Protein kinase C

Overview
NameProtein kinase C
Smed IDSMED30008057
Length (bp)2112
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase C (SMED30008057) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase C (SMED30008057) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase C (SMED30008057) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase C (SMED30008057) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008057

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30008057SMESG000037135.1 dd_Smed_v4_2110_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30008057SMESG000037135.1 dd_Smed_v4_2110_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008057SMESG000037135.1 Contig53806uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008057SMESG000037135.1 Contig53806newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 4 cellSMED30008057SMESG000037135.1 dd_Smed_v4_2110_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008057SMESG000037135.1 dd_Smed_v4_2110_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase C vs. Ensembl Human
Match: PRKCI (protein kinase C iota [Source:HGNC Symbol;Acc:HGNC:9404])

HSP 1 Score: 684.485 bits (1765), Expect = 0.000e+0
Identity = 332/628 (52.87%), Postives = 424/628 (67.52%), Query Frame = 3
Query:   36 SALIKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCG-----EDFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            S  +++K  Y  +  IT    S++++ L  E+  +C   +   FTMKWID+EGDPCT+++Q+EL+EA RLYE NKD+E+++HVFP +P  PGMPC GED  +YRRGA+RW+K Y   GH F AKRFN+ A C  C DRIWGLG+QG +C  C+LL+HK+C +LV  +CG     ++  +P  QS + S+ A                 ++ I Y     E L QV + K  +   +                                     +G     +GL DF+LL V+GRGSYAKV  V  K T +IYAMKV+KKE + D +DI+WVQTEKHVFE ASNHPFLVGLHSCFQT SRL +VIE+VNGGDLM+HMQR+ ++PEEHA+FY+AEI+LALN+LH R IIYRDLKLDNVL+D++GH+KLTDYGMCKEG+      +TFCGTPNYIAPEILR E YG SVDWW+LGVLMFEM+AG SP+   G    P++NTEDYLF +IL K IRIPRS+S KA+S+LK  LNKDP +RL C P + F D Q H FFR ++WD +  K++ PPF+P ++ +  L NFD  FT+EPV  TPDD   + KIDQSEFEGFEYINPLL++ EE V
Sbjct:   23 SHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGEDKSIYRRGARRWRKLYCANGHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTIECGRHSLPQEPVMPMDQSSMHSDHA-----------------QTVIPYNPSSHESLDQVGEEKEAMNTRE-------------------------------------SGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNEPVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV 596          
BLAST of Protein kinase C vs. Ensembl Human
Match: PRKCZ (protein kinase C zeta [Source:HGNC Symbol;Acc:HGNC:9412])

HSP 1 Score: 660.603 bits (1703), Expect = 0.000e+0
Identity = 333/624 (53.37%), Postives = 421/624 (67.47%), Query Frame = 3
Query:   45 IKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGE--DFNLPNYQSQI--KSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            ++LK  Y  +  IT ++A+ T+++L  E+  +C L      T+KW+D EGDPCT+++QMEL+EA RL    +D  +++HVFPS P  PG+PC GED  +YRRGA+RW+K Y   GH F AKRFN+ A C  C +RIWGL +QG RC  C+LL+HKRC  LV   C +  D  +P+ +  +  K+  A   + E  GI     Y+ S+  +          +KD   DL+                                P +D   G    +G +GL DF+L+ V+GRGSYAKV  V  K   +IYAMKV+KKE + D +DI+WVQTEKHVFE AS++PFLVGLHSCFQT SRL  VIE+VNGGDLM+HMQR+ ++PEEHA+FYAAEI +ALNFLH R IIYRDLKLDNVL+D DGH+KLTDYGMCKEG+      +TFCGTPNYIAPEILR E YG SVDWW+LGVLMFEM+AG SP+        P+ NTEDYLF +IL KPIRIPR +S KAS +LKG LNKDP +RL C+P + F D ++HAFFR ++WD L  K+  PPF+P++T D  L NFD  FT EPV  TPDD+  I +IDQSEFEGFEYINPLLL+TEE+V
Sbjct:   16 VRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIA----YISSSRKH--------DSIKDDSEDLK--------------------------------PVIDGMDGIKISQG-LGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDN--PDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV 592          
BLAST of Protein kinase C vs. Ensembl Human
Match: PRKCZ (protein kinase C zeta [Source:HGNC Symbol;Acc:HGNC:9412])

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 291/529 (55.01%), Postives = 357/529 (67.49%), Query Frame = 3
Query:  330 DLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGE--DFNLPNYQSQI--KSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            D  +YRRGA+RW+K Y   GH F AKRFN+ A C  C +RIWGL +QG RC  C+LL+HKRC  LV   C +  D  +P+ +  +  K+  A   + E  GI     Y+ S+  +          +KD   DL+                                P +D   G    +G +GL DF+L+ V+GRGSYAKV  V  K   +IYAMKV+KKE + D +DI+WVQTEKHVFE AS++PFLVGLHSCFQT SRL  VIE+VNGGDLM+HMQR+ ++PEEHA+FYAAEI +ALNFLH R IIYRDLKLDNVL+D DGH+KLTDYGMCKEG+      +TFCGTPNYIAPEILR E YG SVDWW+LGVLMFEM+AG SP+        P+ NTEDYLF +IL KPIRIPR +S KAS +LKG LNKDP +RL C+P + F D ++HAFFR ++WD L  K+  PPF+P++T D  L NFD  FT EPV  TPDD+  I +IDQSEFEGFEYINPLLL+TEE+V
Sbjct:    7 DESIYRRGARRWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIA----YISSSRKH--------DSIKDDSEDLK--------------------------------PVIDGMDGIKISQG-LGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDN--PDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV 488          
BLAST of Protein kinase C vs. Ensembl Human
Match: PRKCZ (protein kinase C zeta [Source:HGNC Symbol;Acc:HGNC:9412])

HSP 1 Score: 494.967 bits (1273), Expect = 4.163e-170
Identity = 238/363 (65.56%), Postives = 284/363 (78.24%), Query Frame = 3
Query:  816 PPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            P +D   G    +G +GL DF+L+ V+GRGSYAKV  V  K   +IYAMKV+KKE + D +DI+WVQTEKHVFE AS++PFLVGLHSCFQT SRL  VIE+VNGGDLM+HMQR+ ++PEEHA+FYAAEI +ALNFLH R IIYRDLKLDNVL+D DGH+KLTDYGMCKEG+      +TFCGTPNYIAPEILR E YG SVDWW+LGVLMFEM+AG SP+        P+ NTEDYLF +IL KPIRIPR +S KAS +LKG LNKDP +RL C+P + F D ++HAFFR ++WD L  K+  PPF+P++T D  L NFD  FT EPV  TPDD+  I +IDQSEFEGFEYINPLLL+TEE+V
Sbjct:   50 PVIDGMDGIKISQG-LGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDN--PDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV 409          
BLAST of Protein kinase C vs. Ensembl Human
Match: PRKCZ (protein kinase C zeta [Source:HGNC Symbol;Acc:HGNC:9412])

HSP 1 Score: 409.453 bits (1051), Expect = 9.738e-138
Identity = 195/295 (66.10%), Postives = 233/295 (78.98%), Query Frame = 3
Query:  816 PPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWD 1700
            P +D   G    +G +GL DF+L+ V+GRGSYAKV  V  K   +IYAMKV+KKE + D +DI+WVQTEKHVFE AS++PFLVGLHSCFQT SRL  VIE+VNGGDLM+HMQR+ ++PEEHA+FYAAEI +ALNFLH R IIYRDLKLDNVL+D DGH+KLTDYGMCKEG+      +TFCGTPNYIAPEILR E YG SVDWW+LGVLMFEM+AG SP+        P+ NTEDYLF +IL KPIRIPR +S KAS +LKG LNKDP +RL C+P + F D ++HAFFR ++WD
Sbjct:   46 PVIDGMDGIKISQG-LGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDN--PDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWD 337          
BLAST of Protein kinase C vs. Ensembl Celegans
Match: pkc-3 (Protein kinase C-like 3 [Source:UniProtKB/Swiss-Prot;Acc:Q19266])

HSP 1 Score: 461.455 bits (1186), Expect = 1.008e-154
Identity = 223/359 (62.12%), Postives = 275/359 (76.60%), Query Frame = 3
Query:  837 GTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSN--FDDFQNHAFFRG-LNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            G G  K  + L DF LL V+GRGSYAKV Q E+  T++IYA+K+IKKE   + +DI+WVQTEK VFE ASN+PFLVGLHSCFQT SRL +VIEFV GGDLM+HMQ++ ++PEEHA+FY+ EI LAL+FLH R IIYRDLKLDNVL+D +GH+KLTDYGMCKE I+     +TFCGTPNYIAPEILR + YG SVDWW+LGVLMFEM+AG SP+   G     EENTEDYLF +IL + IRIPRS+S +AS ILKG LNKDPT+RL CK   N    D + H FFRG ++W+ L  K + PP+ P +  DRDLT+FD  FTDE    +PD+   I++IDQSEF+GFEY+NPL ++ E++V
Sbjct:  240 GNGSSKWAVSLNDFRLLTVIGRGSYAKVVQAEHVSTRQIYAIKIIKKEMFNEDEDIDWVQTEKSVFEAASNYPFLVGLHSCFQTESRLFFVIEFVPGGDLMFHMQQQRKLPEEHARFYSGEIILALHFLHSRGIIYRDLKLDNVLIDAEGHIKLTDYGMCKENIKDGDLTSTFCGTPNYIAPEILRGDEYGFSVDWWALGVLMFEMMAGRSPFDIVGMQ-NSEENTEDYLFQIILERQIRIPRSLSVRASGILKGFLNKDPTERLGCKLDINEGLRDMKEHQFFRGFIDWEALEQKAVAPPYHPAVESDRDLTHFDHQFTDELPQLSPDNPDVIARIDQSEFDGFEYVNPLQMSREDSV 597          

HSP 2 Score: 179.104 bits (453), Expect = 4.943e-48
Identity = 79/179 (44.13%), Postives = 110/179 (61.45%), Query Frame = 3
Query:   27 MHESALIKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPN 563
            + E   IKLK  +  +  +      +  D     +   C      + T+KWID++GDP +I +QMELDEA+R   ++++AE+ +HVF   P  PG+PCQGED  VYRRGA+RWKK Y   GH+F AKR N+  +CF C D IWG+G+QG RC  CRL +HK+C + V+  CG+    PN
Sbjct:    7 LEEDGDIKLKTRFQGQVVVLYARPPLILDDFFALLKDACKQHKKQDITVKWIDEDGDPISIDSQMELDEAVRCLNSSQEAELNIHVFVGKPELPGLPCQGEDKTVYRRGARRWKKIYLYNGHRFQAKRLNRRIQCFICHDYIWGIGRQGFRCVDCRLCVHKKCHRHVRTHCGQALQGPN 185          
BLAST of Protein kinase C vs. Ensembl Celegans
Match: pkc-1 (Protein kinase C-like 1B [Source:UniProtKB/Swiss-Prot;Acc:P34885])

