LFK    P + + NL  +        +QE S  + + L Y  S L  +         ++  +CT+ P
Sbjct:   13 LILSYGATI--AQGERTRDKMYE--PIGGAS-CFRRLNGTHQTGCSSTYSGSVGVLHLINVEADLEFLLSSPPSPPYAPMIPPHLFTRNNLMR--LKEAGPKNISVV-------LLINRTNQMKQFSHELNCPNQYSGLNSTSETCDASNPAKNWNPWGTGLLHEDFPFPIYYIADLDQVT--KLEKCFQDFNNHNYETHALRSLCAVEVKSFMSAAVNTEVCMR----RTNFINNLGGSKYCDPLEGRNVYATLYPRKPAIENNLETVHTNEKFILVTCRLDTTTMFDGVGL---GAMDSLMGFAVFTHVAYLLKQLLPPQSKDLHNVLFVTFNGESYDYIGSQRFVYDMEKLQFPTESTGTPPIAFDNIDFMLDIGTLDDISNIKLHALNGTTLAQQILERLNN---------YAKSPRYGFNLNIQSEMSAHLPPTSAQSFLRRDPNFNALILNARP---TNKYYHSIYDDADNVDFTYANTSKDFTQLTEVNDFKSLNPDSLQMKVRNVSSIVAMALYQTITGKEYT----GTKVANPLMADEFLYCFLQSADCPLFKAASYPGSQLTNLPPMRYISVLGGSQESSGYTYRLLGYLLSQLQPD---------IHRDNCTDLP 590          
BLAST of SMED30008063 vs. Ensembl Fly
Match: Nct (gene:FBgn0039234 transcript:FBtr0306087)

HSP 1 Score: 114.775 bits (286), Expect = 4.105e-26
Identity = 149/626 (23.80%), Postives = 256/626 (40.89%), Query Frame = -2
Query:  344 FILTICLTIFAVQCNEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLNYLKENTIL-VISSSLFIKQNLTDSILKNKFIKGLVVFERDNCSDLFCNDSNE--SFSEDYSIPNEAYSFNHN----------HSYNPSGTKYAFRNWPFPVTLIDSRHKVEQDKIIECYSKFNKNPKSSRK----CSLEIRNFMAAVKSLKTCLDFLEIQRKFIDYFHHVNFCRELTGENYVVHAFDKTKSAKPN--------PVIVLISRIDSLSMFERSAFNVHGTVTXXXXXXXXXXXXXSQPEFRNPKALK-KDVLFLFLDNESYDYLGSDRFVWELNN-NYLVNFTGV-PVNFTNLDLLLEFGEM-GFSNFSQTSFFYPQFPGQ--DKINNKTLNYFTKLWTFFERYGFG---SSYTNHDLPPASIQYFLLRNKTIPSIVMSDHRKSFKNMFYNSYLD--------------------------SKFPRNISEELLAIVNSVASFVYQEATGNNLTRLMNKSDDANPF---SIIDCFTNNVHCDLFKKV-LPTTLIDNLHSL---GTPIPTQEHSSKSEKYLRYRFSSLLENLITLFSGEKVNNSDCTNCP 2020
             IL+   TI   Q    ++++Y   PI   S C RRLN T   GCSS  +G+VG++ +   + +L   L+         +I   LF + NL    LK    K + V        L  N +N+   FS + + PN+    N             ++NP GT     ++PFP+  I    +V   K+ +C+  FN +   +      C++E+++FM+A  + + C+     +  FI+      +C  L G N     + +  + + N          I++  R+D+ +MF+       G + S         +     +   P++    +VLF+  + ESYDY+GS RFV+++    +    TG  P+ F N+D +L+ G +   SN    +        Q  +++NN         +    RYGF     S  +  LPP S Q FL R+    +++++       N +Y+S  D                          S  P ++  ++  + + VA  +YQ  TG   T     +  ANP      + CF  +  C LFK    P + + NL  +        +QE S  + + L Y  S L  +         ++  +CT+ P
Sbjct:   13 LILSYGATI--AQGERTRDKMYE--PIGGAS-CFRRLNGTHQTGCSSTYSGSVGVLHLINVEADLEFLLSSPPSPPYAPMIPPHLFTRNNLMR--LKEAGPKNISVV-------LLINRTNQMKQFSHELNCPNQYSGLNSTSETCDASNPAKNWNPWGTGLLHEDFPFPIYYIADLDQVT--KLEKCFQDFNNHNYETHALRSLCAVEVKSFMSAAVNTEVCMR----RTNFINNLGGSKYCDPLEGRNVYATLYPRKPAIENNLETVHTNEKFILVTCRLDTTTMFDGVGL---GAMDSLMGFAVFTHVAYLLKQLLPPQSKDLHNVLFVTFNGESYDYIGSQRFVYDMEKLQFPTESTGTPPIAFDNIDFMLDIGTLDDISNIKLHALNGTTLAQQILERLNN---------YAKSPRYGFNLNIQSEMSAHLPPTSAQSFLRRDPNFNALILNARP---TNKYYHSIYDDADNVDFTYANTSKDFTQLTEVNDFKSLNPDSLQMKVRNVSSIVAMALYQTITGKEYT----GTKVANPLMADEFLYCFLQSADCPLFKAASYPGSQLTNLPPMRYISVLGGSQESSGYTYRLLGYLLSQLQPD---------IHRDNCTDLP 590          
BLAST of SMED30008063 vs. Ensembl Zebrafish
Match: CABZ01110881.1 (pep chromosome:GRCz11:2:58115123:58142854:-1 gene:ENSDARG00000103284.2 transcript:ENSDART00000169909.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01110881.1)

HSP 1 Score: 59.3066 bits (142), Expect = 1.267e-8
Identity = 57/228 (25.00%), Postives = 103/228 (45.18%), Query Frame = -2
Query: 1373 DLMLTFILTICLTIFAVQCNEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLNYLKENTILVISSSLFIKQNLTDSILKNKFIKGLVVFERDNCSDLFCNDSNESF---SEDYSIPNEAYSFNHNHSYNPSGTKYAFRNWPFPVTLIDSRHKVEQDKIIECYSKFNKNPKSSRK----CSLEIRNFMAAVKSLKTCLDFLEIQRKF 2035
             L++T +   C++     C+ ++ +IY E+     + CVR LN T  IGC S  +G+ G++ +  ++++L   L+       +VI  + F  +  T S +        +V E   C  LF       F   S  YS  +E  + N    +NP G   ++ ++ FPV  +   ++ +   I +CY   N     S      C++++ + M AV    TC+   ++Q KF
Sbjct:   11 QLLITALFYTCIS-----CSSVEQKIYVEL--NKTAPCVRLLNATHQIGCQSSISGDTGVVHVLESESDLDWILSAGPHPPYMVIMETAFFNRQSTISDVSFPMSYNELVIEY--CLSLFNVCVCVCFPHVSGVYSAGSEFANCNGT-VWNPLGNGLSYEDFTFPVFALKDENQTQ--VIRKCYEDHNLRVNGSAPHYPLCAMQLFSHMHAVTDTVTCMRRTDLQNKF 226          
BLAST of SMED30008063 vs. Ensembl Xenopus
Match: ctsg (cathepsin G [Source:Xenbase;Acc:XB-GENE-5953471])

HSP 1 Score: 66.2402 bits (160), Expect = 1.218e-10
Identity = 77/337 (22.85%), Postives = 137/337 (40.65%), Query Frame = -2
Query:  728 SFSEDYSIPNEAYS---------FNH-NHS-YNPSGTKYAFRNWPFPVTLIDSRHKVEQDKIIECYSKFNKNPKSSRKCSLEIRNFMAAVKSLKTCLDFLEIQRKFIDYFHHVNFCRELTG--ENYVVH-------AFDKTKSAKPNP-VIVLISRIDSLSMFERSAFNVHGTVTXXXXXXXXXXXXXSQPEFRNPKALKKDVLFLFLDNESYDYLGSDRFVWELNNNYLVNFTGVPVNFTNLDLLLEFGEMGFSNFSQTSFFYPQFPGQDKINNKTLNYFTKLWTFFERYGFGSSYT------NHDLPPASIQYFLLRNKTIPSIVMSDHRKSFKN 1657
             FS D   PN+ +          F H NH+ +NP G+  ++ ++ FP+ L+   ++ E   +I+        P   R C                  + L +  +   +  H      L G  +  +VH         + T +  P   ++V  +R DS S F   A     TV+    LL+  + L  + + ++   L ++++F+    E YDY+GS R V+++           PV+  N+   +E  ++   N    SF +       + N        ++         GS+ T      +  LPPAS+Q F LR + IP +V++DHR ++ N
Sbjct:   28 GFSPDPQCPNDGFGLYTSDHGPQFAHCNHTTWNPLGSGISYEDFQFPIFLLREENETE---VIKQVGTQLVGPVHGRPCCYREE-------------EVLLLDARTNPFRSHDVSLSSLEGVCDTIIVHNVWSSLKPINTTGTVPPEEQIVVAAARADSHSFFWNLAPGADSTVSGFVTLLAAAEALHKRNDTQD---LPRNIMFVLFQGEVYDYIGSSRMVYDMEKGRF------PVSLGNIHSFVELNQVALRN---DSFLWVHTDPISRTNETVNATVQEVVDSLVAASQGSNVTIQEVDRSQPLPPASLQRF-LRVRNIPGVVLTDHRTAYSN 335          
BLAST of SMED30008063 vs. Ensembl Mouse
Match: Ncstn (nicastrin [Source:MGI Symbol;Acc:MGI:1891700])

HSP 1 Score: 130.954 bits (328), Expect = 4.542e-31
Identity = 127/506 (25.10%), Postives = 212/506 (41.90%), Query Frame = -2
Query:  608 NEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLNYLKENTILV-ISSSLFIKQNLTDSILKNKFIKGLVVFERDNCSDLFCNDSNESFSEDYSIPNEAYSFNHNHSYNPS------------GTKYAFRNWPFPVTLIDSRHKVEQDKIIECYSKFNKNPKSSRK----CSLEIRNFMAAVKSLKTCLDFLEIQRKFIDYFHHVN---FCRELTGENY--VVHAFDKTKSAKPN-PVIVLISRIDSLSMFERSAFNVHGTVTXXXXXXXXXXXXXSQPEFRNPKALKKDVLFLFLDNESYDYLGSDRFVWELNNNYLVNFTGVPVNFTNLDLLLEFGEMGFSNFSQTSF-FYPQFPGQDKINNKTLNYFTKLWTFFERYGFGSS-------YTNHDLPPASIQYFLLRNKTIPSIVMSDHRKSFKNMFYNSYLDSK------------------FPRNISEELLAIVNSVASFVYQEATGNNLT 1978
            N ++ +IY  IP+   + CVR LN T  IGC S  +G+ G+I +   + +L   L        +V +   LF +  +         I GL V        L   +S  SFS     PN+ +   +++SY P             G   A+ ++ FP+ L++  +  E   I +CY   N     S      C++++ + M AV S  TC+     +R FI     +N    C  L+  N   ++   + +   +P+  V+V  +R+DS S F   A      V S    L+  + L   P+      L ++V+F+F   E++DY+GS R V+++ N         PV   N+D  +E G++      +TS   +       + N    N    L    E+ G G           +  LPP+S+Q F LR + I  +V++DH  SF N +Y S  D+                   F  + ++ L  +   +A  +Y+ A G N +
Sbjct:   33 NSVERKIY--IPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLKWVLTDGPNPPYMVLLEGKLFTRDVMEKLKGTTSRIAGLAV-------TLAKPNSTSSFSPSVQCPNDGFGI-YSNSYGPEFAHCKKTLWNELGNGLAYEDFSFPIFLLEDEN--ETKVIKQCYQDHNLGQNGSAPSFPLCAMQLFSHMHAVISTATCM-----RRSFIQSTFSINPEIVCDPLSDYNVWSMLKPINTSVGLEPDVRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALHKAPDV---TTLSRNVMFVFFQGETFDYIGSSRMVYDMENGKF------PVRLENIDSFVELGQVAL----RTSLDLWMHTDPMSQKNESVKNQVEDLLATLEKSGAGVPEVVLRRLAQSQALPPSSLQRF-LRARNISGVVLADHSGSFHNRYYQSIYDTAENINVTYPEWQSPEEDLNFVTDTAKALANVATVLARALYELAGGTNFS 507          
BLAST of SMED30008063 vs. UniProt/SwissProt
Match: sp|Q92542|NICA_HUMAN (Nicastrin OS=Homo sapiens OX=9606 GN=NCSTN PE=1 SV=2)