HSP 1 Score: 355.91 bits (912), Expect = 1.434e-113
Identity = 199/503 (39.56%), Postives = 280/503 (55.67%), Query Frame = 3
Query:  390 HKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRK------GKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDD-FQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINP 1877
            H+FS   + +   C +C   ++GL  QGL+C TC+L                     N   + + N+A      N GI       E           +LG   D K  +R+   +   ++  +T++  + S+ S     L     D  G T  R       G + + DF  + V+G+GS+ KV   E K T ++YA+K++KK+ I   DD+E    EK +   A+ HPFL  LHS FQT  RL +V+E+VNGGDLM+ +QR  +  E  A+FYAAE+  AL FLHR  +IYRDLKLDN+L+D +GH +L D+GMCKEGI  D   +TFCGTP+YIAPEIL+   YG SVDWW+LGVLM+EM+AG     QP    P E + ED LF  IL   +  P  +S +A +ILK  + K+  +RL C  S   +D  + H FFR ++WD L  ++++PPF+P++   RD  NFD  FT E  + TP D + +  I+Q EF GF +INP
Sbjct:  162 HRFSVHSYKRPTFCDHCGSMLYGLINQGLQCSTCKL---------------------NVHKRCQRNVA-----NNCGINAKQMAAE---------LAQLGLTGD-KMSIRS---KKKPSIMTDTSTDISGSSNSENSGYLQQISEDDSGTTSSRSASKVPGGTLSIHDFTFMKVLGKGSFGKVMLAERKGTDEVYAIKILKKDVIVQDDDVECTMCEKRILSLAAKHPFLTALHSSFQTSDRLFFVMEYVNGGDLMFQIQRARKFDESRARFYAAEVTCALQFLHRNDVIYRDLKLDNILLDAEGHCRLADFGMCKEGINKDNLTSTFCGTPDYIAPEILQEMEYGVSVDWWALGVLMYEMMAG-----QP----PFEADNEDDLFEAILNDDVLYPVWLSKEAVNILKAFMTKNAGKRLGCVVSQGGEDAIRAHPFFREIDWDALESRQVKPPFKPKIKSKRDANNFDSDFTKEEPVLTPSDPAVVRAINQDEFRGFSFINP 616          

HSP 2 Score: 64.3142 bits (155), Expect = 2.100e-10
Identity = 29/65 (44.62%), Postives = 42/65 (64.62%), Query Frame = 3
Query:  345 RRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKC 539
            RRGA R +K + + GHKF A    +   C +CK+ IWG+G+QG +C  C +++HKRC + V  KC
Sbjct:   70 RRGAMR-RKIHEVTGHKFMALFLRQPTFCAHCKEFIWGIGKQGYQCQICTVVVHKRCHEDVVWKC 133          
BLAST of Protein kinase C vs. Ensembl Celegans
Match: pkc-1 (Protein kinase C-like 1B [Source:UniProtKB/Swiss-Prot;Acc:P34885])

HSP 1 Score: 351.673 bits (901), Expect = 5.167e-111
Identity = 198/503 (39.36%), Postives = 278/503 (55.27%), Query Frame = 3
Query:  390 HKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRK------GKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDD-FQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINP 1877
            H+FS   + +   C +C   ++GL  QGL+C T        C+  V  +C  +                   A N GI       E           +LG   D K  +R+   +   ++  +T++  + S+ S     L     D  G T  R       G + + DF  + V+G+GS+ KV   E K T ++YA+K++KK+ I   DD+E    EK +   A+ HPFL  LHS FQT  RL +V+E+VNGGDLM+ +QR  +  E  A+FYAAE+  AL FLHR  +IYRDLKLDN+L+D +GH +L D+GMCKEGI  D   +TFCGTP+YIAPEIL+   YG SVDWW+LGVLM+EM+AG     QP    P E + ED LF  IL   +  P  +S +A +ILK  + K+  +RL C  S   +D  + H FFR ++WD L  ++++PPF+P++   RD  NFD  FT E  + TP D + +  I+Q EF GF +INP
Sbjct:  249 HRFSVHSYKRPTFCDHCGSMLYGLINQGLQCST--------CKLNVHKRCQRN------------------VANNCGINAKQMAAE---------LAQLGLTGD-KMSIRS---KKKPSIMTDTSTDISGSSNSENSGYLQQISEDDSGTTSSRSASKVPGGTLSIHDFTFMKVLGKGSFGKVMLAERKGTDEVYAIKILKKDVIVQDDDVECTMCEKRILSLAAKHPFLTALHSSFQTSDRLFFVMEYVNGGDLMFQIQRARKFDESRARFYAAEVTCALQFLHRNDVIYRDLKLDNILLDAEGHCRLADFGMCKEGINKDNLTSTFCGTPDYIAPEILQEMEYGVSVDWWALGVLMYEMMAG-----QP----PFEADNEDDLFEAILNDDVLYPVWLSKEAVNILKAFMTKNAGKRLGCVVSQGGEDAIRAHPFFREIDWDALESRQVKPPFKPKIKSKRDANNFDSDFTKEEPVLTPSDPAVVRAINQDEFRGFSFINP 703          

HSP 2 Score: 65.0846 bits (157), Expect = 1.420e-10
Identity = 29/65 (44.62%), Postives = 42/65 (64.62%), Query Frame = 3
Query:  345 RRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKC 539
            RRGA R +K + + GHKF A    +   C +CK+ IWG+G+QG +C  C +++HKRC + V  KC
Sbjct:  157 RRGAMR-RKIHEVTGHKFMALFLRQPTFCAHCKEFIWGIGKQGYQCQICTVVVHKRCHEDVVWKC 220          
BLAST of Protein kinase C vs. Ensembl Celegans
Match: pkc-1 (Protein kinase C-like 1B [Source:UniProtKB/Swiss-Prot;Acc:P34885])

HSP 1 Score: 352.058 bits (902), Expect = 1.927e-110
Identity = 198/503 (39.36%), Postives = 278/503 (55.27%), Query Frame = 3
Query:  390 HKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRK------GKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDD-FQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINP 1877
            H+FS   + +   C +C   ++GL  QGL+C T        C+  V  +C  +                   A N GI       E           +LG   D K  +R+   +   ++  +T++  + S+ S     L     D  G T  R       G + + DF  + V+G+GS+ KV   E K T ++YA+K++KK+ I   DD+E    EK +   A+ HPFL  LHS FQT  RL +V+E+VNGGDLM+ +QR  +  E  A+FYAAE+  AL FLHR  +IYRDLKLDN+L+D +GH +L D+GMCKEGI  D   +TFCGTP+YIAPEIL+   YG SVDWW+LGVLM+EM+AG     QP    P E + ED LF  IL   +  P  +S +A +ILK  + K+  +RL C  S   +D  + H FFR ++WD L  ++++PPF+P++   RD  NFD  FT E  + TP D + +  I+Q EF GF +INP
Sbjct:  305 HRFSVHSYKRPTFCDHCGSMLYGLINQGLQCST--------CKLNVHKRCQRN------------------VANNCGINAKQMAAE---------LAQLGLTGD-KMSIRS---KKKPSIMTDTSTDISGSSNSENSGYLQQISEDDSGTTSSRSASKVPGGTLSIHDFTFMKVLGKGSFGKVMLAERKGTDEVYAIKILKKDVIVQDDDVECTMCEKRILSLAAKHPFLTALHSSFQTSDRLFFVMEYVNGGDLMFQIQRARKFDESRARFYAAEVTCALQFLHRNDVIYRDLKLDNILLDAEGHCRLADFGMCKEGINKDNLTSTFCGTPDYIAPEILQEMEYGVSVDWWALGVLMYEMMAG-----QP----PFEADNEDDLFEAILNDDVLYPVWLSKEAVNILKAFMTKNAGKRLGCVVSQGGEDAIRAHPFFREIDWDALESRQVKPPFKPKIKSKRDANNFDSDFTKEEPVLTPSDPAVVRAINQDEFRGFSFINP 759          

HSP 2 Score: 64.6994 bits (156), Expect = 1.640e-10
Identity = 29/65 (44.62%), Postives = 42/65 (64.62%), Query Frame = 3
Query:  345 RRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKC 539
            RRGA R +K + + GHKF A    +   C +CK+ IWG+G+QG +C  C +++HKRC + V  KC
Sbjct:  213 RRGAMR-RKIHEVTGHKFMALFLRQPTFCAHCKEFIWGIGKQGYQCQICTVVVHKRCHEDVVWKC 276          
BLAST of Protein kinase C vs. Ensembl Celegans
Match: pkc-2 (Protein kinase C-like 2 [Source:UniProtKB/Swiss-Prot;Acc:P90980])

HSP 1 Score: 339.347 bits (869), Expect = 1.567e-106
Identity = 172/341 (50.44%), Postives = 224/341 (65.69%), Query Frame = 3
Query:  861 IGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACK--PSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINP 1877
            I   DFN L V+G+GS+ KV   E K TK+++A+KV+KK+ I   DD+E   TEK V        FLV LHSCFQT  RL +V+EFVNGGDLMY +Q+  +  E  A FYAAEIA+ L FLH + IIYRDLKLDNV+++ DGH+K+TD+GMCKE I GD    TFCGTP+YIAPEI+  + YG SVDWW+ GVL+FEMLAG     QP    P +   ED LF  I    +  P+S+S +A S+ K LL K+P++RL C     S   D + H FFR ++W  +  ++IQPPF+P+L    D +NFD  FT E    TP D+  +  +DQ+EFEGF ++NP
Sbjct:  343 IKASDFNFLTVLGKGSFGKVLLGEQKTTKELFAIKVLKKDVIIQDDDVECTMTEKRVLALPEKPSFLVALHSCFQTMDRLYFVMEFVNGGDLMYQIQQVGKFKEPVAVFYAAEIAVGLFFLHSKGIIYRDLKLDNVMLERDGHIKITDFGMCKENIFGDATTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLFEMLAG-----QP----PFDGEDEDELFTAITEHNVSYPKSLSKEAVSLCKALLIKNPSKRLGCTGDDESASRDIKEHPFFRRIDWFKIETRQIQPPFKPKLKSADDTSNFDSEFTHEVPKLTPIDRLFLMNLDQTEFEGFSFVNP 674          

HSP 2 Score: 70.0922 bits (170), Expect = 3.270e-12
Identity = 33/84 (39.29%), Postives = 47/84 (55.95%), Query Frame = 3
Query:  345 RRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKC-----GEDFNLPNYQSQIK 581
            RRGA R K  + +  HKF A+ F +   C +CKD +WG+ +QG +C  C L++HKRC + V   C     G D + P  Q + K
Sbjct:   24 RRGALRQKNVHEIKSHKFIARFFKQPTFCSHCKDFLWGITKQGFQCQVCTLVVHKRCHEFVNFACPGADKGVDTDDPRQQHKWK 107          
BLAST of Protein kinase C vs. Ensembl Fly
Match: aPKC (gene:FBgn0261854 transcript:FBtr0303432)

HSP 1 Score: 494.967 bits (1273), Expect = 8.005e-169
Identity = 232/349 (66.48%), Postives = 276/349 (79.08%), Query Frame = 3
Query:  858 KIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            +  L DF L+ V+GRGSYAKV  VE + T++IYAMKVIKK  +TD +DI+WVQTEKHVFE ASNHPFLVGLHSCFQTPSRL +VIEFV GGDLMYHMQR+ R+PEEHA+FYAAEI+LALNFLH + IIYRDLKLDNVL+D++GH+KLTDYGMCKEGI      +TFCGTPNYIAPEILR E YG SVDWW+LGVL++EMLAG SP+   G    P++NTEDYLF +IL K IRIPRS+S +A+S+LKG LNK+P  RL C   S F D  +H FF+ ++W+ L  K++ PPF+P L  DRDL NF P FT E V  TPDD   I  IDQSEFEGFEY+NPLL++ E+ V
Sbjct:  176 QYSLNDFELIRVIGRGSYAKVLMVELRRTRRIYAMKVIKKALVTDDEDIDWVQTEKHVFETASNHPFLVGLHSCFQTPSRLFFVIEFVRGGDLMYHMQRQRRLPEEHARFYAAEISLALNFLHEKGIIYRDLKLDNVLLDHEGHIKLTDYGMCKEGIRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLLYEMLAGRSPFDLAGASENPDQNTEDYLFQVILEKTIRIPRSLSVRAASVLKGFLNKNPADRLGCHRESAFMDIVSHPFFKNMDWELLERKQVTPPFKPRLDSDRDLANFPPEFTGEAVQLTPDDDHVIDNIDQSEFEGFEYVNPLLMSLEDCV 524          

HSP 2 Score: 128.257 bits (321), Expect = 7.313e-31
Identity = 55/106 (51.89%), Postives = 76/106 (71.70%), Query Frame = 3
Query:  231 EAIRLYETNKDAEIM---MHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKC 539
            EA ++Y T + A  M     +FP++P +PG+ C GED  +YRRGA+RW+K Y + GH F AKRFN+ A C YC+DRIWGLG+QG +C  C+LL+HK+C +LV+  C
Sbjct:    9 EAAQIYST-QTATFMSGGASLFPNVPQAPGLSCDGEDRSIYRRGARRWRKLYRVNGHIFQAKRFNRRAFCAYCQDRIWGLGRQGFKCIQCKLLVHKKCHKLVQKHC 113          
BLAST of Protein kinase C vs. Ensembl Fly
Match: aPKC (gene:FBgn0261854 transcript:FBtr0303433)

HSP 1 Score: 493.812 bits (1270), Expect = 1.297e-168
Identity = 232/347 (66.86%), Postives = 275/347 (79.25%), Query Frame = 3
Query:  864 GLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
             L DF L+ V+GRGSYAKV  VE + T++IYAMKVIKK  +TD +DI+WVQTEKHVFE ASNHPFLVGLHSCFQTPSRL +VIEFV GGDLMYHMQR+ R+PEEHA+FYAAEI+LALNFLH + IIYRDLKLDNVL+D++GH+KLTDYGMCKEGI      +TFCGTPNYIAPEILR E YG SVDWW+LGVL++EMLAG SP+   G    P++NTEDYLF +IL K IRIPRS+S +A+S+LKG LNK+P  RL C   S F D  +H FF+ ++W+ L  K++ PPF+P L  DRDL NF P FT E V  TPDD   I  IDQSEFEGFEY+NPLL++ E+ V
Sbjct:  157 SLNDFELIRVIGRGSYAKVLMVELRRTRRIYAMKVIKKALVTDDEDIDWVQTEKHVFETASNHPFLVGLHSCFQTPSRLFFVIEFVRGGDLMYHMQRQRRLPEEHARFYAAEISLALNFLHEKGIIYRDLKLDNVLLDHEGHIKLTDYGMCKEGIRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLLYEMLAGRSPFDLAGASENPDQNTEDYLFQVILEKTIRIPRSLSVRAASVLKGFLNKNPADRLGCHRESAFMDIVSHPFFKNMDWELLERKQVTPPFKPRLDSDRDLANFPPEFTGEAVQLTPDDDHVIDNIDQSEFEGFEYVNPLLMSLEDCV 503          

HSP 2 Score: 126.331 bits (316), Expect = 2.566e-30
Identity = 49/86 (56.98%), Postives = 67/86 (77.91%), Query Frame = 3
Query:  282 VFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKC 539
            +FP++P +PG+ C GED  +YRRGA+RW+K Y + GH F AKRFN+ A C YC+DRIWGLG+QG +C  C+LL+HK+C +LV+  C
Sbjct:    7 LFPNVPQAPGLSCDGEDRSIYRRGARRWRKLYRVNGHIFQAKRFNRRAFCAYCQDRIWGLGRQGFKCIQCKLLVHKKCHKLVQKHC 92          
BLAST of Protein kinase C vs. Ensembl Fly
Match: aPKC (gene:FBgn0261854 transcript:FBtr0329888)

HSP 1 Score: 494.197 bits (1271), Expect = 1.627e-168
Identity = 232/347 (66.86%), Postives = 275/347 (79.25%), Query Frame = 3
Query:  864 GLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
             L DF L+ V+GRGSYAKV  VE + T++IYAMKVIKK  +TD +DI+WVQTEKHVFE ASNHPFLVGLHSCFQTPSRL +VIEFV GGDLMYHMQR+ R+PEEHA+FYAAEI+LALNFLH + IIYRDLKLDNVL+D++GH+KLTDYGMCKEGI      +TFCGTPNYIAPEILR E YG SVDWW+LGVL++EMLAG SP+   G    P++NTEDYLF +IL K IRIPRS+S +A+S+LKG LNK+P  RL C   S F D  +H FF+ ++W+ L  K++ PPF+P L  DRDL NF P FT E V  TPDD   I  IDQSEFEGFEY+NPLL++ E+ V
Sbjct:  173 SLNDFELIRVIGRGSYAKVLMVELRRTRRIYAMKVIKKALVTDDEDIDWVQTEKHVFETASNHPFLVGLHSCFQTPSRLFFVIEFVRGGDLMYHMQRQRRLPEEHARFYAAEISLALNFLHEKGIIYRDLKLDNVLLDHEGHIKLTDYGMCKEGIRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLLYEMLAGRSPFDLAGASENPDQNTEDYLFQVILEKTIRIPRSLSVRAASVLKGFLNKNPADRLGCHRESAFMDIVSHPFFKNMDWELLERKQVTPPFKPRLDSDRDLANFPPEFTGEAVQLTPDDDHVIDNIDQSEFEGFEYVNPLLMSLEDCV 519          

HSP 2 Score: 127.102 bits (318), Expect = 1.299e-30
Identity = 49/86 (56.98%), Postives = 67/86 (77.91%), Query Frame = 3
Query:  282 VFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKC 539
            +FP++P +PG+ C GED  +YRRGA+RW+K Y + GH F AKRFN+ A C YC+DRIWGLG+QG +C  C+LL+HK+C +LV+  C
Sbjct:   23 IFPNVPQAPGLSCDGEDRSIYRRGARRWRKLYRVNGHIFQAKRFNRRAFCAYCQDRIWGLGRQGFKCIQCKLLVHKKCHKLVQKHC 108          
BLAST of Protein kinase C vs. Ensembl Fly
Match: aPKC (gene:FBgn0261854 transcript:FBtr0329890)

HSP 1 Score: 495.352 bits (1274), Expect = 1.379e-167
Identity = 232/349 (66.48%), Postives = 276/349 (79.08%), Query Frame = 3
Query:  858 KIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            +  L DF L+ V+GRGSYAKV  VE + T++IYAMKVIKK  +TD +DI+WVQTEKHVFE ASNHPFLVGLHSCFQTPSRL +VIEFV GGDLMYHMQR+ R+PEEHA+FYAAEI+LALNFLH + IIYRDLKLDNVL+D++GH+KLTDYGMCKEGI      +TFCGTPNYIAPEILR E YG SVDWW+LGVL++EMLAG SP+   G    P++NTEDYLF +IL K IRIPRS+S +A+S+LKG LNK+P  RL C   S F D  +H FF+ ++W+ L  K++ PPF+P L  DRDL NF P FT E V  TPDD   I  IDQSEFEGFEY+NPLL++ E+ V
Sbjct:  155 QYSLNDFELIRVIGRGSYAKVLMVELRRTRRIYAMKVIKKALVTDDEDIDWVQTEKHVFETASNHPFLVGLHSCFQTPSRLFFVIEFVRGGDLMYHMQRQRRLPEEHARFYAAEISLALNFLHEKGIIYRDLKLDNVLLDHEGHIKLTDYGMCKEGIRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLLYEMLAGRSPFDLAGASENPDQNTEDYLFQVILEKTIRIPRSLSVRAASVLKGFLNKNPADRLGCHRESAFMDIVSHPFFKNMDWELLERKQVTPPFKPRLDSDRDLANFPPEFTGEAVQLTPDDDHVIDNIDQSEFEGFEYVNPLLMSLEDCV 503          

HSP 2 Score: 127.102 bits (318), Expect = 3.147e-30
Identity = 49/86 (56.98%), Postives = 67/86 (77.91%), Query Frame = 3
Query:  282 VFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKC 539
            +FP++P +PG+ C GED  +YRRGA+RW+K Y + GH F AKRFN+ A C YC+DRIWGLG+QG +C  C+LL+HK+C +LV+  C
Sbjct:    7 LFPNVPQAPGLSCDGEDRSIYRRGARRWRKLYRVNGHIFQAKRFNRRAFCAYCQDRIWGLGRQGFKCIQCKLLVHKKCHKLVQKHC 92          
BLAST of Protein kinase C vs. Ensembl Fly
Match: aPKC (gene:FBgn0261854 transcript:FBtr0303434)

HSP 1 Score: 494.582 bits (1272), Expect = 1.933e-167
Identity = 232/347 (66.86%), Postives = 275/347 (79.25%), Query Frame = 3
Query:  864 GLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
             L DF L+ V+GRGSYAKV  VE + T++IYAMKVIKK  +TD +DI+WVQTEKHVFE ASNHPFLVGLHSCFQTPSRL +VIEFV GGDLMYHMQR+ R+PEEHA+FYAAEI+LALNFLH + IIYRDLKLDNVL+D++GH+KLTDYGMCKEGI      +TFCGTPNYIAPEILR E YG SVDWW+LGVL++EMLAG SP+   G    P++NTEDYLF +IL K IRIPRS+S +A+S+LKG LNK+P  RL C   S F D  +H FF+ ++W+ L  K++ PPF+P L  DRDL NF P FT E V  TPDD   I  IDQSEFEGFEY+NPLL++ E+ V
Sbjct:  260 SLNDFELIRVIGRGSYAKVLMVELRRTRRIYAMKVIKKALVTDDEDIDWVQTEKHVFETASNHPFLVGLHSCFQTPSRLFFVIEFVRGGDLMYHMQRQRRLPEEHARFYAAEISLALNFLHEKGIIYRDLKLDNVLLDHEGHIKLTDYGMCKEGIRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLLYEMLAGRSPFDLAGASENPDQNTEDYLFQVILEKTIRIPRSLSVRAASVLKGFLNKNPADRLGCHRESAFMDIVSHPFFKNMDWELLERKQVTPPFKPRLDSDRDLANFPPEFTGEAVQLTPDDDHVIDNIDQSEFEGFEYVNPLLMSLEDCV 606          