HSP 1 Score: 131.339 bits (329), Expect = 2.333e-30
Identity = 129/503 (25.65%), Postives = 215/503 (42.74%), Query Frame = -2
Query:  623 LTFILTICLTIFAV-QCNEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLNYLKENTILVISSSLFIKQNLTDSIL-KNKFIKGLVVFERDNCSDLFCNDSNESFSEDYSIPNEAYSFNHNHSYNPS------------GTKYAFRNWPFPVTLIDSRHKVEQDKIIECYSKFNKNPKSSRK----CSLEIRNFMAAVKSLKTCLDFLEIQRKFIDYFHHVNFCRELTGENY--VVHAFDKTKSAKPNP-VIVLISRIDSLSMFERSAFNVHGTVTXXXXXXXXXXXXXSQPEFRNPKALKKDVLFLFLDNESYDYLGSDRFVWELNNNYLVNFTGVPVNFTNLDLLLEFGEMGFSNFSQTSFFYPQFPGQDKINNKTLNYFTKLWTFFERYGFGSSYT-------NHDLPPASIQYFLLRNKTIPSIVMSDHRKSFKNMFYNSYLDSKFPRNIS-------EELLAIVNSVASFVYQEAT 2026
            L  +L+ C+ +  + + N ++ +IY  IP+   + CVR LN T  IGC S  +G+ G+I +   + +L   L        +V+  S    ++L + +  +   I GL V        L        FS     PN+ +   +++SY P             G   A+ ++ FP+ L++  +  E   I +CY   N +   S      C++++ + M AV S  TC+    IQ  F    +    C  L+  N   ++   + T + KP+  V+V  +R+DS S F   A      V S    L+  + L   P+      L ++V+F+F   E++DY+GS R V+++           PV   N+D  +E G++     +    +    P   K N    N    L    E+ G G           +  LPP+S+Q F LR + I  +V++DH  +F N +Y S  D+    N+S       EE L  V   A  +   AT
Sbjct:   17 LLRLLSFCVLLAGLCRGNSVERKIY--IPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAV-------SLTKPSPASGFSPSVQCPNDGFGV-YSNSYGPEFAHCREIQWNSLGNGLAYEDFSFPIFLLEDEN--ETKVIKQCYQDHNLSQNGSAPTFPLCAMQLFSHMHAVISTATCMRRSSIQSTF--SINPEIVCDPLSDYNVWSMLKPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALQKAPDV---TTLPRNVMFVFFQGETFDYIGSSRMVYDMEKGKF------PVQLENVDSFVELGQVALR--TSLELWMHTDPVSQK-NESVRNQVEDLLATLEKSGAGVPAVILRRPNQSQPLPPSSLQRF-LRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFVTDTAKALADVAT 492          
BLAST of SMED30008063 vs. UniProt/SwissProt
Match: sp|P57716|NICA_MOUSE (Nicastrin OS=Mus musculus OX=10090 GN=Ncstn PE=1 SV=3)

HSP 1 Score: 130.954 bits (328), Expect = 3.177e-30
Identity = 127/506 (25.10%), Postives = 212/506 (41.90%), Query Frame = -2
Query:  608 NEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLNYLKENTILV-ISSSLFIKQNLTDSILKNKFIKGLVVFERDNCSDLFCNDSNESFSEDYSIPNEAYSFNHNHSYNPS------------GTKYAFRNWPFPVTLIDSRHKVEQDKIIECYSKFNKNPKSSRK----CSLEIRNFMAAVKSLKTCLDFLEIQRKFIDYFHHVN---FCRELTGENY--VVHAFDKTKSAKPN-PVIVLISRIDSLSMFERSAFNVHGTVTXXXXXXXXXXXXXSQPEFRNPKALKKDVLFLFLDNESYDYLGSDRFVWELNNNYLVNFTGVPVNFTNLDLLLEFGEMGFSNFSQTSF-FYPQFPGQDKINNKTLNYFTKLWTFFERYGFGSS-------YTNHDLPPASIQYFLLRNKTIPSIVMSDHRKSFKNMFYNSYLDSK------------------FPRNISEELLAIVNSVASFVYQEATGNNLT 1978
            N ++ +IY  IP+   + CVR LN T  IGC S  +G+ G+I +   + +L   L        +V +   LF +  +         I GL V        L   +S  SFS     PN+ +   +++SY P             G   A+ ++ FP+ L++  +  E   I +CY   N     S      C++++ + M AV S  TC+     +R FI     +N    C  L+  N   ++   + +   +P+  V+V  +R+DS S F   A      V S    L+  + L   P+      L ++V+F+F   E++DY+GS R V+++ N         PV   N+D  +E G++      +TS   +       + N    N    L    E+ G G           +  LPP+S+Q F LR + I  +V++DH  SF N +Y S  D+                   F  + ++ L  +   +A  +Y+ A G N +
Sbjct:   33 NSVERKIY--IPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLKWVLTDGPNPPYMVLLEGKLFTRDVMEKLKGTTSRIAGLAV-------TLAKPNSTSSFSPSVQCPNDGFGI-YSNSYGPEFAHCKKTLWNELGNGLAYEDFSFPIFLLEDEN--ETKVIKQCYQDHNLGQNGSAPSFPLCAMQLFSHMHAVISTATCM-----RRSFIQSTFSINPEIVCDPLSDYNVWSMLKPINTSVGLEPDVRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALHKAPDV---TTLSRNVMFVFFQGETFDYIGSSRMVYDMENGKF------PVRLENIDSFVELGQVAL----RTSLDLWMHTDPMSQKNESVKNQVEDLLATLEKSGAGVPEVVLRRLAQSQALPPSSLQRF-LRARNISGVVLADHSGSFHNRYYQSIYDTAENINVTYPEWQSPEEDLNFVTDTAKALANVATVLARALYELAGGTNFS 507          
BLAST of SMED30008063 vs. UniProt/SwissProt
Match: sp|Q8CGU6|NICA_RAT (Nicastrin OS=Rattus norvegicus OX=10116 GN=Ncstn PE=1 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 3.935e-30
Identity = 132/519 (25.43%), Postives = 219/519 (42.20%), Query Frame = -2
Query:  566 NEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLNYLKENTILV-ISSSLFIKQNLTDSILKNKFIKGLVVFERDNCSDLFCNDSNESFSEDYSIPNEAYSFNHNHSYNPS------------GTKYAFRNWPFPVTLIDSRHKVEQDKIIECYSKFNKNPKSSRK----CSLEIRNFMAAVKSLKTCLDFLEIQRKFIDYFHHVN---FCRELTGENY--VVHAFDKTKSAKPN-PVIVLISRIDSLSMFERSAFNVHGTVTXXXXXXXXXXXXXSQPEFRNPKALKKDVLFLFLDNESYDYLGSDRFVWELNNNYLVNFTGVPVNFTNLDLLLEFGEMGFSNFSQTSFFYPQFPGQDKINNKTLNYFTKLWTFFERYGFGSSYT-------NHDLPPASIQYFLLRNKTIPSIVMSDHRKSFKNMFYNSYLDSK------FPRNISEE------------LLAIVNSVASFVYQEATGNNLTRLMNKSDDANPFSI 1978
            N ++ +IY  IP+   + CVR LN T  IGC S  +G+ G+I +   + +L   L        +V +   LF +  +     +   I GL V        L   +S  SFS     PN+ +   +++SY P             G   A+ ++ FP+ L++  +  E   I +CY   N     S      C++++ + M AV S  TC+     +R FI     +N    C  L+  N   ++   + +   +P+  V+V  +R+DS S F   A      V S    L+  + L   P+      L ++V+F+F   E++DY+GS R V+++ N         PV   N+D  +E G++     +    +    P   K N    N    L    E+ G  +          +  LPP+S+Q F LR + I  +V++DH  SF N +Y S  D+       +P + S E            L  +   +A  +Y+ A G N     N S  A+P ++
Sbjct:   33 NSVERKIY--IPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEDDLKWVLTDGPNPPYMVLLEGKLFTRDIMEKLKGETSRIAGLAV-------TLAKPNSTSSFSPSVQCPNDGFGI-YSNSYGPEFAHCKKTLWNELGNGLAYDDFSFPIFLLEDEN--ETKVIKQCYQDHNLGQNGSAPSFPLCAMQLFSHMHAVISTATCM-----RRSFIQSTFSINPEIVCDPLSDYNVWSMLKPINTSGGLEPDVRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALHKAPDV---TTLPRNVMFVFFQGETFDYIGSSRMVYDMENGKF------PVRLENIDSFVELGQVALR--TSLELWMHTDPMSQK-NESVKNQVEDLLVTLEQSGADTPQVVLSRLVQSQALPPSSLQRF-LRARNISGVVLADHSGSFHNRYYQSIYDTAENINVTYPESQSPEEDLNFVTDTAKALADVATVLARALYKLAGGTNF----NNSIQADPQTV 517          
BLAST of SMED30008063 vs. UniProt/SwissProt
Match: sp|Q9VC27|NICA_DROME (Nicastrin OS=Drosophila melanogaster OX=7227 GN=Nct PE=1 SV=3)