HSP 2 Score: 206.453 bits (524), Expect = 1.294e-57
Identity = 91/165 (55.15%), Postives = 125/165 (75.76%), Query Frame = 3
Query:   45 IKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKC 539
            I +K  Y  +  IT IN +++Y++L YEI  IC  P    FT+KW+D+E DPCTI+T+MELDEAIRLYE N D+++++HVFP++P +PG+ C GED  +YRRGA+RW+K Y + GH F AKRFN+ A C YC+DRIWGLG+QG +C  C+LL+HK+C +LV+  C
Sbjct:   31 ITVKTAYNGQIIITTINKNISYEELCYEIRNICRFPLDQPFTIKWVDEENDPCTISTKMELDEAIRLYEMNFDSQLVIHVFPNVPQAPGLSCDGEDRSIYRRGARRWRKLYRVNGHIFQAKRFNRRAFCAYCQDRIWGLGRQGFKCIQCKLLVHKKCHKLVQKHC 195          
BLAST of Protein kinase C vs. Ensembl Zebrafish
Match: prkci (protein kinase C, iota [Source:NCBI gene;Acc:117507])

HSP 1 Score: 680.248 bits (1754), Expect = 0.000e+0
Identity = 328/620 (52.90%), Postives = 426/620 (68.71%), Query Frame = 3
Query:   45 IKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            +++K  Y  +  IT    S++Y+ L  E+  +C + +   FTMKWID+EGDPCT+++Q+EL+EA+RLYE NKD+E+++HVFP +P  PGMPC GED  +YRRGA+RW+K Y+  GH F AKRFN+ A C  C DRIWGLG+QG +C  C+LL+HK+C +LV  +CG          Q+  +  I R        +PG    ++ ++P     +    + I H+    +   AV  R                             +G     +GL DF+LL V+GRGSYAKV  V  K T++IYAMKV+KKE + D +DI+WVQTEKHVFE ASNHPFLVGLHSCFQT SRL +VIE+VNGGDLM+HMQR+ ++PEEHA+FY+AEI+LALN+LH R IIYRDLKLDNVL+D++GH+KLTDYGMCKEG+      +TFCGTPNYIAPEILR E YG SVDWW+LGVLMFEM+AG SP+   G    P++NTEDYLF +IL K IRIPRS+S KA+S+LKG LNK+  +RL C P + F D   H FFR ++WD +  K++ PPF+P ++ +  L NFD  FT+EP+  TPDD   + KIDQSEFEGFEYINPLL++ EE V
Sbjct:   19 VRVKAYYRGDIMITHFEPSISYEGLCNEVRDMCSMDNDQLFTMKWIDEEGDPCTVSSQLELEEALRLYELNKDSELIIHVFPCVPEKPGMPCPGEDKSIYRRGARRWRKLYYATGHAFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTVECGR---------QVIQDPMIGRI-------DPG---STHPEHPDQVLGKKNSTESINHE---GEEHEAVGSRE----------------------------SGKAVSSLGLIDFDLLRVIGRGSYAKVLLVRLKKTERIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSLSVKAASVLKGFLNKESKERLGCHPQTGFADIMAHPFFRNVDWDLMEQKQVVPPFKPNISGEFGLDNFDAQFTNEPIQLTPDDDDAVKKIDQSEFEGFEYINPLLMSAEECV 588          
BLAST of Protein kinase C vs. Ensembl Zebrafish
Match: prkcz (protein kinase C, zeta [Source:ZFIN;Acc:ZDB-GENE-070511-1])

HSP 1 Score: 667.152 bits (1720), Expect = 0.000e+0
Identity = 329/626 (52.56%), Postives = 431/626 (68.85%), Query Frame = 3
Query:   36 SALIKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFN--LPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGK-IGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            S  +K+K  Y  +  I+ ++ ++TY ++  E+ ++C +   +  T+KWIDDEGDPCTI++QMEL+EA R+Y  N+ + +++HVFPS+P  PGMPC GED  +YRRGA+RW+K Y + GH F AKRFN+ A C +C +RIWGLG+QG +C  C+LL+HKRC +LV   C    +  +P+ +  +  + + +       +E P    E     PV       +V+  + D  + D +  V                             +G  G +  + +GLGDF+L+ V+GRGSYAKV  V  K  ++IYAMKV+KKE + D +DI+WVQTEKHVFE AS +PFLVGLHSCFQT SRL  VIE+VNGGDLM+HMQR+ ++PEEHA+FYAAEI +ALNFLH + IIYRDLKLDNVL+D DGH+KLTDYGMCKEGI      +TFCGTPNYIAPEILR E YG SVDWW+LGVLMFEM+AG SP+        P+ NTE+YLF +IL KPIRIPRS+S KA+S+LKG LNKDP +RL C+  + F D ++H FFR ++WD L  K++ PPF+P++T D  L NFD  FT+EPV  TPDD+  I +IDQSEFEGFEYINPLLL+TEE V
Sbjct:   13 SEYVKIKAHYGGDMLISDLDLALTYTEVCKEVREMCGVRKETPITLKWIDDEGDPCTISSQMELEEAFRIYSRNRHSGLLLHVFPSIPEKPGMPCPGEDKSIYRRGARRWRKLYRVNGHLFQAKRFNRKAYCGHCSERIWGLGRQGYKCINCKLLVHKRCHKLVPLTCQRHMDPVMPSQEPLVDDDKSGEE------VELPPEDPEDTDAIPVPFLAHNRKVEKAEDD--SEDLKAVV-----------------------------DGIEGIQISQCLGLGDFDLIRVIGRGSYAKVLLVRLKKNEQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASTNPFLVGLHSCFQTESRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHEKGIIYRDLKLDNVLLDQDGHIKLTDYGMCKEGIRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIITDN--PDMNTEEYLFQVILEKPIRIPRSLSVKAASVLKGFLNKDPKERLGCQVQTGFTDIKSHTFFRSIDWDQLEQKQVTPPFKPQITDDYGLENFDTQFTNEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLSTEETV 599          
BLAST of Protein kinase C vs. Ensembl Zebrafish
Match: prkcz (protein kinase C, zeta [Source:ZFIN;Acc:ZDB-GENE-070511-1])

HSP 1 Score: 667.152 bits (1720), Expect = 0.000e+0
Identity = 329/626 (52.56%), Postives = 431/626 (68.85%), Query Frame = 3
Query:   36 SALIKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFN--LPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGK-IGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            S  +K+K  Y  +  I+ ++ ++TY ++  E+ ++C +   +  T+KWIDDEGDPCTI++QMEL+EA R+Y  N+ + +++HVFPS+P  PGMPC GED  +YRRGA+RW+K Y + GH F AKRFN+ A C +C +RIWGLG+QG +C  C+LL+HKRC +LV   C    +  +P+ +  +  + + +       +E P    E     PV       +V+  + D  + D +  V                             +G  G +  + +GLGDF+L+ V+GRGSYAKV  V  K  ++IYAMKV+KKE + D +DI+WVQTEKHVFE AS +PFLVGLHSCFQT SRL  VIE+VNGGDLM+HMQR+ ++PEEHA+FYAAEI +ALNFLH + IIYRDLKLDNVL+D DGH+KLTDYGMCKEGI      +TFCGTPNYIAPEILR E YG SVDWW+LGVLMFEM+AG SP+        P+ NTE+YLF +IL KPIRIPRS+S KA+S+LKG LNKDP +RL C+  + F D ++H FFR ++WD L  K++ PPF+P++T D  L NFD  FT+EPV  TPDD+  I +IDQSEFEGFEYINPLLL+TEE V
Sbjct:   13 SEYVKIKAHYGGDMLISDLDLALTYTEVCKEVREMCGVRKETPITLKWIDDEGDPCTISSQMELEEAFRIYSRNRHSGLLLHVFPSIPEKPGMPCPGEDKSIYRRGARRWRKLYRVNGHLFQAKRFNRKAYCGHCSERIWGLGRQGYKCINCKLLVHKRCHKLVPLTCQRHMDPVMPSQEPLVDDDKSGEE------VELPPEDPEDTDAIPVPFLAHNRKVEKAEDD--SEDLKAVV-----------------------------DGIEGIQISQCLGLGDFDLIRVIGRGSYAKVLLVRLKKNEQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASTNPFLVGLHSCFQTESRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHEKGIIYRDLKLDNVLLDQDGHIKLTDYGMCKEGIRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIITDN--PDMNTEEYLFQVILEKPIRIPRSLSVKAASVLKGFLNKDPKERLGCQVQTGFTDIKSHTFFRSIDWDQLEQKQVTPPFKPQITDDYGLENFDTQFTNEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLSTEETV 599          
BLAST of Protein kinase C vs. Ensembl Zebrafish
Match: prkcea (protein kinase C, epsilon a [Source:ZFIN;Acc:ZDB-GENE-030131-8191])

HSP 1 Score: 356.681 bits (914), Expect = 3.130e-112
Identity = 198/525 (37.71%), Postives = 287/525 (54.67%), Query Frame = 3
Query:  390 HKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDF------------------NLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLR-ASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEG-GTGDRKG----KIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDD-FQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLT 1889
            H FS   +     C +C   +WGL +QGL+C  C++ +H+RC+  V   CG D                   N    + ++      Q++             +S    P D   EL +++ I+  L    +H+ + +   +                      + EG   GD K     ++ L DF+ + V+G+GS+ KV   E K T ++YA+KV+KK+ I   DD++   TEK +   A  HP+L  L  CFQT  RL +V+E+VNGGDLM+ +QR  +  E  ++FYAAE+  AL FLH+  +IYRDLKLDN+L+D +GH KL D+GMCKEGI   +  TTFCGTP+YIAPEIL+   YG SVDWW+LGVLM+EM+AG     QP    P E + ED LF  IL   +  P  +S +A SILK  + K+P++RL C  +   ++  + H FFR ++W  L  ++I+PPF+P +   RD+ NFD  FT E  + TP D + I +I+Q EF+GF Y     L+
Sbjct:  247 HMFSIHNYKVPTFCDHCGSLLWGLMRQGLQCKACKMNVHRRCESNVAPSCGVDARKIAKVLSDLGVTPDKISNSTQRRKKLTPGQDPQQSTTEAPSSEESDRCKSAPTSPCDQ-AELAELESIRKALSFGQEHKSSSSSSCSGVQS-----------------TEIEGRENGDLKTVQTKRMSLTDFSFIKVLGKGSFGKVMLAELKGTDEVYAVKVLKKDVILQDDDVDCTLTEKRILALARKHPYLTQLFCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEARSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAG-----QP----PFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPSKRLGCVVTQGLEEAIKVHPFFREIDWVQLEQRRIKPPFKPRIKTKRDVNNFDQDFTREDPVLTPVDDAIIKQINQEEFKGFSYFGEEALS 744          

HSP 2 Score: 62.3882 bits (150), Expect = 1.348e-9
Identity = 28/67 (41.79%), Postives = 42/67 (62.69%), Query Frame = 3
Query:  345 RRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWG-LGQQGLRCGTCRLLLHKRCQQLVKHKCG 542
            R+GA R ++ + + GHKF A    +   C +C+D IWG LG+QG +C  C  ++HKRC +L+  KC 
Sbjct:  159 RQGAVR-RRVHQVNGHKFMATYLRQPTYCSHCRDFIWGVLGKQGYQCQVCTCVVHKRCHELIITKCA 224          
BLAST of Protein kinase C vs. Ensembl Zebrafish
Match: prkceb (protein kinase C, epsilon b [Source:ZFIN;Acc:ZDB-GENE-081028-47])

HSP 1 Score: 355.525 bits (911), Expect = 6.478e-112
Identity = 198/525 (37.71%), Postives = 289/525 (55.05%), Query Frame = 3
Query:  390 HKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQ--------------VKDIKHDLRAS--DHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGKIG--------LGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDD-FQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLT 1889
            HKF    +     C +C   +WGL +QGL+C  C++ +HKRC+  V   CG D       +++ S++ +     +G ++      +    +P+     L +              +KD+++  +A   DHR                         +S  V  E G     G++         L DF+ + V+G+GS+ KV   E + T +++A+KV+KK+ I   DD++   TEK +   A  HP+L  L+ CFQT  RL +V+E+VNGGDLM+ +QR  +  E  ++FYAAE+  AL FLH   +IYRDLKLDN+L+D +GH KL D+GMCKEGI   I  TTFCGTP+YIAPEIL+   YG SVDWW+LGVLM+EM+AG     QP    P E + ED LF  IL   +  P  +S +A SILK  + K P++RL C  S   +D  + H FF+ ++W  L  +K++PPF+P +   RD+ NFD  FT E  + TP + + I +I+Q EF+GF Y     L+
Sbjct:  245 HKFRIHNYKVLTFCDHCGSLLWGLLRQGLQCKVCKMNVHKRCEINVAPNCGVD---ARGIAKVLSDLGVTPDKLSGSVQRRKKISQGPDPHPLPISPLLEEDRCKSAPTSPCDQDIKDLENIRKALSFDHR-------------------SEEMKQASEGVSEETGEARENGEVKTVQAKRMMLEDFSFIKVLGKGSFGKVMLAELRGTDEVFAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEARSRFYAAEVTSALMFLHHNGVIYRDLKLDNILLDAEGHCKLADFGMCKEGILDGITTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAG-----QP----PFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKSPSKRLGCVVSQGLEDAIKVHPFFKDIDWVLLEQRKVKPPFKPRIKTKRDVNNFDQDFTREEPVLTPVEDAIIKQINQEEFKGFSYFGEETLS 738          

HSP 2 Score: 65.4698 bits (158), Expect = 1.738e-10
Identity = 53/171 (30.99%), Postives = 84/171 (49.12%), Query Frame = 3
Query:   75 ATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWI--DDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFP----SLPTSPGMPCQGEDLKVYR--------RGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWG-LGQQGLRCGTCRLLLHKRCQQLVKHKCG 542
            +T  + N+   +D+L  E+H    + ++S F    I  DD    CTI  +  L    + +E   D E    VF     S  +S    C+ E+ +V+R        +GA R ++ + + GHKF A    +   C +C+D IWG LG+QG +C  C  ++HKRC +L+  KC 
Sbjct:   55 STKQKTNSPAWHDELVTEVHDGRKI-ELSVFHDAPIGYDDFVANCTIQFEELLHNGSKHFEDWIDLEPEGKVFVIIDLSGSSSEAGGCENEE-RVFRERMRPRKRQGAVR-RRVHQVNGHKFMATYLRQPTYCSHCRDFIWGVLGKQGYQCQVCTCVVHKRCHELIITKCA 222          
BLAST of Protein kinase C vs. Ensembl Xenopus
Match: prkcz (protein kinase C zeta [Source:NCBI gene;Acc:100101769])

HSP 1 Score: 667.537 bits (1721), Expect = 0.000e+0
Identity = 334/629 (53.10%), Postives = 419/629 (66.61%), Query Frame = 3
Query:   24 KMHESALIKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGE--DFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            KM  S  IK+K  Y  +  IT++ + + Y+QL  E+ ++C L      T+KWIDDEGDPCTI++QMEL+EA RLY   K+  + +HVFPS+P  PGMPC GED  +YRRGA+RW+K Y + GH F AKRFN+ A C  C +RIWGLG+QG +C  C+LL+HKRC  LV   C +  D  +P  + Q+                         +D P +  +E+  +   KH+ R                                P +D   G    +G +GL DF L+ V+GRGSYAKV  V  K   + YAMKV+KKE + D +DI+WVQTEKHVFE AS++PFLVGLHSCFQTPSRL  VIE+VNGGDLM+HMQR+ ++PEEHA+FYAAEI +ALNFLH R IIYRDLKLDNVL+D DGH+KLTDYGMCKEG+      +TFCGTPNYIAPEILR E YG SVDWW+LGVLMFEM+AG SP+        P+ NTEDYLF +IL KPIRIPR +S KAS +LKG LNKDP +RL C+  + F D ++H FFR ++WD L  K++ PPF+P++T D  L NFD  FT EPV  TPDD+  I +IDQSEFEGFEYINPLL+++EE V
Sbjct:    8 KMDLSKDIKIKAHYKGDILITRLGSYLNYEQLCDEVREMCYLNQRQPITLKWIDDEGDPCTISSQMELEEAFRLYSIYKEEGLSIHVFPSIPEKPGMPCPGEDKSIYRRGARRWRKLYRVNGHLFQAKRFNRKAYCGQCSERIWGLGRQGYKCINCKLLVHKRCHILVPLTCKKHMDLVMPFQEPQVDDK-------------------SDEVDPPSEEIDEISIIAPRKHENRKDGSE------------------------DLKPVIDGMDGIKISQG-LGLQDFELIRVIGRGSYAKVLLVRLKKNDQTYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTPSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDN--PDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCQLQTGFSDIKSHTFFRSIDWDMLEKKQVVPPFKPQITDDYGLENFDTQFTSEPVQLTPDDEETIKRIDQSEFEGFEYINPLLISSEETV 590          
BLAST of Protein kinase C vs. Ensembl Xenopus
Match: zfhx4 (zinc finger homeobox 4 [Source:Xenbase;Acc:XB-GENE-957673])

HSP 1 Score: 660.603 bits (1703), Expect = 0.000e+0
Identity = 324/626 (51.76%), Postives = 418/626 (66.77%), Query Frame = 3
Query:   36 SALIKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENGGIENPGYYV---ESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            S  +++K  +  +  IT    S+T+D L  E+  +C   +   FTMKWID+EGDPCT+++Q+EL+EA RLYE NKD+E+++HVFP +P  PGMPC GED  +YRRGA+RW+K Y   GH F AKRFN+ A C  C DRIWGLG+QG +C  C+L        LV  KC +  ++   +  I   +          ++ PG +    E  + Y     + L QV + K  + + +                                     +G     +GL DF+L+ V+GRGSYAKV  V  K T++IYAMKV+KKE + D +DI+WVQTEKHVFE ASNHPFLVGLHSCFQT SRL +VIE+VNGGDLM+HMQR+ ++PEEHA+FY+AEI+LALN+LH R IIYRDLKLDNVL+D++GH+KLTDYGMCKEG+      +TFCGTPNYIAPEILR E YG SVDWW+LGVLMFEM+AG SP+   G    P++NTED+LF +IL K IRIPRS+S KA+S+LK  LNKDP  RL C P + F D Q H FFR ++WD +  K++ PPF+P ++ +  L NFD  FT+EPV  TPDD+  + KIDQSEFEGFEYINPLL++ EE V
Sbjct:   16 SHQVRVKAYFKGDIMITHFEPSITFDGLCNEVRDMCSFENDQPFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCIPERPGMPCAGEDKSIYRRGARRWRKLYCANGHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKL--------LVHKKCHKLVSIECGRHTIAEPVI--------PMDPPGMHSDHSEPELPYRPRSQDNLDQVGEEKEAMNSRE-------------------------------------SGKTPSSLGLQDFDLMRVIGRGSYAKVLLVRLKKTERIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDFLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKDRLGCHPQTGFADIQGHQFFRNVDWDLMEQKQVVPPFKPNISGEFGLDNFDAQFTNEPVQLTPDDEDVVRKIDQSEFEGFEYINPLLMSAEECV 588          
BLAST of Protein kinase C vs. Ensembl Xenopus
Match: prkcz (protein kinase C zeta [Source:NCBI gene;Acc:100101769])

HSP 1 Score: 659.448 bits (1700), Expect = 0.000e+0
Identity = 333/628 (53.03%), Postives = 418/628 (66.56%), Query Frame = 3
Query:   27 MHESALIKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGE--DFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            M  S  IK+K  Y  +  IT++ + + Y+QL  E+ ++C L      T+KWIDDEGDPCTI++QMEL+EA RLY   K+  + +HVFPS+P  PGMPC GED  +YRRGA+RW+K Y + GH F AKRFN+ A C  C +RIWGLG+QG +C  C+LL+HKRC  LV   C +  D  +P  + Q+                         +D P    EE+ + + I    ++S                              P +D   G    +G +GL DF L+ V+GRGSYAKV  V  K   + YAMKV+KKE + D +DI+WVQTEKHVFE AS++PFLVGLHSCFQTPSRL  VIE+VNGGDLM+HMQR+ ++PEEHA+FYAAEI +ALNFLH R IIYRDLKLDNVL+D DGH+KLTDYGMCKEG+      +TFCGTPNYIAPEILR E YG SVDWW+LGVLMFEM+AG SP+        P+ NTEDYLF +IL KPIRIPR +S KAS +LKG LNKDP +RL C+  + F D ++H FFR ++WD L  K++ PPF+P++T D  L NFD  FT EPV  TPDD+  I +IDQSEFEGFEYINPLL+++EE V
Sbjct:    1 MDLSKDIKIKAHYKGDILITRLGSYLNYEQLCDEVREMCYLNQRQPITLKWIDDEGDPCTISSQMELEEAFRLYSIYKEEGLSIHVFPSIPEKPGMPCPGEDKSIYRRGARRWRKLYRVNGHLFQAKRFNRKAYCGQCSERIWGLGRQGYKCINCKLLVHKRCHILVPLTCKKHMDLVMPFQEPQVDDK-------------------SDEVDPPS---EEIDESRLIACHTKSS--------------------TCNKTYRDLKPVIDGMDGIKISQG-LGLQDFELIRVIGRGSYAKVLLVRLKKNDQTYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTPSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDN--PDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCQLQTGFSDIKSHTFFRSIDWDMLEKKQVVPPFKPQITDDYGLENFDTQFTSEPVQLTPDDEETIKRIDQSEFEGFEYINPLLISSEETV 583          
BLAST of Protein kinase C vs. Ensembl Xenopus
Match: prkcz (protein kinase C zeta [Source:NCBI gene;Acc:100101769])