HSP 1 Score: 115.161 bits (287), Expect = 2.943e-25
Identity = 149/626 (23.80%), Postives = 256/626 (40.89%), Query Frame = -2
Query:  344 FILTICLTIFAVQCNEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLNYLKENTIL-VISSSLFIKQNLTDSILKNKFIKGLVVFERDNCSDLFCNDSNE--SFSEDYSIPNEAYSFNHN----------HSYNPSGTKYAFRNWPFPVTLIDSRHKVEQDKIIECYSKFNKNPKSSRK----CSLEIRNFMAAVKSLKTCLDFLEIQRKFIDYFHHVNFCRELTGENYVVHAFDKTKSAKPN--------PVIVLISRIDSLSMFERSAFNVHGTVTXXXXXXXXXXXXXSQPEFRNPKALK-KDVLFLFLDNESYDYLGSDRFVWELNN-NYLVNFTGV-PVNFTNLDLLLEFGEM-GFSNFSQTSFFYPQFPGQ--DKINNKTLNYFTKLWTFFERYGFG---SSYTNHDLPPASIQYFLLRNKTIPSIVMSDHRKSFKNMFYNSYLD--------------------------SKFPRNISEELLAIVNSVASFVYQEATGNNLTRLMNKSDDANPF---SIIDCFTNNVHCDLFKKV-LPTTLIDNLHSL---GTPIPTQEHSSKSEKYLRYRFSSLLENLITLFSGEKVNNSDCTNCP 2020
             IL+   TI   Q    ++++Y   PI   S C RRLN T   GCSS  +G+VG++ +   + +L   L+         +I   LF + NL    LK    K + V        L  N +N+   FS + + PN+    N             ++NP GT     ++PFP+  I    +V   K+ +C+  FN +   +      C++E+++FM+A  + + C+     +  FI+      +C  L G N     + +  + + N          I++  R+D+ +MF+       G + S         +     +   P++    +VLF+  + ESYDY+GS RFV+++    +    TG  P+ F N+D +L+ G +   SN    +        Q  +++NN         +    RYGF     S  +  LPP S Q FL R+    +++++       N +Y+S  D                          S  P ++  ++  + + VA  +YQ  TG   T     +  ANP      + CF  +  C LFK    P + + NL  +        +QE S  + + L Y  S L  +         ++  +CT+ P
Sbjct:   13 LILSYGATI--AQGERTRDKMYE--PIGGAS-CFRRLNGTHQTGCSSTYSGSVGVLHLINVEADLEFLLSSPPSPPYAPMIPPHLFTRNNLMR--LKEAGPKNISVV-------LLINRTNQMKQFSHELNCPNQYSGLNSTSETCDASNPAKNWNPWGTGLLHEDFPFPIYYIADLDQVT--KLEKCFQDFNNHNYETHALRSLCAVEVKSFMSAAVNTEVCMR----RTNFINNLGGSKYCDPLEGRNVYATLYPRKPAIENNLETVHTNEKFILVTCRLDTTTMFDGVGL---GAMDSLMGFAVFTHVAYLLKQLLPPQSKDLHNVLFVTFNGESYDYIGSQRFVYDMEKLQFPTESTGTPPIAFDNIDFMLDIGTLDDISNIKLHALNGTTLAQQILERLNN---------YAKSPRYGFNLNIQSEMSAHLPPTSAQSFLRRDPNFNALILNARP---TNKYYHSIYDDADNVDFTYANTSKDFTQLTEVNDFKSLNPDSLQMKVRNVSSIVAMALYQTITGKEYT----GTKVANPLMADEFLYCFLQSADCPLFKAASYPGSQLTNLPPMRYISVLGGSQESSGYTYRLLGYLLSQLQPD---------IHRDNCTDLP 590          
BLAST of SMED30008063 vs. UniProt/SwissProt
Match: sp|Q23316|NICA_CAEEL (Nicastrin OS=Caenorhabditis elegans OX=6239 GN=aph-2 PE=1 SV=3)