HSP 1 Score: 652.899 bits (1683), Expect = 0.000e+0
Identity = 327/610 (53.61%), Postives = 410/610 (67.21%), Query Frame = 3
Query:   81 ITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGE--DFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            IT++ + + Y+QL  E+ ++C L      T+KWIDDEGDPCTI++QMEL+EA RLY   K+  + +HVFPS+P  PGMPC GED  +YRRGA+RW+K Y + GH F AKRFN+ A C  C +RIWGLG+QG +C  C+LL+HKRC  LV   C +  D  +P  + Q+                         +D P    EE+ + + I    ++S                              P +D   G    +G +GL DF L+ V+GRGSYAKV  V  K   + YAMKV+KKE + D +DI+WVQTEKHVFE AS++PFLVGLHSCFQTPSRL  VIE+VNGGDLM+HMQR+ ++PEEHA+FYAAEI +ALNFLH R IIYRDLKLDNVL+D DGH+KLTDYGMCKEG+      +TFCGTPNYIAPEILR E YG SVDWW+LGVLMFEM+AG SP+        P+ NTEDYLF +IL KPIRIPR +S KAS +LKG LNKDP +RL C+  + F D ++H FFR ++WD L  K++ PPF+P++T D  L NFD  FT EPV  TPDD+  I +IDQSEFEGFEYINPLL+++EE V
Sbjct:   29 ITRLGSYLNYEQLCDEVREMCYLNQRQPITLKWIDDEGDPCTISSQMELEEAFRLYSIYKEEGLSIHVFPSIPEKPGMPCPGEDKSIYRRGARRWRKLYRVNGHLFQAKRFNRKAYCGQCSERIWGLGRQGYKCINCKLLVHKRCHILVPLTCKKHMDLVMPFQEPQVDDK-------------------SDEVDPPS---EEIDESRLIACHTKSS--------------------TCNKTYRDLKPVIDGMDGIKISQG-LGLQDFELIRVIGRGSYAKVLLVRLKKNDQTYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTPSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDN--PDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCQLQTGFSDIKSHTFFRSIDWDMLEKKQVVPPFKPQITDDYGLENFDTQFTSEPVQLTPDDEETIKRIDQSEFEGFEYINPLLISSEETV 593          
BLAST of Protein kinase C vs. Ensembl Xenopus
Match: prkcz (protein kinase C zeta [Source:NCBI gene;Acc:100101769])

HSP 1 Score: 652.899 bits (1683), Expect = 0.000e+0
Identity = 327/610 (53.61%), Postives = 410/610 (67.21%), Query Frame = 3
Query:   81 ITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGE--DFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            IT++ + + Y+QL  E+ ++C L      T+KWIDDEGDPCTI++QMEL+EA RLY   K+  + +HVFPS+P  PGMPC GED  +YRRGA+RW+K Y + GH F AKRFN+ A C  C +RIWGLG+QG +C  C+LL+HKRC  LV   C +  D  +P  + Q+                         +D P    EE+ + + I    ++S                              P +D   G    +G +GL DF L+ V+GRGSYAKV  V  K   + YAMKV+KKE + D +DI+WVQTEKHVFE AS++PFLVGLHSCFQTPSRL  VIE+VNGGDLM+HMQR+ ++PEEHA+FYAAEI +ALNFLH R IIYRDLKLDNVL+D DGH+KLTDYGMCKEG+      +TFCGTPNYIAPEILR E YG SVDWW+LGVLMFEM+AG SP+        P+ NTEDYLF +IL KPIRIPR +S KAS +LKG LNKDP +RL C+  + F D ++H FFR ++WD L  K++ PPF+P++T D  L NFD  FT EPV  TPDD+  I +IDQSEFEGFEYINPLL+++EE V
Sbjct:   24 ITRLGSYLNYEQLCDEVREMCYLNQRQPITLKWIDDEGDPCTISSQMELEEAFRLYSIYKEEGLSIHVFPSIPEKPGMPCPGEDKSIYRRGARRWRKLYRVNGHLFQAKRFNRKAYCGQCSERIWGLGRQGYKCINCKLLVHKRCHILVPLTCKKHMDLVMPFQEPQVDDK-------------------SDEVDPPS---EEIDESRLIACHTKSS--------------------TCNKTYRDLKPVIDGMDGIKISQG-LGLQDFELIRVIGRGSYAKVLLVRLKKNDQTYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTPSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDN--PDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCQLQTGFSDIKSHTFFRSIDWDMLEKKQVVPPFKPQITDDYGLENFDTQFTSEPVQLTPDDEETIKRIDQSEFEGFEYINPLLISSEETV 588          
BLAST of Protein kinase C vs. Ensembl Mouse
Match: Prkci (protein kinase C, iota [Source:MGI Symbol;Acc:MGI:99260])

HSP 1 Score: 682.174 bits (1759), Expect = 0.000e+0
Identity = 330/623 (52.97%), Postives = 418/623 (67.09%), Query Frame = 3
Query:   36 SALIKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            S  +++K  Y  +  IT    S++++ L  E+  +C   +   FTMKWID+EGDPCT+++Q+EL+EA RLYE NKD+E+++HVFP +P  PGMPC GED  +YRRGA+RW+K Y   GH F AKRFN+ A C  C DRIWGLG+QG +C  C+LL+HK+C +LV  +CG     P     +   M    T             ++ I Y     E L QV + K  +   +                                     +G     +GL DF+LL V+GRGSYAKV  V  K T +IYAMKV+KKE + D +DI+WVQTEKHVFE ASNHPFLVGLHSCFQT SRL +VIE+VNGGDLM+HMQR+ ++PEEHA+FY+AEI+LALN+LH R IIYRDLKLDNVL+D++GH+KLTDYGMCKEG+      +TFCGTPNYIAPEILR E YG SVDWW+LGVLMFEM+AG SP+   G    P++NTEDYLF +IL K IRIPRS+S KA+S+LK  LNKDP +RL C P + F D Q H FFR ++WD +  K++ PPF+P ++ +  L NFD  FT+EPV  TPDD   + KIDQSEFEGFEYINPLL++ EE V
Sbjct:   23 SHQVRVKAYYRGDIMITHFEPSISFEGLCSEVRDMCSFDNEQPFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGEDKSIYRRGARRWRKLYCANGHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTIECGRHSLPPEPMMPMDQTMHPDHT-------------QTVIPYNPSSHESLDQVGEEKEAMNTRE-------------------------------------SGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNEPVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV 595          
BLAST of Protein kinase C vs. Ensembl Mouse
Match: Prkcz (protein kinase C, zeta [Source:MGI Symbol;Acc:MGI:97602])

HSP 1 Score: 657.136 bits (1694), Expect = 0.000e+0
Identity = 331/622 (53.22%), Postives = 416/622 (66.88%), Query Frame = 3
Query:   45 IKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGE--DFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            ++LK  Y  +  IT ++A  T+  L  E+  +C L      T+KW+D EGDPCT+++QMEL+EA RL    +D  +++HVFPS+P  PGMPC GED  +YRRGA+RW+K Y   GH F AKRFN+ A C  C +RIWGL +QG RC  C+LL+HKRC  LV   C    D  +P+ +  +          +N G++ P    +  I Y +    +   +KD   DL+                                P +D   G    +G +GL DF+L+ V+GRGSYAKV  V  K   +IYAMKV+KKE + D +DI+WVQTEKHVFE AS++PFLVGLHSCFQT SRL  VIE+VNGGDLM+HMQR+ ++PEEHA+FYAAEI +ALNFLH R IIYRDLKLDNVL+D DGH+KLTDYGMCKEG+      +TFCGTPNYIAPEILR E YG SVDWW+LGVLMFEM+AG SP+        P+ NTEDYLF +IL KPIRIPR +S KAS +LKG LNKDP +RL C+P + F D ++HAFFR ++WD L  K+  PPF+P++T D  L NFD  FT EPV  TPDD+  I +IDQSEFEGFEYINPLLL+ EE+V
Sbjct:   16 VRLKAHYGGDILITSVDAMTTFKDLCEEVRDMCGLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLVCQGRDEVLIIHVFPSIPEQPGMPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRGAYCGQCSERIWGLSRQGYRCINCKLLVHKRCHVLVPLTCRRHMDSVMPSQEPPVDD--------KNDGVDLPSEETD-GIAY-ISSSRKHDNIKDDSEDLK--------------------------------PVIDGVDGIKISQG-LGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDN--PDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQTLPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLSAEESV 592          
BLAST of Protein kinase C vs. Ensembl Mouse
Match: Prkcz (protein kinase C, zeta [Source:MGI Symbol;Acc:MGI:97602])

HSP 1 Score: 492.656 bits (1267), Expect = 2.349e-169
Identity = 237/363 (65.29%), Postives = 283/363 (77.96%), Query Frame = 3
Query:  816 PPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            P +D   G    +G +GL DF+L+ V+GRGSYAKV  V  K   +IYAMKV+KKE + D +DI+WVQTEKHVFE AS++PFLVGLHSCFQT SRL  VIE+VNGGDLM+HMQR+ ++PEEHA+FYAAEI +ALNFLH R IIYRDLKLDNVL+D DGH+KLTDYGMCKEG+      +TFCGTPNYIAPEILR E YG SVDWW+LGVLMFEM+AG SP+        P+ NTEDYLF +IL KPIRIPR +S KAS +LKG LNKDP +RL C+P + F D ++HAFFR ++WD L  K+  PPF+P++T D  L NFD  FT EPV  TPDD+  I +IDQSEFEGFEYINPLLL+ EE+V
Sbjct:   50 PVIDGVDGIKISQG-LGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDN--PDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQTLPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLSAEESV 409          
BLAST of Protein kinase C vs. Ensembl Mouse
Match: Prkch (protein kinase C, eta [Source:MGI Symbol;Acc:MGI:97600])

HSP 1 Score: 362.073 bits (928), Expect = 6.500e-115
Identity = 200/534 (37.45%), Postives = 291/534 (54.49%), Query Frame = 3
Query:  375 YHLYGHKFSAKRFNKYAECFYCKDRIWGL-GQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGF-EELGQV--KDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXX------------------PPVDTEGGTGDRKG---------KIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLL 1883
            + + GHKF A    +   C +C++ IWG+ G+QG +C  C  ++HKRC  L+   C    N+    +++ + +A QR     GI  P  +   N  Y V  F +  G +    ++  L+    ++ V +R            +  L+   +                    +  +G  G ++G         + G+ +F  + V+G+GS+ KV     K T ++YA+KV+KK+ I   DD+E   TEK +   A NHPFL  L  CFQTP RL +V+EFVNGGDLM+H+Q+  R  E  A+FYAAEI  AL FLH + IIYRDLKLDNVL+D++GH KL D+GMCKEGI   +   TFCGTP+YIAPEIL+   YG +VDWW++GVL++EML G +P+         E   ED LF  IL   +  P  +   A+ ILK  + K+PT RL         +   H FF+ ++W  L  ++++PPFRP +    D++NFDP F  E  + TP D+  +  I+Q EF  F Y++P L
Sbjct:  167 HQVNGHKFMATYLRQPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTACTCQNNI----NKVDAKIAEQRF----GINIPHKFNVHN--YKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIRCQANVAPNCGVNAVELAKTLAGMGLQPGNISPTSKLISRSTLRRQGKEGSKEGNGIGVNSSSRFGIDNFEFIRVLGKGSFGKVMLARIKETGELYAVKVLKKDVILQDDDVECTMTEKRILSLARNHPFLTQLFCCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHEKGIIYRDLKLDNVLLDHEGHCKLADFGMCKEGICNGVTTATFCGTPDYIAPEILQEMLYGPAVDWWAMGVLLYEMLCGHAPF---------EAENEDDLFEAILNDEVVYPTWLHEDATGILKSFMTKNPTMRLGSLTQGGEHEILRHPFFKEIDWAQLNHRQLEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDEGHLPMINQDEFRNFSYVSPEL 681          
BLAST of Protein kinase C vs. Ensembl Mouse
Match: Prkce (protein kinase C, epsilon [Source:MGI Symbol;Acc:MGI:97599])

HSP 1 Score: 363.229 bits (931), Expect = 7.464e-115
Identity = 209/523 (39.96%), Postives = 295/523 (56.41%), Query Frame = 3
Query:  390 HKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDF--------NLPNYQSQIKSNMAIQRTAENGGIENP----------GYYVESNIDYPVDGFEELGQV-----KDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDD-FQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLL 1886
            HKF    +     C +C   +WGL +QGL+C  C++ +H+RC+  V   CG D         +L     +I +N   +R     G E+P              +S    P D  +EL ++     K +  D R  +HR + A                    L+SP  + E   G  K ++GL +FN + V+G+GS+ KV   E K   ++YA+KV+KK+ I   DD++   TEK +   A  HP+L  L+ CFQT  RL +V+E+VNGGDLM+ +QR  +  E  ++FYAAE+  AL FLH+  +IYRDLKLDN+L+D +GH KL D+GMCKEGI   +  TTFCGTP+YIAPEIL+   YG SVDWW+LGVLM+EM+AG     QP    P E + ED LF  IL   +  P  +S +A SILK  + K+P +RL C  + N +D  + H FF+ ++W  L  KKI+PPF+P +   RD+ NFD  FT E  + T  D++ I +I+Q EF+GF Y    L+
Sbjct:  243 HKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIAKVLADLGVTPDKI-TNSGQRRKKLAAGAESPQPASGNSPSEDDRSKSAPTSPCD--QELKELENNIRKALSFDNRGEEHRASSAT----------------DGQLASPGENGEVRPGQAK-RLGLDEFNFIKVLGKGSFGKVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGIMNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAG-----QP----PFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVAAQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPILTLVDEAIIKQINQEEFKGFSYFGEDLM 736          

HSP 2 Score: 64.3142 bits (155), Expect = 3.824e-10
Identity = 41/131 (31.30%), Postives = 66/131 (50.38%), Query Frame = 3
Query:  183 DDEGDPCTITTQMELDEAIRLYE--TNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYR--------RGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWG-LGQQGLRCGTCRLLLHKRCQQLVKHKCG 542
            DD    CTI  +  L    R +E   + + E  ++V   L  S G   +  + +V+R        +GA R ++ + + GHKF A    +   C +C+D IWG +G+QG +C  C  ++HKRC +L+  KC 
Sbjct:   92 DDFVANCTIQFEELLQNGSRHFEDWIDLEPEGKVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVR-RRVHQVNGHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCA 221          
BLAST of Protein kinase C vs. UniProt/SwissProt
Match: sp|P41743|KPCI_HUMAN (Protein kinase C iota type OS=Homo sapiens OX=9606 GN=PRKCI PE=1 SV=2)

HSP 1 Score: 684.485 bits (1765), Expect = 0.000e+0
Identity = 332/628 (52.87%), Postives = 424/628 (67.52%), Query Frame = 3
Query:   36 SALIKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCG-----EDFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            S  +++K  Y  +  IT    S++++ L  E+  +C   +   FTMKWID+EGDPCT+++Q+EL+EA RLYE NKD+E+++HVFP +P  PGMPC GED  +YRRGA+RW+K Y   GH F AKRFN+ A C  C DRIWGLG+QG +C  C+LL+HK+C +LV  +CG     ++  +P  QS + S+ A                 ++ I Y     E L QV + K  +   +                                     +G     +GL DF+LL V+GRGSYAKV  V  K T +IYAMKV+KKE + D +DI+WVQTEKHVFE ASNHPFLVGLHSCFQT SRL +VIE+VNGGDLM+HMQR+ ++PEEHA+FY+AEI+LALN+LH R IIYRDLKLDNVL+D++GH+KLTDYGMCKEG+      +TFCGTPNYIAPEILR E YG SVDWW+LGVLMFEM+AG SP+   G    P++NTEDYLF +IL K IRIPRS+S KA+S+LK  LNKDP +RL C P + F D Q H FFR ++WD +  K++ PPF+P ++ +  L NFD  FT+EPV  TPDD   + KIDQSEFEGFEYINPLL++ EE V
Sbjct:   23 SHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGEDKSIYRRGARRWRKLYCANGHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTIECGRHSLPQEPVMPMDQSSMHSDHA-----------------QTVIPYNPSSHESLDQVGEEKEAMNTRE-------------------------------------SGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNEPVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV 596          
BLAST of Protein kinase C vs. UniProt/SwissProt
Match: sp|Q5R4K9|KPCI_PONAB (Protein kinase C iota type OS=Pongo abelii OX=9601 GN=PRKCI PE=2 SV=2)

HSP 1 Score: 683.33 bits (1762), Expect = 0.000e+0
Identity = 332/628 (52.87%), Postives = 423/628 (67.36%), Query Frame = 3
Query:   36 SALIKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGE-----DFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            S  +++K  Y  +  IT    S++++ L  E+  +C   +   FTMKWID+EGDPCT+++Q+EL+EA RLYE NKD+E+++HVFP +P  PGMPC GED  +YRRGA+RW+K Y   GH F AKRFN+ A C  C DRIWGLG+QG +C  C+LL+HK+C +LV  +CG      +  +P  QS + S+ A                 ++ I Y     E L QV + K  +   +                                     +G     +GL DF+LL V+GRGSYAKV  V  K T +IYAMKV+KKE + D +DI+WVQTEKHVFE ASNHPFLVGLHSCFQT SRL +VIE+VNGGDLM+HMQR+ ++PEEHA+FY+AEI+LALN+LH R IIYRDLKLDNVL+D++GH+KLTDYGMCKEG+      +TFCGTPNYIAPEILR E YG SVDWW+LGVLMFEM+AG SP+   G    P++NTEDYLF +IL K IRIPRS+S KA+S+LK  LNKDP +RL C P + F D Q H FFR ++WD +  K++ PPF+P ++ +  L NFD  FT+EPV  TPDD   + KIDQSEFEGFEYINPLL++ EE V
Sbjct:   23 SHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGEDKSIYRRGARRWRKLYCANGHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTIECGRHSLPPEPMMPMDQSSMHSDHA-----------------QTVIPYNPSSHESLDQVGEEKEAMNTRE-------------------------------------SGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNEPVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV 596          
BLAST of Protein kinase C vs. UniProt/SwissProt
Match: sp|Q62074|KPCI_MOUSE (Protein kinase C iota type OS=Mus musculus OX=10090 GN=Prkci PE=1 SV=3)

HSP 1 Score: 682.174 bits (1759), Expect = 0.000e+0
Identity = 330/623 (52.97%), Postives = 418/623 (67.09%), Query Frame = 3
Query:   36 SALIKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            S  +++K  Y  +  IT    S++++ L  E+  +C   +   FTMKWID+EGDPCT+++Q+EL+EA RLYE NKD+E+++HVFP +P  PGMPC GED  +YRRGA+RW+K Y   GH F AKRFN+ A C  C DRIWGLG+QG +C  C+LL+HK+C +LV  +CG     P     +   M    T             ++ I Y     E L QV + K  +   +                                     +G     +GL DF+LL V+GRGSYAKV  V  K T +IYAMKV+KKE + D +DI+WVQTEKHVFE ASNHPFLVGLHSCFQT SRL +VIE+VNGGDLM+HMQR+ ++PEEHA+FY+AEI+LALN+LH R IIYRDLKLDNVL+D++GH+KLTDYGMCKEG+      +TFCGTPNYIAPEILR E YG SVDWW+LGVLMFEM+AG SP+   G    P++NTEDYLF +IL K IRIPRS+S KA+S+LK  LNKDP +RL C P + F D Q H FFR ++WD +  K++ PPF+P ++ +  L NFD  FT+EPV  TPDD   + KIDQSEFEGFEYINPLL++ EE V
Sbjct:   23 SHQVRVKAYYRGDIMITHFEPSISFEGLCSEVRDMCSFDNEQPFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGEDKSIYRRGARRWRKLYCANGHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTIECGRHSLPPEPMMPMDQTMHPDHT-------------QTVIPYNPSSHESLDQVGEEKEAMNTRE-------------------------------------SGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNEPVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV 595          
BLAST of Protein kinase C vs. UniProt/SwissProt
Match: sp|F1M7Y5|KPCI_RAT (Protein kinase C iota type OS=Rattus norvegicus OX=10116 GN=Prkci PE=1 SV=1)

HSP 1 Score: 681.019 bits (1756), Expect = 0.000e+0
Identity = 330/623 (52.97%), Postives = 425/623 (68.22%), Query Frame = 3
Query:   36 SALIKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            S  +++K  Y  +  IT    S++++ L  E+  +C   +   FTMKWID+EGDPCT+++Q+EL+EA RLYE NKD+E+++HVFP +P  PGMPC GED  +YRRGA+RW+K Y   GH F AKRFN+ A C  C DRIWGLG+QG +C  C+LL+HK+C +LV  +CG   +LP      +  M + +++ +        + ++ I Y     E L QV + K  +   +                                     +G     +GL DF+LL V+GRGSYAKV  V  K T +IYAMKV+KKE + D +DI+WVQTEKHVFE ASNHPFLVGLHSCFQT SRL +VIE+VNGGDLM+HMQR+ ++PEEHA+FY+AEI+LALN+LH R IIYRDLKLDNVL+D++GH+KLTDYGMCKEG+      +TFCGTPNYIAPEILR E YG SVDWW+LGVLMFEM+AG SP+   G    P++NTEDYLF +IL K IRIPRS+S KA+S+LK  LNKDP +RL C P + F D Q H FFR ++WD +  K++ PPF+P ++ +  L NFD  FT+EPV  TPDD   + KIDQSEFEGFEYINPLL++ EE V
Sbjct:   23 SHQVRVKAYYRGDIMITHFEPSISFEGLCSEVRDMCSFDNEQPFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGEDKSIYRRGARRWRKLYCANGHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTIECGR-HSLPP-----EPMMPMDQSSMHPD------HTQTVIPYNPSSHESLDQVGEEKEAMNTRE-------------------------------------SGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNEPVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV 596          
BLAST of Protein kinase C vs. UniProt/SwissProt
Match: sp|Q90XF2|KPCI_DANRE (Protein kinase C iota type OS=Danio rerio OX=7955 GN=prkci PE=2 SV=2)