HSP 1 Score: 77.411 bits (189), Expect = 2.512e-13
Identity = 120/555 (21.62%), Postives = 218/555 (39.28%), Query Frame = -2
Query:  518 LTICLTIFAVQCNEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLN------YLK-ENTILVISSSLFIKQNLTDSILKNKFIKGLVVFERDNCSDLFCNDSNESFSEDYSIPNEA---YSFNHNHSY-----NPSG--TKYAFR--NWPFPVTLIDSRHKVEQDKIIE-CYSKFNKNPKSSRK-----CSLEIRNFMAAVKSLKTCLDFLEIQRKF----IDYFHHVNFCRELTGENYVVHAFDKTKSAKP-NPVIV------LISRIDSLSMFERSAFNVHGTVTXXXXXXXXXXXXXSQPE--FRNPKALKKDVLFLFLDNESYDYLGSDRFVWELNNNYLVNFTGV------PVNFTNLDLLLEFGEMGFSNFSQTSFFYPQFPGQDKINNKTL--NYFTKLWTFFERYGFG---SSYTNHDLPPASIQYFLLRNKTIPSIVMSDHRKSFKNMFYNSYLDS-KFPRNISEELLAIVNSVASFVYQEAT---GNNLTRLMNKSDDANPFSIIDCFTNN---VHCDLFKKV 2014
            L I L I  ++C+   +Q++  + I   + C R  N T   GC +      G+I +  +K E    L+      Y K       +     I+++    +  +K + G+V++  ++   +   D + + S D   PN A   Y  + N  Y     N  G  T+      +W   +  ID+   +E   IIE CYS FNK PK         C +  R    A  + + C    +   K     ID       C  +  +N  + AF       P N  I+      + +R+DS  M    +      +TS   +L+  + + +Q E   +      ++V F F + ES DY+GS    +++ N               P+    LD +LE  ++G +   +   +Y    G+    NKT       ++      + F     S +   +PPAS   F   +  + S++++ + K ++    NS LD  ++  +  E+ +  + +V++ +   A    G     ++ K D     +I DC   +     CD  +K+
Sbjct:    5 LVIVLIIAGIRCDGFSDQVFRTLFIGEGNACYRTFNKTHEFGCQANRENENGLI-VRIDKQEDFKNLDSCWNSFYPKYSGKYWALLPVNLIRRDTISQLKSSKCLSGIVLY--NSGESIHPGDESTAASHDAECPNAASDYYLQDKNEEYCERKINSRGAITRDGLMKIDWRIQMVFIDNSTDLE---IIEKCYSMFNK-PKEDGSSGYPYCGMSFRLANMAAGNSEICYRRGKNDAKLFQMNIDSGDAPQLCGAMHSDN--IFAFPTPIPTSPTNETIITSKYMMVTARMDSFGMIPEISVGEVSVLTSIISVLAAARSMGTQIEKWQKASNTSNRNVFFAFFNGESLDYIGSGAAAYQMENGKFPQMIRSDRTHIHPIRPNELDYILEVQQIGVAKGRK---YYVHVDGERYQQNKTQTDRVIDRIERGLRSHAFDLEKPSGSGDRVPPASWHSFAKADAHVQSVLLAPYGKEYEYQRVNSILDKNEWTEDEREKAIQEIEAVSTAILAAAADYVGVETDEVVAKVDKKLITTIFDCLITSNFWFDCDFMQKL 547          
BLAST of SMED30008063 vs. TrEMBL
Match: A0A4Z2D016 (Nicastrin isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_005923 PE=4 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 2.395e-69
Identity = 195/655 (29.77%), Postives = 316/655 (48.24%), Query Frame = -2
Query:  224 MLTFILTICLTIFAVQCNEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLNYLKENT--ILVISSSLFIKQNLTDSILKNKFIKGLVVFERDNCSDLFCNDSNESFSEDYSIPNEAYSF-------NHNHSYNPSGTKYAFRNWPFPVTLIDSRHKVEQDKIIECYSKFNKNPKSSRKCSLEIRNFMAAVKSLKTCLDFLEIQRKFIDYFHHVN----FCRELTGENYVVHAFDK-------------TKSAKPNPVIVLISRIDSLSMFERSAFNVHGTVTXXXXXXXXXXXXXSQPEFRNPKALKKDVLFLFLDNESYDYLGSDRFVWELNNNYLVNFTGVPVNFTNLDLLLEFGEMGFS---NFSQTSFFYPQFPGQDKINNKTLNYFTKLWTFFERYGFGSSYTNHD------LPPASIQYFLLRNKTIP--SIVMSDH-RKSFKNMFYNSYLDSKFP----RNISEELLAIVNSVASFVYQEATGNNLTRLMNKSDDANPFSIIDCFTNNVHCDLFKKVLPTTLIDNLHSLGTPIPTQEHSSKSEKYLRYRFSSLLENLITLFSGEKVNNSDCTNCPKCKNLTK-------LDHGNTSD-CYSINYYISDNFYNTEKD---APLWSMS 2029
            +L  + ++ + I  + C++I N IY  IP+   S C RRLN T  +GCSS + GN G+  +  N++E + +  +   +T  ++++S   F   +L    +  + +KGL+VF  ++      ND N  FSE    PN  YS        + +  +NP+GT Y++ +WPFPV L+   +   +  + EC+S  NK P    +CS+EI N M+A  S +TC      +R+++   H       FC ELTG N ++ A D              T     N  + +++R+DS S+FERS F+  G + S ++L+SV   LM Q  F++   L+KD+ F FLDNE+YD++GS R  ++L +  +  +TG PV + N+  ++E GE+G S   N   T +        +   + T N F +L    +           D      LPP S    LL+    P   +V+SDH R  F+N  + S++D+K+P          LL + N++A  +++  + N+ T + +      P  I++CF  N+ CDLFK  L       L  L TP+P Q +       +  + S L+  L+   +GE+      T  P C  + +       + H N+S+ CY     I   F   E +   AP W  S
Sbjct:    7 LLQILSSLIINIDPLHCSKITNHIYNYIPLSYTSFCTRRLNLTGQVGCSSSTTGNSGV-ALFMNESEDIMQTLHSDTSTPFVILVSVKHFTNASLMRFFMSTRNVKGLIVFSNEDV-----NDDNHEFSESSKCPNGLYSAYNVTKQCDLDIQWNPAGTDYSYIDWPFPVVLVADVNNTIRASMYECFSVLNKEPYDDTRCSIEIYNPMSAAGSSETCF-----RRQYLMTLHISESSGIFCDELTGLNIILSASDSVNHSWNNIAVNIGTSGRSENSSVFILTRMDSRSIFERSGFSSQGVLPSVAVLISVAAHLMRQKAFKD-SHLEKDLFFGFLDNEAYDFMGSYRLSYDLGSGNIARYTGRPVMWNNVHAVIELGEVGLSQKHNNLHTFYMLTDSKSYNLTRDFTDNIFHQLTAASKASQKVDLQRPSDKLQELPLPPTSSMQTLLQTSARPLSHVVLSDHDRPPFRNKHFESFMDTKWPPTDNPTADITLLDLANTLADALHRIVSANH-TSIPSGITYPKPGDIMECFVTNLGCDLFKMYLSPVDYRYLQMLNTPVPMQTYLPLGRHEI--KVSHLVSILLMGLTGER------TLTPTCPPINERGPYTYWMGHFNSSEQCYYTRMDIMSRFLLMENEKLRAPAWMRS 640          
BLAST of SMED30008063 vs. TrEMBL
Match: A0A0V0J209 (Ubiquitin carboxyl-terminal hydrolase isozyme L5 OS=Schistocephalus solidus OX=70667 GN=UCHL5 PE=4 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 1.243e-67
Identity = 189/633 (29.86%), Postives = 310/633 (48.97%), Query Frame = -2
Query:  182 QIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLNYLKENTILVISSSLFIKQNLTDSILKNKFIKGLVVFERDNCSDLFCNDSNESFSEDYSIPNEAYSFNHNHS--------YNPSGTKYAFRNWPFPVTLIDSRHKVEQDKIIECYSKFNKNPKSSRKCSLEIRNFMAAVKSLKTCLDFLEIQRKFIDYF--HHVNFCRELTGENYVVHAFDK-----TKSAKPNPVIVLISRIDSLSMFERSAFNVHGTVTXXXXXXXXXXXXXSQPEFRNPKALKKDVLFLFLDNESYDYLGSDRFVWELNNNYLVNFTGVPVNFTNLDLLLEFGEMGF--SNFSQTSFFYPQFPGQDKINNKTLNYFTKLWTFFERYGF---GSSYTN-------HDLPP-ASIQYFLLRNKTIP-----SIVMSDHRKSFKNMFYNSYLDSKFPRN----ISEELLAIVNSVASFVYQE--ATGNNLTRLMNKSDDANPFSIIDCFTNNVHCDLFKKVLPTTLIDNLHSLGTPIPTQEHSSKSEKYLRYRFSSLLENLITLFSGEKVNNSDCTNCPKCKNLTKLDHGNTSDCYSINYYISDNFYNTEKDAPLWSMSSIVDDQSVKMFLQG 1963
            +IY  IP  +VS C R L+Y   +GCSS+   ++G I +A + + L  +L+      I+VIS  LF+ ++L   +  +K + GLVVF  +N +D      N  FSE+   PN AY+F +N +        +NP+   YA  +WPFPV LI  +     +K ++CY + N N     +CS+EIRNFM+ ++S +TC      +   + Y       FC ++ G N +V A DK     T    PN  +++++RIDS SMF+R A +  G +   ++L SV   L++ P F++  +LKKDVLF FLDNE+YD++GS R +++L N  +   +G P    +++ +LE   +G   S  + +++F    P   +I+  T+N  + +W    +      G ++ N         LPP  S+Q  L + + I      +++       + +   +S+LD  +P          LL + N VA+ +Y E   TG+    LM       P  ++DCF  N  CDL +  L   +++ L SL  PIPTQ +     +   +R S ++  L+   +GE++       CP             +D Y    Y+   F  ++     W   S++D  +V  FL G
Sbjct:   20 EIYQYIPQTNVSFCSRSLSYDGQVGCSSKYPSSLGPIFVADSHSNLPEELSTFTVEHIIVISYHLFLNRSLLFHLRNSKKVAGLVVFAPENPNDE--EIKNTDFSENSFCPNGAYNFYNNKTFQCEVTPKWNPTAFDYATISWPFPVVLILDKENHIWNKTLDCYKRLNVNSTDDTRCSMEIRNFMSGIQSSQTCY----YREHLLSYRLEQPTEFCSQIGGVNLMVRAIDKPVLNNTSCRLPNSTLLVLTRIDSRSMFDRKASSSLGVLPGVAVLTSVAAHLLNTPAFKS-YSLKKDVLFAFLDNEAYDFMGSQRLLFDLTNMRMAARSGAPFTIESIESVLELSAVGLPDSKANVSTYFLISDP---EISQATINVTSAIWRALNKSTTVFPGVNFVNLTEVKPGLPLPPTVSLQALLTQYRRIGRQLSHTVIFDRDGPPYADPRMDSFLDVTWPPESLPYADGILLNLANVVANAIYSEIVTTGD----LMPPIQSVTPGELMDCFVKNPGCDLLRMHLEPDVVNFLLSLSGPIPTQGYPPIDGR--EWRLSHVVARLLMGLTGERLK-----ECPP------------ADEYGAYTYMYGYFNGSQ-----WCYRSLIDTSTVFFFLDG 614          
BLAST of SMED30008063 vs. TrEMBL
Match: A0A4Z2CZX9 (Nicastrin isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_005923 PE=4 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 9.236e-66
Identity = 170/547 (31.08%), Postives = 280/547 (51.19%), Query Frame = -2
Query:  515 MLTFILTICLTIFAVQCNEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLNYLKENT--ILVISSSLFIKQNLTDSILKNKFIKGLVVFERDNCSDLFCNDSNESFSEDYSIPNEAYSF-------NHNHSYNPSGTKYAFRNWPFPVTLIDSRHKVEQDKIIECYSKFNKNPKSSRKCSLEIRNFMAAVKSLKTCLDFLEIQRKFIDYFHHVN----FCRELTGENYVVHAFDK-------------TKSAKPNPVIVLISRIDSLSMFERSAFNVHGTVTXXXXXXXXXXXXXSQPEFRNPKALKKDVLFLFLDNESYDYLGSDRFVWELNNNYLVNFTGVPVNFTNLDLLLEFGEMGFS---NFSQTSFFYPQFPGQDKINNKTLNYFTKLWTFFERYGFGSSYTNHD------LPPASIQYFLLRNKTIP--SIVMSDH-RKSFKNMFYNSYLDSKFP--RNISEE--LLAIVNSVASFVYQEATGNNLTRLMNKSDDANPFSIIDCFTNNVHCDLFKKVL 2029
            +L  + ++ + I  + C++I N IY  IP+   S C RRLN T  +GCSS + GN G+  +  N++E + +  +   +T  ++++S   F   +L    +  + +KGL+VF  ++      ND N  FSE    PN  YS        + +  +NP+GT Y++ +WPFPV L+   +   +  + EC+S  NK P    +CS+EI N M+A  S +TC      +R+++   H       FC ELTG N ++ A D              T     N  + +++R+DS S+FERS F+  G + S ++L+SV   LM Q  F++   L+KD+ F FLDNE+YD++GS R  ++L +  +  +TG PV + N+  ++E GE+G S   N   T +        +   + T N F +L    +           D      LPP S    LL+    P   +V+SDH R  F+N  + S++D+K+P   N + +  LL + N++A  +++  + N+ T + +      P  I++CF  N+ CDLFK V+
Sbjct:    7 LLQILSSLIINIDPLHCSKITNHIYNYIPLSYTSFCTRRLNLTGQVGCSSSTTGNSGV-ALFMNESEDIMQTLHSDTSTPFVILVSVKHFTNASLMRFFMSTRNVKGLIVFSNEDV-----NDDNHEFSESSKCPNGLYSAYNVTKQCDLDIQWNPAGTDYSYIDWPFPVVLVADVNNTIRASMYECFSVLNKEPYDDTRCSIEIYNPMSAAGSSETCF-----RRQYLMTLHISESSGIFCDELTGLNIILSASDSVNHSWNNIAVNIGTSGRSENSSVFILTRMDSRSIFERSGFSSQGVLPSVAVLISVAAHLMRQKAFKDSH-LEKDLFFGFLDNEAYDFMGSYRLSYDLGSGNIARYTGRPVMWNNVHAVIELGEVGLSQKHNNLHTFYMLTDSKSYNLTRDFTDNIFHQLTAASKASQKVDLQRPSDKLQELPLPPTSSMQTLLQTSARPLSHVVLSDHDRPPFRNKHFESFMDTKWPPTDNPTADITLLDLANTLADALHRIVSANH-TSIPSGITYPKPGDIMECFVTNLGCDLFKMVI 540          
BLAST of SMED30008063 vs. TrEMBL
Match: A0A074ZCI8 (Ncstrn_small domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_07458 PE=4 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 1.929e-65
Identity = 188/601 (31.28%), Postives = 293/601 (48.75%), Query Frame = -2
Query:  356 MLTFILTIC--LTIFAVQCNEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGI---IEIAFNKTELLTKLNYLKENTILVISSSLFIKQNLTDSI--LKNKFIKGLVVFERDNCSDLFCNDSNESFSEDYSIPNEAYSF-------NHNHSYNPSGTKYAFRNWPFPVTLIDSRHKVEQDKIIECYSKFNKNPKSSRKCSLEIRNFMAAVKSLKTCLDFLEIQRKFIDYFHHVNFCRELTGENYVVHAFDKTKSAKP--------------NPVIVLISRIDSLSMFERSAFNVHGTVTXXXXXXXXXXXXXSQPEFRNPKALKKDVLFLFLDNESYDYLGSDRFVWELNNNYLVNFTGVPVNFTNLDLLLEFGEMGFSNFSQTSFFY----PQFPGQDKINNKTLNYFTKLWTFFERYGFGS------SYTNHDLPP-ASIQYFLLRNK-TIPSIVMSDHR-KSFKNMFYNSYLDSKFPRNISEE--LLAIVNSVASFVYQEATGNNLTRLMNKSDDANPFSIIDCFTNNVHCDLFKKVLPTTLIDNLHSLGTPIPTQEHSSKSEKYLRYRFSSLLENLITLFSGEKVNNSDC 2029
            + TF+LT C  LT F+ Q N +   IY+    +S SHC RRLN T  IGCSS    + G+   +E A   T+ L   N     T+LV+  SLF+  +L   +     + +  +V+F++     +  N     FSE    PN  YS        N   ++NP GT Y+   WPFPV LI +     + ++  CY +FN NP    +C +EIRN M+AV S   C+    +    I +   + +C EL G N ++ A + T S +               N  IV+++R+DS SMFERSAF     +   S+L+S+   L+ QP F+  + LK+D+ F FLDNE++D++GS R  ++L    L  +TGVP+ + ++   +E GE+G +  +    +Y         Q K+    L    +L    ER+G  S      S     LPP AS+Q  L      +P I+++DH      +  + S+LD  +P +   +  LL + N++A  +++    ++L    N S    P  ++ CF NNV CDL +  L    +  L SL TPIP Q +    +  L  + S ++  L+   +GE+    DC
Sbjct:    7 LCTFLLTSCAILTCFS-QSNNVMGDIYHYFSEQSTSHCSRRLNVTGQIGCSSRLQSSSGVALFVEHADEVTDFLNAENVAP--TVLVMQYSLFLNSSLMSDVRSYSERTVGLVVLFQK-----ISKNKHPVPFSESDECPNALYSHYGAERQCNVTPAWNPHGTAYSSIEWPFPVVLIRTSDTSIESELFRCYKQFNANPVDDTRCLIEIRNVMSAVSSSALCIRRESLMGLPI-FESPIVYCDELNGVNILLSATNTTASIRTNSPNRSVSVQERSRNSSIVVLTRLDSRSMFERSAFASQWALPGTSVLVSIAAHLIRQPAFQQLQ-LKRDLFFAFLDNEAFDFMGSGRLAYDLRERNLAAYTGVPLGWEHVHSFIELGELGLAAKNPLPTYYTLADESIYEQTKVVTDELR--EQLAAANERFGQISISRAPDSIARLPLPPTASLQSLLSSAPHPLPHILLADHAGPPLWDKHFESFLDFVWPPDSGADQVLLVLANTLADALHRLVVKDSLPMPANIS-HPTPGDLMLCFVNNVTCDLLRTFLSPGDLHFLQSLKTPIPAQSYLPLDKHEL--KISHIISVLLMGLTGERTATRDC 592          
BLAST of SMED30008063 vs. TrEMBL
Match: A0A4S2LPW9 (Ncstrn_small domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005975 PE=4 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 4.649e-64
Identity = 182/598 (30.43%), Postives = 291/598 (48.66%), Query Frame = -2
Query:  356 MLTFILTIC--LTIFAVQCNEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLNYLKEN---TILVISSSLFIKQNLTDSILK-NKFIKGLVVFERDNCSDLFCNDSNESFSEDYSIPNEAYSF-------NHNHSYNPSGTKYAFRNWPFPVTLIDSRHKVEQDKIIECYSKFNKNPKSSRKCSLEIRNFMAAVKSLKTCLDFLEIQRKFIDYFHHVNFCRELTGENYVVHAFDKTKSAKP--------------NPVIVLISRIDSLSMFERSAFNVHGTVTXXXXXXXXXXXXXSQPEFRNPKALKKDVLFLFLDNESYDYLGSDRFVWELNNNYLVNFTGVPVNFTNLDLLLEFGEMGFSNFSQTSFFYPQFPGQ--DKINNKTLNYFTKLWTFFERYGFGS------SYTNHDLPP-ASIQYFLLRNK-TIPSIVMSDHR-KSFKNMFYNSYLDSKFPRNISEE--LLAIVNSVASFVYQEATGNNLTRLMNKSDDANPFSIIDCFTNNVHCDLFKKVLPTTLIDNLHSLGTPIPTQEHSSKSEKYLRYRFSSLLENLITLFSGEKVNNSDC 2029
            + TF+LT C  LT FA Q + +   IY+    +S SHC RRLN T  IGCSS    + G+     +  E++  LN   +N   T+LV+  SLF+  +L + +   ++   GLVV  +        N  +  FSE    PN  YS        +   ++NP G  Y+   WPFPV LI +     + ++  CY +FN NP    +C +EIRN M+A+ S   C+    +    I +   + +C EL G N ++ A + T S +               N  +V+++R+DS SMFERSAF   G +   S+L+S+   L+ QP F+  + LK+D+ F FLDNE++D++GS R  ++L    L  +TG P+ + ++   +E GE+G    +    +Y        ++    T     +L    ER+G  S      S     LPP AS+Q  L      +P I+++DH      +  + S+LD  +P +   +  LL + N++A  +++    ++L    + S    P  ++ CF NNV CDL +  L    +  L SL TPIP Q +    +  L  + S ++  L+   +GE+    DC
Sbjct:   49 LCTFLLTSCTILTCFA-QPHHVMGDIYHYFSEQSTSHCSRRLNITGQIGCSSRLRSSSGVALFVEHADEVIDFLN--AKNIVPTVLVMQYSLFLNSSLMNDVRSYSERAVGLVVLSQQTSE----NKHSLPFSESDECPNALYSHYGAERQCSVTPAWNPHGAAYSSIEWPFPVVLIQTADASIESELFRCYKQFNANPVDDTRCLIEIRNVMSAISSSALCIRRESLMGLPI-FESPIVYCDELNGVNILLSATNTTASIRKNSPNRSVSVQERSRNSSVVVLTRLDSRSMFERSAFASQGALPGISVLVSIAAHLIRQPAFQQLQ-LKRDLFFAFLDNEAFDFMGSGRLAYDLRERNLAAYTGFPLGWEHIHSFIELGELGLPAKNPLPTYYTLVDESIYEQTKEDTDELREQLAAANERFGQISISRAPDSVARLPLPPMASLQSLLSSAPHPLPHILLADHAGPPLWDKHFESFLDFVWPPDSGSDQVLLVLANTLADALHRLVVKDSLPMPASIS-HPTPGDLMLCFVNNVTCDLLRTFLSPGDLRFLQSLKTPIPAQSYLPLDKHEL--KISHIISVLLMGLTGERTATRDC 634          
BLAST of SMED30008063 vs. Ensembl Cavefish
Match: NCSTN (nicastrin [Source:NCBI gene;Acc:111194526])

HSP 1 Score: 125.176 bits (313), Expect = 2.367e-29
Identity = 129/567 (22.75%), Postives = 238/567 (41.98%), Query Frame = -2
Query:  467 TFILTICLTIFAVQCNEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLNYLKENTILVISSSLFIKQNLTDSILKNKFIKGLVVFERDNCSDLFCNDSNESFSEDYSIPN-------EAYSFN----HNHSYNPSGTKYAFRNWPFPVTLIDSRHKVEQDKIIECYS----KFNKNPKSSRKCSLEIRNFMAAVKSLKTCLDFLEIQ-------RKFIDYFHHVNFCRELTGENYVVHAFDKTKSAKPNPVIVLISRIDSLSMFERSAFNVHGTVTXXXXXXXXXXXXXSQPEFRNPKALKKDVLFLFLDNESYDYLGSDRFVWELNNNYLVNFTGVPVNFTNLDLLLEFGEMGFSNFSQTSFFYPQFPGQDKINNKTLNYFTK--------LWTFFERYGFGSSYTNHDLPPASIQYFLLRNKTIPSIVMSDHRKSFKNMFYNS------YLDSKFPRNISEE------------LLAIVNSVASFVYQEATGNNLTRLMNKSDDANPFSIIDCFTNNVHCDLFKKVLPTTLIDNLHSLGTPIP 2023
            +++L I L    V C+ ++ +IY  I + +   CVR LN T  IGC S  +G+ G++ +  ++ +L   L        +V+  ++F  +     +  +  + G+ V              +E FS     PN       E+Y       +N  +NP G   ++ ++ FP+  +++ ++ +   I +CY     + N        C++++ + M AV    TC+   ++Q        K  D  +  N    +   N  +    + +S     V++  +R+D  S F   A +  GTV+    LL+  + L    +   P    +++ F F   E++DY+GS R V+++ N   V      ++  N+  LLE G++G  N S           ++   N+ ++   K        L    E  G     ++  LPP+S Q F LR + IP +V++DH+ +F N +Y S      YL+  +P ++S E            L  +   VA  +Y +A G++       +D      ++  F    +   F  +LP   +     LGT  P
Sbjct:    9 SYLLLISLFYSYVSCSSVEQKIY--IQLNNTVPCVRLLNATHQIGCQSSISGDTGVLHVFESEADLEWILTNGPHPPYMVVMEAVFFTRPTMMRMKNSSRVAGVAVISSSTA-------PSEGFSPHTRCPNQNSGVYGESYGPELANCNNTVWNPLGNNLSYEDFAFPIFFLENDNQTQ--VIRKCYEDHNVRVNGTAPEYPLCAMQLFSHMHAVTDTVTCMRRTDLQNSFSINPEKLCDPLNDFNVWASIRPLNSSIKGHKENES-----VVIAATRLDGRSFFWDVATSAEGTVSGIVTLLAAAQALYPVTQEAPP---PRNIFFTFFQGEAFDYIGSSRMVYDMQNAKFV------IDMDNVHSLLEIGQVGLRNGSNLWIHSDPVSRKNSSVNEEVDKLVKNMQSVASSLKLSVEEPG-----SSQALPPSSFQRF-LRARPIPGLVLADHQSAFINRYYESLYDTPAYLNLTYPPDLSPEEQLEYETEAAKSLSEVATLVARSLYTQAGGDDQFLSNITADTKTVAKLLYGFLIKSNNSWFSSLLPPEALGRGSILGTGAP 544          
BLAST of SMED30008063 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010343.1 (pep scaffold:Pmarinus_7.0:GL482912:143:6397:-1 gene:ENSPMAG00000009368.1 transcript:ENSPMAT00000010343.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 5.657e-11
Identity = 41/169 (24.26%), Postives = 76/169 (44.97%), Query Frame = -2
Query: 1538 ILTICLTIFAVQCNEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLNYLKENT-ILVISSSLFIKQNLTDSILKNKFIKGLVVFERDNCSDLFCNDSNESFSEDYSIPNEAYSFNHNHSY--------NPSGTKYAFRNWPFPVTLI 2017
            ++  C     V  N ++ +IY E+  +  + CVR +N T  IGC S   G+ G++ +  +  +L   L     +  + ++ + +F ++ +    +    + G+VV        L    +  +FS D S PN+ +    +  Y        NPSGT  A  ++ FPV L+
Sbjct:   20 LVRFCRFAAWVHGNSVEQKIYVEL--KDTAACVRLMNGTHQIGCQSSVGGDTGVLHLVSSAEDLAWVLKDGPHSPYMALLDNYMFSRETMMQLKVARGRVAGVVVMLHQKALPL----APANFSHDLSCPNDKFGMYEDTDYAHCRRTVWNPSGTGLALEDFGFPVFLL 182          
BLAST of SMED30008063 vs. Ensembl Nematostella
Match: EDO38368 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD25])

HSP 1 Score: 143.28 bits (360), Expect = 2.434e-35
Identity = 131/487 (26.90%), Postives = 220/487 (45.17%), Query Frame = -2
Query:  695 DLMLTFILTICLTIFAVQCNEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLNYLKENTILVISSSLFIKQNLTDSILKNKFIKG-LVVFE-RDNCSDLFCNDSNESFSEDYSIPNE---AYSFNHNHS------YNPSGTKYAFRNWPFPVTLIDSRHKVEQDKIIECYSKFNKNPKSSRK---CSLEIRNFMAAVKSLKTCLDFLEI----QRKFIDYFHHVNFCRELTGENYVVHAFDKTKSAKPNPVIVLISRIDSLSMFERSAF----NVHGTVTXXXXXXXXXXXXXSQ--PEFRNPKALKKDVLFLFLDNESYDYLGSDRFVWELNNN-YLVNFTGVPVNFTNLDLLLEFGEMG---FSNFSQTSFFYPQFPGQ-DKINNKTLNY---FTKLWTFFERYGFGSSYTNHD--------LPPASIQYFLLRNKTIPSIVMSDHRKSFKNMFYNSYLDSKF 2035
            + +L F++ + L++  V+ +E+   IY +I  + V  CV   N T  IGC+S   G+VG++    ++ ++   LN  K    + I +S   K ++  S+ K   I G LV+F  RD       +   E FS DYS PN+    Y  N ++S      +N  G   +F  +  P+ L+    +V+  + I+CY K+N     + +   CS ++++FM A K   TC+    I    Q  F D    +N    L       +  ++T + K   ++V+ +++DS S F    +    +  G +   +   ++     +   PE +NP      ++F+    ES+DY+GS R V+E+    +  N   VP +   +D     G      F   +Q +    Q     D ++ KT         L T  ++ G  S+ T  D        LPPAS Q FL+ N  IP +V++DH  +F N +YNS  D  F
Sbjct:    8 NFILVFLIIVLLSLGGVRSDEVARLIYEDI--KGVIPCVLLTNATHQIGCTSTIGGHVGVLHFVQSQDDVDWLLNKGKHAPYIPILTSEMFKGDVLSSLAKKNVINGALVIFTGRDG------DPPKEGFSPDYSCPNDNHGLYRGNADYSGCKKQIWNTVGNAMSFLYYGIPIFLLHDSKEVQ--RAIQCYEKYNSPVNRTPEYPLCSAQLKDFMFAAKDTPTCMRKTNIPNPTQNMFCDPLGDLNIWSTL-------YPMNRTPNEKE--IVVVAAKMDSSSFFHDLVYGADNDASGVIALLAAAKALGDAKRNGTLPEPKNP------IMFVLFHGESWDYIGSSRMVYEMEQGLFPPNPWKVPGDTGKVDKNFTIGLKNIKYFIELNQVALGGDQLWAHTDPVSRKTGEVDKEVQTLMTALQKTGKASNLTIKDPSPGKAKPLPPASFQRFLMSNNKIPGVVLTDHEANFTNKYYNSRFDDLF 469          
BLAST of SMED30008063 vs. Ensembl Medaka
Match: NCSTN (nicastrin [Source:NCBI gene;Acc:101163847])

HSP 1 Score: 104.76 bits (260), Expect = 6.780e-23
Identity = 119/463 (25.70%), Postives = 196/463 (42.33%), Query Frame = -2
Query:  620 CVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLNYLKENTILVI-SSSLFIKQNLTDSILKNKFIKGLVVFERDNCSDLFCNDSNESFSEDYSIPNE---AYSFNHNHSY--------NPSGTKYAFRNWPFPV-TLIDSRHKVEQDKIIECYSKFNKNPKSSRK----CSLEIRNFMAAVKSLKTCLDFLEIQRKFIDYFHHVNFCRELTGENYVVHAFDKTKSAKPN----PVIVLISRIDSLSMFERSAFNVHGTVTXXXXXXXXXXXXXSQPEFRNPKALKKDVLFLFLDNESYDYLGSDRFVWELNNNYLVNFTGVPVNFTNLDLLLEFGEMGFSNFSQTSFFYPQFPGQDKINNKTLNYFTKLWTFFERYGFGSSYTNHDLPPASIQYFLLRNKTIPSIVMSDHRKSFKNMFYNSYLDSK-------FPRNISEELLAIVNSVASFVYQEATG 1924
            CVR LN T  IGC S   G+VG++ +  ++  L   L+       +VI  S+LF + +      +   + G+VV E          +  + FS   S PNE    YS ++  SY        NP G   ++  + FP+ ++ DS    + + I  CY + N+    S      C++++ + M+AV    TC+   EI       F     C  L  EN          +AK +     V++   ++DS S F   A     T T    LL+    L +         L + +L+ F   E++DY+GS R V+++ NN        P++  N+  +LE G++   + S+          +++  NK ++    L                 LPP+S Q F LR ++IP +V+ +H+ SF N +Y S  D+         P   +EE L  V   A  + + AT 
Sbjct:   23 CVRLLNATHQIGCQSSFGGDVGVVHLLESEENLDWVLSSGPNPPYMVILESTLFTRYS------QCSRVAGVVVVEP-------TTNPPDGFSPHTSCPNENMGVYSESYGPSYAHCNVTVWNPLGNGLSYEEFDFPIFSMKDSN---DTEVIRRCYREHNRAVNGSTPQYPLCAMQLFSHMSAVTDTATCMRRSEIPFSLTPEF----VCDPLGDENIWASTKPLNNTAKGHKEGESVVIAAVKMDSRSFFFGLAPGADSTATGLVALLAAANALRNAT-----AELNRTILYTFFHGETFDYIGSSRMVYDMENNQF------PLDLDNVHSILEVGQVALGSNSRLWLHSDPVSRRNRSVNKLVSNL-HLAAAGLNISLEEPNVTQPLPPSSFQRF-LRVRSIPGVVIENHQASFTNKYYQSIFDNAESLQLNYSPNLTAEEQLEFVTDAAKNLTEVATA 452          
BLAST of SMED30008063 vs. Planmine SMEST
Match: SMESG000043378.1 (SMESG000043378.1)

HSP 1 Score: 1267.29 bits (3278), Expect = 0.000e+0
Identity = 649/651 (99.69%), Postives = 650/651 (99.85%), Query Frame = -2
Query:   77 MLTFILTICLTIFAVQCNEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLNYLKENTILVISSSLFIKQNLTDSILKNKFIKGLVVFERDNCSDLFCNDSNESFSEDYSIPNEAYSFNHNHSYNPSGTKYAFRNWPFPVTLIDSRHKVEQDKIIECYSKFNKNPKSSRKCSLEIRNFMAAVKSLKTCLDFLEIQRKFIDYFHHVNFCRELTGENYVVHAFDKTKSAKPNPVIVLISRIDSLSMFERSAFNVHGTVTXXXXXXXXXXXXXSQPEFRNPKALKKDVLFLFLDNESYDYLGSDRFVWELNNNYLVNFTGVPVNFTNLDLLLEFGEMGFSNFSQTSFFYPQFPGQDKINNKTLNYFTKLWTFFERYGFGSSYTNHDLPPASIQYFLLRNKTIPSIVMSDHRKSFKNMFYNSYLDSKFPRNISEELLAIVNSVASFVYQEATGNNLTRLMNKSDDANPFSIIDCFTNNVHCDLFKKVLPTTLIDNLHSLGTPIPTQEHSSKSEKYLRYRFSSLLENLITLFSGEKVNNSDCTNCPKCKNLTKLDHGNTSDCYSINYYISDNFYNTEKDAPLWSMSSIVDDQSVKMFLQGPNTPLLITGXXXXXXXXXXXTLISSKMSEIFQSDS 2029
            MLTFILTICLTIFAVQCNEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLNYLKENTILVISSSLFIKQNLTDSILKNKFIKGLVVFERDNCSDLFCNDSNESFSEDYSIPNEAYSFNHNHSYNPSGTKYAFRNWPFPVTLIDSRHKVEQDKIIECYSKFNKNPKSSRKCSLEIRNFMAAVKSLKTCLDFLEIQRKFIDYFHHVNFCRELTGENYVVHAFDKTKSAKPNPVIVLISRIDSLSMFERSAFNVHGTVTSASLLLSVLKLLMSQPEFRNPKALKKDVLFLFLDNESYDYLGSDRFVWELNNNYLVNFTGVPVNFTNLDLLLEFGEMGFSNFSQTSFFYPQFPGQDKINNKTLNYFTKLWTFFERYGFGSSYTNHDLPPASIQYFLLRNKTIPSIVMSDHRKSFKNMFYNSYLDSKFPRNISEELLAIVNSVASFVYQEATGNNLTRLMNKSDDANPFSIIDCFTNNVHCDLFKKVLPTTLIDNL+SLGTPIPTQEHSSKSEKYLRYRFSSLLENLIT FSGEKVNNSDCTNCPKCKNLTKLDHGNTSDCYSINYYISDNFYNTEKDAPLWSMSSIVDDQSVKMFLQGPNTPLLITGVVITIFMTIFMTLISSKMSEIFQSDS
Sbjct:    1 MLTFILTICLTIFAVQCNEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLNYLKENTILVISSSLFIKQNLTDSILKNKFIKGLVVFERDNCSDLFCNDSNESFSEDYSIPNEAYSFNHNHSYNPSGTKYAFRNWPFPVTLIDSRHKVEQDKIIECYSKFNKNPKSSRKCSLEIRNFMAAVKSLKTCLDFLEIQRKFIDYFHHVNFCRELTGENYVVHAFDKTKSAKPNPVIVLISRIDSLSMFERSAFNVHGTVTSASLLLSVLKLLMSQPEFRNPKALKKDVLFLFLDNESYDYLGSDRFVWELNNNYLVNFTGVPVNFTNLDLLLEFGEMGFSNFSQTSFFYPQFPGQDKINNKTLNYFTKLWTFFERYGFGSSYTNHDLPPASIQYFLLRNKTIPSIVMSDHRKSFKNMFYNSYLDSKFPRNISEELLAIVNSVASFVYQEATGNNLTRLMNKSDDANPFSIIDCFTNNVHCDLFKKVLPTTLIDNLYSLGTPIPTQEHSSKSEKYLRYRFSSLLENLITFFSGEKVNNSDCTNCPKCKNLTKLDHGNTSDCYSINYYISDNFYNTEKDAPLWSMSSIVDDQSVKMFLQGPNTPLLITGVVITIFMTIFMTLISSKMSEIFQSDS 651          
BLAST of SMED30008063 vs. Planmine SMEST
Match: SMESG000035366.1 (SMESG000035366.1)

HSP 1 Score: 130.183 bits (326), Expect = 3.750e-31
Identity = 157/659 (23.82%), Postives = 282/659 (42.79%), Query Frame = -2
Query:  188 NFLCDLMLTFILTICLTIFAVQCNEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLNYLK-ENTILVISSSLFIKQNLTDSIL-KNKFIKGLVVFERDNCSDLFCNDSN---------ESFSE-DYSIPNEAYSFNHNHSYNPSGTKYAF---RNWPFPVTLIDSRHKVEQDKIIECYSKFNKNPKSSRKCSLEIRNFMAAVKSLKTCLDFLEIQRKFIDYFHHVNFCRELTGENYVVHAFDKTKSAKPNPVIVLISRIDSLSMFERSAFNVHGTVTXXXXXXXXXXXXXSQPEFRNPKALKKDVLFLFLDNESYDYLGSDRFVWELNNNYLVNFTGVPVNFTNLDLLLEFGEMGFSNFSQTSFFYPQFPGQDKINNKTLNYFTKLWTFFERYGFGSS-YTNHDLPPASIQYFLLRNKTIPSIVMSDHRKSFKNMFYNSYLDSKFPRNISEE---LLAIVNSVASFV--YQEATGNNLTRLMNKSDDANPFSIIDCFTNNVHCDLFKKVLPTTLIDNLHSLGTPIPTQEHSSK--SEKYLRY--RFSSLLENLITLFSGEKVNNSDCTNCPKCKNLTKLDHGNTSDCYSINYYI--------------SDNFYNTEKDAPLWSMSSIVDDQSVKMFL 2047
            N    ++L  IL +   I ++QC E    I   IP  + S C  R+N++ S GC+S+S GNVG + +  + +E+  KL+  K E  ILV+ +++  +++    +L K   I G+++ E   C     ND           + FSE D         FN    Y  +  +Y       WPFP+  + ++   +Q+ + +CY  +N  P +  KC + I ++ +  ++   C++   + RK +       +C +LTG N +   F+ +K  K N +I++ +R+D+ SMF+ +A    G       +  ++ +     E +   ++  D+L  FLDNES D+LGS R +++L  N + N  G  ++  N++L++    + F+   +   F        K       +        + Y F    Y   D      + F +    I + V+S  +      + +S+LD   P NIS      + I  S+  FV  + +A   NL + M      +P ++  C  NN    L K ++        +  G P   Q +      +K+ RY  R S  +  L  L S +K       NC    NL           Y +  YI               D+F++   + P+W  +++  +Q + +F+
Sbjct:    5 NLWYKIVLPNILLLSFFINSIQCIEF---IKLRIPNYATSFCTYRMNFSHSFGCNSKSEGNVGTVLVVRSLSEMKLKLSDQKEEEVILVMPAAMLTRKSTVQDLLDKQHVIAGVIIMEPIYC---LINDKRTCKAAILKLKWFSEIDLCKEGFYRHFNQRQCYYNNLFEYYSLYEMRWPFPLVFLKAKENFQQN-VYDCYDTYNAVPGNRNKCKIRISSYTSKPRTSARCIENNYLYRKKLWLTDDFQYCVDLTGYN-IYLTFNPSKKYKENSIILIFTRMDTKSMFDTAA---AGCQELFPSIGILIFIGNILKEAKYKDSV--DILLAFLDNESDDHLGSLRLIYDLKTNQVSNGIG-NISEKNINLIISLENLTFTLVKRYFLFLYDCDSSIKSTETCKKFLAIFKRISKSYNFKVVIYNMEDDLDIWHRTFKVPKINIKTEVISSAK------YRSSFLDRMKPVNISNSTDFAVTIALSILEFVNDFPQAKIINLKKFM------DPNALAYCLFNNKCAVLRKDIMGLMERTFYYKYGCPPAAQSYVEGFLQKKHGRYINRLSYFV--LKILLSKQKRWKVVDKNCYDLSNLNNFTVVFLDKEYCVFAYIQVRTDFNPYHYVHLGDSFFHMFNNLPIWMRNNVAMEQKLILFV 635          
BLAST of SMED30008063 vs. Planmine SMEST
Match: SMESG000035366.1 (SMESG000035366.1)

HSP 1 Score: 130.183 bits (326), Expect = 3.767e-31
Identity = 157/659 (23.82%), Postives = 282/659 (42.79%), Query Frame = -2
Query:  188 NFLCDLMLTFILTICLTIFAVQCNEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLNYLK-ENTILVISSSLFIKQNLTDSIL-KNKFIKGLVVFERDNCSDLFCNDSN---------ESFSE-DYSIPNEAYSFNHNHSYNPSGTKYAF---RNWPFPVTLIDSRHKVEQDKIIECYSKFNKNPKSSRKCSLEIRNFMAAVKSLKTCLDFLEIQRKFIDYFHHVNFCRELTGENYVVHAFDKTKSAKPNPVIVLISRIDSLSMFERSAFNVHGTVTXXXXXXXXXXXXXSQPEFRNPKALKKDVLFLFLDNESYDYLGSDRFVWELNNNYLVNFTGVPVNFTNLDLLLEFGEMGFSNFSQTSFFYPQFPGQDKINNKTLNYFTKLWTFFERYGFGSS-YTNHDLPPASIQYFLLRNKTIPSIVMSDHRKSFKNMFYNSYLDSKFPRNISEE---LLAIVNSVASFV--YQEATGNNLTRLMNKSDDANPFSIIDCFTNNVHCDLFKKVLPTTLIDNLHSLGTPIPTQEHSSK--SEKYLRY--RFSSLLENLITLFSGEKVNNSDCTNCPKCKNLTKLDHGNTSDCYSINYYI--------------SDNFYNTEKDAPLWSMSSIVDDQSVKMFL 2047
            N    ++L  IL +   I ++QC E    I   IP  + S C  R+N++ S GC+S+S GNVG + +  + +E+  KL+  K E  ILV+ +++  +++    +L K   I G+++ E   C     ND           + FSE D         FN    Y  +  +Y       WPFP+  + ++   +Q+ + +CY  +N  P +  KC + I ++ +  ++   C++   + RK +       +C +LTG N +   F+ +K  K N +I++ +R+D+ SMF+ +A    G       +  ++ +     E +   ++  D+L  FLDNES D+LGS R +++L  N + N  G  ++  N++L++    + F+   +   F        K       +        + Y F    Y   D      + F +    I + V+S  +      + +S+LD   P NIS      + I  S+  FV  + +A   NL + M      +P ++  C  NN    L K ++        +  G P   Q +      +K+ RY  R S  +  L  L S +K       NC    NL           Y +  YI               D+F++   + P+W  +++  +Q + +F+
Sbjct:    6 NLWYKIVLPNILLLSFFINSIQCIEF---IKLRIPNYATSFCTYRMNFSHSFGCNSKSEGNVGTVLVVRSLSEMKLKLSDQKEEEVILVMPAAMLTRKSTVQDLLDKQHVIAGVIIMEPIYC---LINDKRTCKAAILKLKWFSEIDLCKEGFYRHFNQRQCYYNNLFEYYSLYEMRWPFPLVFLKAKENFQQN-VYDCYDTYNAVPGNRNKCKIRISSYTSKPRTSARCIENNYLYRKKLWLTDDFQYCVDLTGYN-IYLTFNPSKKYKENSIILIFTRMDTKSMFDTAA---AGCQELFPSIGILIFIGNILKEAKYKDSV--DILLAFLDNESDDHLGSLRLIYDLKTNQVSNGIG-NISEKNINLIISLENLTFTLVKRYFLFLYDCDSSIKSTETCKKFLAIFKRISKSYNFKVVIYNMEDDLDIWHRTFKVPKINIKTEVISSAK------YRSSFLDRMKPVNISNSTDFAVTIALSILEFVNDFPQAKIINLKKFM------DPNALAYCLFNNKCAVLRKDIMGLMERTFYYKYGCPPAAQSYVEGFLQKKHGRYINRLSYFV--LKILLSKQKRWKVVDKNCYDLSNLNNFTVVFLDKEYCVFAYIQVRTDFNPYHYVHLGDSFFHMFNNLPIWMRNNVAMEQKLILFV 636          
BLAST of SMED30008063 vs. Planmine SMEST
Match: SMESG000035367.1 (SMESG000035367.1)

HSP 1 Score: 129.028 bits (323), Expect = 7.154e-31
Identity = 165/645 (25.58%), Postives = 284/645 (44.03%), Query Frame = -2
Query:  188 QCNEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLN-YLKENTILVISSSLFIKQNLTDSILKNK-FIKGLVVFERDNCSDL---FCNDSNES---FSEDYSIPNEAYSFNHNHSYNPSGTKY----AFRN-----WPFPVTLIDSRHKVEQDKIIECYSKFNKNPKSSRKCSLEIRNFMAAVKSLKTCL---DFLEIQRKFIDYFHHVNFCRELTGENYVVHAFDKTKSAKPNPVIVLISRIDSLSMFERSAFN---VHGTVTXXXXXXXXXXXXXSQPEFRNPKALKKDVLFLFLDNESYDYLGSDRFVWELNNNYLVNFTGVPVNFTNLDLLLEFGEMGFSNFSQTSFFYPQFPGQDKINNKTLNYFTKLWTFFERYGFGSSYTNHDLPPASIQYFLLRNKTIPSIVMSDHRKSFKNMFYNSYLDSKFPR-NISEELLAIVNSVASFVYQEATGNNLTRLMNKSDD---ANPFSIIDCFTNNVHCDLFKKVLPTTLIDNLHSLGTPIPTQEHSS-----KSEKYLRYRFSSLLENLIT--LFSGEKVNNSDCTNCPKCKNLTKLDHGNTSDCYSINYYI------------SDNFYNTEKDAPLWSMSSIVDDQSVKMFL 1984
            Q + +K  I   IP  +VS+C  R+NYT   GC+S+S+GNVG + + ++  ELL +L+ Y  +  I+V+ + +FIK++    +++ K  I+G+V+ E D C +     C         FSE    P     + H   +N    KY     F       WPFP+  + + +  +Q  IIECY K N       KC ++I NF     +  TC+   + L  + +F   F   N+C EL G N  +  F+ +K      +I++ +RIDS S+F+ ++     ++ +VT    ++ +  +    P          D+L  FLDNES D LGS R +++L NN + N  G  ++  N+ L++   +   +  +    F  +    + I    L   T+L      Y +G     + +  +   +  L+   +P I          N +  S+LD   P  N   E++  + + A     +A    L  + NKSD      P +I  CF  ++ C L ++++     +   + G P+ +Q         K  KYL  R S ++   I   L + E+V + +C +     N T +   +   C   N  I            S  F N   D P+   S++V  Q +++F+
Sbjct:    9 QSHAVK-HIKMRIPNYAVSYCTFRMNYTHFFGCNSKSSGNVGSVLLVYSLKELLYQLSEYRHDPVIIVMPAQVFIKKSTYKIMMQKKSTIEGVVILEPDYCLNHTLGICKHKVMGVPFFSE--IDPCRDLFYRH---FNERSCKYSDVFGFYGMYEMIWPFPLIYLKANYYYQQS-IIECYQKHNAISGKKNKCKIQIYNFSPKPCNSATCILIENLLTNRWRFTSRF---NYCSELAGNNIYI-TFNPSKKYAKKAIILITTRIDSTSLFDTASAGTQELYPSVTLLMFMVQMFNITSYPPS--------SDILVGFLDNESVDNLGSLRMIYDLKNNLVSNGVG-NISDKNIVLIISIDDFIMTKTNHLFAFIYECSRNNIICTVLLRDLTQLC-----YKYGFKLIIYKMKDSRDMW--LKTINVPKIKFQSSIID-ANPYKRSFLDRMKPVINPQNEIIGRMLAEAVI---KAVNGTLNDVFNKSDKYYFILPDTISACFY-DIRCPLLQRLIGKRERNLYINYGKPLVSQAFVDGFVEIKGGKYLT-RLSYIISKFIIYRLRTTEEV-DLNCLDMDNLNNFT-MTVNDVDTCVHANIQIRTEFNPLRYVNKSTYFLNELSDLPISMRSNVVQRQKLELFV 618          
BLAST of SMED30008063 vs. Planmine SMEST
Match: SMESG000035366.1 (SMESG000035366.1)

HSP 1 Score: 129.798 bits (325), Expect = 8.503e-31
Identity = 157/659 (23.82%), Postives = 282/659 (42.79%), Query Frame = -2
Query:  188 NFLCDLMLTFILTICLTIFAVQCNEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSSESNGNVGIIEIAFNKTELLTKLNYLK-ENTILVISSSLFIKQNLTDSIL-KNKFIKGLVVFERDNCSDLFCNDSN---------ESFSE-DYSIPNEAYSFNHNHSYNPSGTKYAF---RNWPFPVTLIDSRHKVEQDKIIECYSKFNKNPKSSRKCSLEIRNFMAAVKSLKTCLDFLEIQRKFIDYFHHVNFCRELTGENYVVHAFDKTKSAKPNPVIVLISRIDSLSMFERSAFNVHGTVTXXXXXXXXXXXXXSQPEFRNPKALKKDVLFLFLDNESYDYLGSDRFVWELNNNYLVNFTGVPVNFTNLDLLLEFGEMGFSNFSQTSFFYPQFPGQDKINNKTLNYFTKLWTFFERYGFGSS-YTNHDLPPASIQYFLLRNKTIPSIVMSDHRKSFKNMFYNSYLDSKFPRNISEE---LLAIVNSVASFV--YQEATGNNLTRLMNKSDDANPFSIIDCFTNNVHCDLFKKVLPTTLIDNLHSLGTPIPTQEHSSK--SEKYLRY--RFSSLLENLITLFSGEKVNNSDCTNCPKCKNLTKLDHGNTSDCYSINYYI--------------SDNFYNTEKDAPLWSMSSIVDDQSVKMFL 2047
            N    ++L  IL +   I ++QC E    I   IP  + S C  R+N++ S GC+S+S GNVG + +  + +E+  KL+  K E  ILV+ +++  +++    +L K   I G+++ E   C     ND           + FSE D         FN    Y  +  +Y       WPFP+  + ++   +Q+ + +CY  +N  P +  KC + I ++ +  ++   C++   + RK +       +C +LTG N +   F+ +K  K N +I++ +R+D+ SMF+ +A    G       +  ++ +     E +   ++  D+L  FLDNES D+LGS R +++L  N + N  G  ++  N++L++    + F+   +   F        K       +        + Y F    Y   D      + F +    I + V+S  +      + +S+LD   P NIS      + I  S+  FV  + +A   NL + M      +P ++  C  NN    L K ++        +  G P   Q +      +K+ RY  R S  +  L  L S +K       NC    NL           Y +  YI               D+F++   + P+W  +++  +Q + +F+
Sbjct:    6 NLWYKIVLPNILLLSFFINSIQCIEF---IKLRIPNYATSFCTYRMNFSHSFGCNSKSEGNVGTVLVVRSLSEMKLKLSDQKEEEVILVMPAAMLTRKSTVQDLLDKQHVIAGVIIMEPIYC---LINDKRTCKAAILKLKWFSEIDLCKEGFYRHFNQRQCYYNNLFEYYSLYEMRWPFPLVFLKAKENFQQN-VYDCYDTYNAVPGNRNKCKIRISSYTSKPRTSARCIENNYLYRKKLWLTDDFQYCVDLTGYN-IYLTFNPSKKYKENSIILIFTRMDTKSMFDTAA---AGCQELFPSIGILIFIGNILKEAKYKDSV--DILLAFLDNESDDHLGSLRLIYDLKTNQVSNGIG-NISEKNINLIISLENLTFTLVKRYFLFLYDCDSSIKSTETCKKFLAIFKRISKSYNFKVVIYNMEDDLDIWHRTFKVPKINIKTEVISSAK------YRSSFLDRMKPVNISNSTDFAVTIALSILEFVNDFPQAKIINLKKFM------DPNALAYCLFNNKCAVLRKDIMGLMERTFYYKYGCPPAAQSYVEGFLQKKHGRYINRLSYFV--LKILLSKQKRWKVVDKNCYDLSNLNNFTVVFLDKEYCVFAYIQVRTDFNPYHYVHLGDSFFHMFNNLPIWMRNNVAMEQKLILFV 636          
The following BLAST results are available for this feature:
BLAST of SMED30008063 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NCSTN4.859e-3125.65nicastrin [Source:HGNC Symbol;Acc:HGNC:17091][more]
NCSTN1.639e-1625.32nicastrin [Source:HGNC Symbol;Acc:HGNC:17091][more]
NCSTN3.396e-1228.21nicastrin [Source:HGNC Symbol;Acc:HGNC:17091][more]
NCSTN3.639e-725.14nicastrin [Source:HGNC Symbol;Acc:HGNC:17091][more]
NCSTN7.541e-723.37nicastrin [Source:HGNC Symbol;Acc:HGNC:17091][more]
back to top
BLAST of SMED30008063 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
aph-21.716e-1421.62Nicastrin [Source:UniProtKB/Swiss-Prot;Acc:Q23316... [more]
aph-21.975e-1421.62Nicastrin [Source:UniProtKB/Swiss-Prot;Acc:Q23316... [more]
back to top
BLAST of SMED30008063 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Nct2.936e-2623.80gene:FBgn0039234 transcript:FBtr0301865[more]
Nct2.936e-2623.80gene:FBgn0039234 transcript:FBtr0084705[more]
Nct4.042e-2623.80gene:FBgn0039234 transcript:FBtr0334570[more]
Nct4.105e-2623.80gene:FBgn0039234 transcript:FBtr0306087[more]
back to top
BLAST of SMED30008063 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CABZ01110881.11.267e-825.00pep chromosome:GRCz11:2:58115123:58142854:-1 gene:... [more]
back to top
BLAST of SMED30008063 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ctsg1.218e-1022.85cathepsin G [Source:Xenbase;Acc:XB-GENE-5953471][more]
back to top
BLAST of SMED30008063 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ncstn4.542e-3125.10nicastrin [Source:MGI Symbol;Acc:MGI:1891700][more]
back to top
BLAST of SMED30008063 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q92542|NICA_HUMAN2.333e-3025.65Nicastrin OS=Homo sapiens OX=9606 GN=NCSTN PE=1 SV... [more]
sp|P57716|NICA_MOUSE3.177e-3025.10Nicastrin OS=Mus musculus OX=10090 GN=Ncstn PE=1 S... [more]
sp|Q8CGU6|NICA_RAT3.935e-3025.43Nicastrin OS=Rattus norvegicus OX=10116 GN=Ncstn P... [more]
sp|Q9VC27|NICA_DROME2.943e-2523.80Nicastrin OS=Drosophila melanogaster OX=7227 GN=Nc... [more]
sp|Q23316|NICA_CAEEL2.512e-1321.62Nicastrin OS=Caenorhabditis elegans OX=6239 GN=aph... [more]
back to top
BLAST of SMED30008063 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2D0162.395e-6929.77Nicastrin isoform 2 OS=Schistosoma japonicum OX=61... [more]
A0A0V0J2091.243e-6729.86Ubiquitin carboxyl-terminal hydrolase isozyme L5 O... [more]
A0A4Z2CZX99.236e-6631.08Nicastrin isoform 1 OS=Schistosoma japonicum OX=61... [more]
A0A074ZCI81.929e-6531.28Ncstrn_small domain-containing protein OS=Opisthor... [more]
A0A4S2LPW94.649e-6430.43Ncstrn_small domain-containing protein OS=Opisthor... [more]
back to top
BLAST of SMED30008063 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
NCSTN2.367e-2922.75nicastrin [Source:NCBI gene;Acc:111194526][more]
back to top
BLAST of SMED30008063 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000010343.15.657e-1124.26pep scaffold:Pmarinus_7.0:GL482912:143:6397:-1 gen... [more]
back to top
BLAST of SMED30008063 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008063 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO383682.434e-3526.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30008063 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
NCSTN6.780e-2325.70nicastrin [Source:NCBI gene;Acc:101163847][more]
back to top
BLAST of SMED30008063 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043378.10.000e+099.69SMESG000043378.1[more]
SMESG000035366.13.750e-3123.82SMESG000035366.1[more]
SMESG000035366.13.767e-3123.82SMESG000035366.1[more]
SMESG000035367.17.154e-3125.58SMESG000035367.1[more]
SMESG000035366.18.503e-3123.82SMESG000035366.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008063 ID=SMED30008063|Name=SMED30008063|organism=Schmidtea mediterranea sexual|type=transcript|length=2117bp
AAGATCAAAAAATTTATTAACGTTAAAAAAATCCATAAAATTGAGAAATT
ACAAATTTCTAACAAAATTTATTTTAAGAATCACTTTGAAAAATTTCTGA
CATTTTAGATGAGATAAGGGTCATGAAGATGGTCATAAAGATTGTGATCA
CAACTCCAGTAATGAGTAAAGGAGTATTGGGACCTTGAAGGAACATTTTG
ACAGATTGATCATCGACAATAGAACTCATACTCCACAACGGAGCATCCTT
TTCGGTATTGTAGAAGTTATCCGATATATAGTAATTGATCGAGTAGCAGT
CTGAAGTATTTCCATGATCTAGTTTTGTAAGATTTTTGCATTTCGGGCAA
TTGGTACAATCAGAATTATTAACCTTTTCTCCCGAAAACAAAGTAATGAG
ATTTTCCAACAGACTACTGAATCTATATCTGAGATATTTCTCCGATTTCG
ATGAATGTTCCTGGGTCGGTATCGGTGTACCGAGTGAATGAAGGTTGTCG
ATTAATGTCGTTGGTAAAACTTTTTTAAACAAATCGCAATGGACATTATT
TGTGAAACAGTCTATAATGGAAAAGGGGTTTGCATCATCTGACTTATTCA
TAAGCCGGGTAAGATTATTTCCGGTTGCTTCCTGATAAACAAAGGAAGCC
ACCGAATTAACAATGGCCAATAATTCTTCGGAAATGTTTCTGGGAAATTT
GCTATCCAAATAACTATTGTAGAACATATTTTTGAATGATTTCCTGTGAT
CTGACATCACAATCGATGGAATGGTCTTGTTTCTTAGTAGGAAATATTGA
ATTGAGGCAGGAGGCAAATCATGATTTGTATAACTGCTTCCAAATCCATA
ACGTTCAAAAAATGTCCATAATTTGGTAAAATAGTTTAATGTCTTATTAT
TGATTTTATCCTGTCCTGGAAATTGCGGATAAAAGAAACTGGTTTGGGAG
AAATTTGAGAATCCCATTTCACCGAATTCCAATAGCAAATCAAGATTAGT
GAAATTGACCGGAACACCGGTAAAGTTGACGAGATAATTATTGTTGAGCT
CCCACACAAACCGATCGGAACCCAAATAATCATAGGACTCGTTGTCAAGA
AATAAAAACAAAACATCTTTCTTAAGCGCTTTTGGATTCCGAAATTCCGG
CTGTGACATCAGAAGTTTCAAGACAGACAACAGCAAAGATGCCGATGTCA
CAGTGCCATGGACATTGAACGCAGACCTTTCAAACATTGACAAAGAGTCA
ATCCGGGATATCAAAACGATAACGGGATTCGGCTTGGCCGATTTAGTCTT
ATCAAATGCGTGAACGACATAATTCTCACCGGTCAATTCCCGGCAGAAAT
TAACATGGTGAAAATAATCGATAAATTTCCGCTGAATTTCTAGGAAATCC
AAACAAGTTTTCAGGCTTTTGACAGCCGCCATGAAGTTCCTGATTTCCAA
GGAACATTTCCGAGACGATTTTGGATTTTTATTGAATTTTGAGTAACATT
CAATAATTTTATCCTGTTCAACTTTATGACGACTATCGATTAGTGTAACT
GGGAATGGCCAATTTCTAAAAGCATATTTAGTTCCACTGGGATTATAACT
ATGATTGTGGTTAAACGAGTAAGCCTCATTGGGTATTGAGTAATCCTCGG
AGAATGATTCATTTGAATCATTACAAAACAAATCGCTGCAATTATCTCTT
TCAAATACAACTAATCCTTTAATAAATTTGTTTTTCAGTATAGAATCGGT
CAAATTTTGTTTAATAAATAAAGAGGAACTAATAACTAAAATTGTATTTT
CTTTAAGGTAATTTAACTTGGTAAGGAGTTCAGTTTTGTTAAATGCAATT
TCTATTATACCGACATTTCCATTTGATTCGGATGAGCAACCAATAGATGA
TGTATAATTTAGTCGTCGCACACAATGAGAAACAGATTCAATAGGAATTT
CGTAATAAATTTGATTCTTAATTTCATTGCATTGAACTGCGAATATAGTC
AAACATATTGTTAAAATAAAAGTTAACATCAAATCACATAGAAAATTATT
TATGGAAGAAAAATAATTTAAAATGTTTGCGTTATAATTTAAATTTTAAA
ACAACGTAAAATTAAAT
back to top

protein sequence of SMED30008063-orf-1

>SMED30008063-orf-1 ID=SMED30008063-orf-1|Name=SMED30008063-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=652bp
MLTFILTICLTIFAVQCNEIKNQIYYEIPIESVSHCVRRLNYTSSIGCSS
ESNGNVGIIEIAFNKTELLTKLNYLKENTILVISSSLFIKQNLTDSILKN
KFIKGLVVFERDNCSDLFCNDSNESFSEDYSIPNEAYSFNHNHSYNPSGT
KYAFRNWPFPVTLIDSRHKVEQDKIIECYSKFNKNPKSSRKCSLEIRNFM
AAVKSLKTCLDFLEIQRKFIDYFHHVNFCRELTGENYVVHAFDKTKSAKP
NPVIVLISRIDSLSMFERSAFNVHGTVTSASLLLSVLKLLMSQPEFRNPK
ALKKDVLFLFLDNESYDYLGSDRFVWELNNNYLVNFTGVPVNFTNLDLLL
EFGEMGFSNFSQTSFFYPQFPGQDKINNKTLNYFTKLWTFFERYGFGSSY
TNHDLPPASIQYFLLRNKTIPSIVMSDHRKSFKNMFYNSYLDSKFPRNIS
EELLAIVNSVASFVYQEATGNNLTRLMNKSDDANPFSIIDCFTNNVHCDL
FKKVLPTTLIDNLHSLGTPIPTQEHSSKSEKYLRYRFSSLLENLITLFSG
EKVNNSDCTNCPKCKNLTKLDHGNTSDCYSINYYISDNFYNTEKDAPLWS
MSSIVDDQSVKMFLQGPNTPLLITGVVITIFMTIFMTLISSKMSEIFQSD
S*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR041084Ncstrn_small
IPR008710Nicastrin
Vocabulary: biological process
TermDefinition
GO:0016485protein processing
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR041084Nicastrin, small lobePFAMPF18266Ncstrn_smallcoord: 35..202
e-value: 3.6E-32
score: 111.7
NoneNo IPR availableGENE3DG3DSA:3.40.630.10coord: 193..481
e-value: 1.3E-9
score: 39.9
NoneNo IPR availablePFAMPF05450Nicastrincoord: 253..444
e-value: 2.0E-29
score: 102.8
NoneNo IPR availableCDDcd03881M28_Nicastrincoord: 38..476
e-value: 6.06173E-46
score: 168.754
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.813
NoneNo IPR availableSUPERFAMILYSSF53187Zn-dependent exopeptidasescoord: 246..450
NoneNo IPR availableTMHMMTMhelixcoord: 619..641
IPR008710NicastrinPANTHERPTHR21092NICASTRINcoord: 2..642