HSP 1 Score: 680.248 bits (1754), Expect = 0.000e+0
Identity = 328/620 (52.90%), Postives = 426/620 (68.71%), Query Frame = 3
Query:   45 IKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            +++K  Y  +  IT    S++Y+ L  E+  +C + +   FTMKWID+EGDPCT+++Q+EL+EA+RLYE NKD+E+++HVFP +P  PGMPC GED  +YRRGA+RW+K Y+  GH F AKRFN+ A C  C DRIWGLG+QG +C  C+LL+HK+C +LV  +CG          Q+  +  I R        +PG    ++ ++P     +    + I H+    +   AV  R                             +G     +GL DF+LL V+GRGSYAKV  V  K T++IYAMKV+KKE + D +DI+WVQTEKHVFE ASNHPFLVGLHSCFQT SRL +VIE+VNGGDLM+HMQR+ ++PEEHA+FY+AEI+LALN+LH R IIYRDLKLDNVL+D++GH+KLTDYGMCKEG+      +TFCGTPNYIAPEILR E YG SVDWW+LGVLMFEM+AG SP+   G    P++NTEDYLF +IL K IRIPRS+S KA+S+LKG LNK+  +RL C P + F D   H FFR ++WD +  K++ PPF+P ++ +  L NFD  FT+EP+  TPDD   + KIDQSEFEGFEYINPLL++ EE V
Sbjct:   19 VRVKAYYRGDIMITHFEPSISYEGLCNEVRDMCSMDNDQLFTMKWIDEEGDPCTVSSQLELEEALRLYELNKDSELIIHVFPCVPEKPGMPCPGEDKSIYRRGARRWRKLYYATGHAFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTVECGR---------QVIQDPMIGRI-------DPG---STHPEHPDQVLGKKNSTESINHE---GEEHEAVGSRE----------------------------SGKAVSSLGLIDFDLLRVIGRGSYAKVLLVRLKKTERIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSLSVKAASVLKGFLNKESKERLGCHPQTGFADIMAHPFFRNVDWDLMEQKQVVPPFKPNISGEFGLDNFDAQFTNEPIQLTPDDDDAVKKIDQSEFEGFEYINPLLMSAEECV 588          
BLAST of Protein kinase C vs. TrEMBL
Match: A0A504Y6V3 (Protein kinase C OS=Fasciola gigantica OX=46835 GN=FGIG_00574 PE=3 SV=1)

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 349/655 (53.28%), Postives = 442/655 (67.48%), Query Frame = 3
Query:   45 IKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKK-FYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNI---DYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGG-------------------------------TGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            I +K I+ S A +T + +      +R ++ ++C       FT+KWID+E DPC +++ +ELDEA+RL   NK+ ++ + VF  +P+ PG PC GEDL +YRRGAKRWKK +Y L+GHKF+A+RFNK AEC YC  RIWGLGQQG +C TCRLLLH+RC+  V+HKCGE   +P   + +        + E     N   Y+ +N      P+        V+   H+  A+   +A A ++                     P D E                                 T    G++GL DF LL V+GRGSYAKVFQVE+ PT++IYAMKVIKKE I D +DIEWVQTEKHVFECA+NHPFLVGLHSCFQT SRL +VIEFVNGGDLM++MQR LR+ E++A+FY+AEI LALNFLH R IIYRDLKLDNVLMD++GH+KLTDYGMCKEGI  D+  +TFCGTPNYIAPEILR E Y  SVDWW+LGVLMFEMLAG SPW   GQ +  ++N+EDYLF +ILT+PIR PRSIS +A++IL+  L K+P +RL C P SNF D  NH+FFR ++W  L  K+I PP+RP   +D DLT+FDP FTDEPV+FTPD++  +SKIDQ+EFEGFEY+NPLL+T EE V
Sbjct:    8 IPVKYIHNSIAMVTNLPSQADLKAMRSQVMELCQFSPDCRFTLKWIDEEQDPCVLSSDLELDEAVRLLHLNKECQLTVLVFDGIPSEPGKPCPGEDLSMYRRGAKRWKKKYYLLHGHKFAARRFNKNAECAYCHGRIWGLGQQGFKCITCRLLLHRRCRGCVQHKCGEPLTIPGPLNPVTVGRVTPLSPET---PNEFAYLNNNTGANSRPISYQLSHAGVETPNHNSGATRLEIAYAQQSTFEEERNRPRTGIQNPAFVDRPSDVEHTRKPRCTEISVPRPDVVIPILEERIAEMSVVTTTSSSGQVGLQDFKLLKVIGRGSYAKVFQVEHIPTQRIYAMKVIKKETILDEEDIEWVQTEKHVFECATNHPFLVGLHSCFQTDSRLFFVIEFVNGGDLMFYMQRNLRLAEDYARFYSAEICLALNFLHERGIIYRDLKLDNVLMDSEGHIKLTDYGMCKEGITADVMTSTFCGTPNYIAPEILRGENYNFSVDWWALGVLMFEMLAGRSPWENVGQSVNQDQNSEDYLFQVILTRPIRFPRSISVRATNILRAFLTKNPAERLGCLPDSNFADIMNHSFFRPVDWVALEQKQIAPPYRPTYANDYDLTHFDPTFTDEPVVFTPDNEEVVSKIDQTEFEGFEYVNPLLMTLEEPV 659          
BLAST of Protein kinase C vs. TrEMBL
Match: A0A4E0R550 (Protein kinase C OS=Fasciola hepatica OX=6192 GN=D915_008611 PE=3 SV=1)

HSP 1 Score: 709.523 bits (1830), Expect = 0.000e+0
Identity = 348/655 (53.13%), Postives = 440/655 (67.18%), Query Frame = 3
Query:   45 IKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKK-FYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDY---PVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGG-------------------------------TGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            I +K I+ S A +T + +      ++ ++ ++C       FT+KWID+E DPC +++ +EL+EA+RL   NK+ ++ + VF  +P  PG PC GEDL +YRRGAKRWKK +Y L+GHKF+A+RFNK AEC YC  RIWGLGQQG +C TCRLLLH+RC+  V+HKCGE   +P   + +        + E     N   Y+ +N      P         V+   H+  AS   +A A ++                     P D E                                 T    G++GL DF LL V+GRGSYAKVFQVE+ PT++IYAMKVIKKE I D +DIEWVQTEKHVFECA+NHPFLVGLHSCFQT SRL +VIEFVNGGDLM++MQR LR+ E++A+FY+AEI LALNFLH R IIYRDLKLDNVLMD++GH+KLTDYGMCKEGI  D+  +TFCGTPNYIAPEILR E Y  SVDWW+LGVLMFEMLAG SPW   GQ +  ++N+EDYLF +ILT+PIR PRSIS +A++IL+  L K+P +RL C P SNF D  NH+FFR ++W  L  K+I PP+RP   +D DLT+FDP FTDEPV+FTPD++  +SKIDQ+EFEGFEY+NPLL+T EE V
Sbjct:    8 IPVKYIHNSIAMVTNLPSQADLKAMQSQVMELCQFSPDCRFTLKWIDEEQDPCVLSSDLELEEAVRLLHLNKECQLTVLVFDGIPLEPGKPCPGEDLSMYRRGAKRWKKKYYLLHGHKFAARRFNKNAECAYCHGRIWGLGQQGFKCITCRLLLHRRCRGCVQHKCGEPLTIPGPLNPVTVGRVTPLSPET---PNEFAYLNNNASANSRPTSYQLSHAGVETPNHNSGASRLEIAYAQQSTFEEERNRPRTGIQNPAFVDRPSDVEHTRKPRCTEISVPRPDVVIPILEERIAEMSVITTTSSSGQVGLQDFKLLKVIGRGSYAKVFQVEHIPTQRIYAMKVIKKETILDEEDIEWVQTEKHVFECATNHPFLVGLHSCFQTDSRLFFVIEFVNGGDLMFYMQRNLRLAEDYARFYSAEICLALNFLHERGIIYRDLKLDNVLMDSEGHIKLTDYGMCKEGITADVMTSTFCGTPNYIAPEILRGENYNFSVDWWALGVLMFEMLAGRSPWENVGQSVNQDQNSEDYLFQVILTRPIRFPRSISVRATNILRAFLTKNPAERLGCLPDSNFADIMNHSFFRPVDWVALEQKQIAPPYRPTYANDYDLTHFDPTFTDEPVVFTPDNEEVVSKIDQTEFEGFEYVNPLLMTLEEPV 659          
BLAST of Protein kinase C vs. TrEMBL
Match: A0A1B6DB11 (Protein kinase C OS=Clastoptera arizonana OX=38151 GN=g.32058 PE=3 SV=1)

HSP 1 Score: 706.442 bits (1822), Expect = 0.000e+0
Identity = 350/626 (55.91%), Postives = 433/626 (69.17%), Query Frame = 3
Query:   30 HESALIKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPV-DGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            HE   I++K  Y  E  IT I+  +T DQL  E+  IC       FTMKW+D+EGDPCTI+TQMELDEAIRLYE N+D+E+ +HVFP++P +PGMPCQGED  +YRRGA+RW+K Y + GH F AKRFN+ A C +C+DRIWGLG+QG +C  C+LL+HK+C +LV+  C  +   P           I R   NG           NI+ P  +   EL    D   DL A    +    +++                      + E G+   + +  L DF L+ V+GRGSYAKV  VE K T++IYAMKVIKK  +TD +DI+WVQTEKHVFE ASNHPFLVGLHSCFQTPSRL +VIEFV GGDLM+HMQR+ R+PEEHA+FYAAEI+LALNFLH + IIYRDLKLDNVL+D++GH+KLTDYGMCKEGI      +TFCGTPNYIAPEILR E YG SVDWW+LGVL++EMLAG SP+   G    P++NTEDYLF +IL K IRIPRS+S KA+S+LKG LNK+P  RL C   + F D  NHAFF+ ++W+ L  K++ PP++P L  DRDL NF P FTDEPV  TPDD   I KIDQSEFEGFEY+NPLL++ E+ V
Sbjct:    9 HEVPEIRVKTAYDGEIMITYIDPHITVDQLCQEMRDICRFSQDQVFTMKWVDEEGDPCTISTQMELDEAIRLYEINRDSELTIHVFPNVPPAPGMPCQGEDRSIYRRGARRWRKLYRVNGHIFQAKRFNRRAFCAFCQDRIWGLGRQGFKCIQCKLLVHKKCHKLVQKPCSNEVVEP-----------IIRDDANGDT--------PNINTPTSELLPELKDFPDPPLDLTADSVPIEDPTKSDD---------------------NLEPGS---QRQYSLADFELIRVIGRGSYAKVLMVELKKTRRIYAMKVIKKALVTDDEDIDWVQTEKHVFETASNHPFLVGLHSCFQTPSRLFFVIEFVRGGDLMFHMQRQRRLPEEHARFYAAEISLALNFLHDKGIIYRDLKLDNVLLDHEGHIKLTDYGMCKEGIRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLLYEMLAGRSPFDLAGASENPDQNTEDYLFQVILEKTIRIPRSLSVKAASVLKGFLNKNPVDRLGCHRETGFYDIANHAFFKSIDWEMLEQKQVAPPYKPRLDSDRDLANFPPEFTDEPVHLTPDDTRVIEKIDQSEFEGFEYVNPLLMSLEDCV 591          
BLAST of Protein kinase C vs. TrEMBL
Match: A0A564YUI6 (Protein kinase C OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS9332 PE=3 SV=1)

HSP 1 Score: 706.057 bits (1821), Expect = 0.000e+0
Identity = 358/629 (56.92%), Postives = 427/629 (67.89%), Query Frame = 3
Query:   45 IKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRW-KKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGD--------RKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            ++LK+ +    TIT I++S  + QL+  I  +  L     FTMKW+DDEGDPC +T   EL E+IRLY  NK+  + +HVF   P SPG+PC GED+K+YRRGAKRW KKFYHL GH F  +RFNK A C YC+DRIWGLGQQG +C  C+LL+HKRC   V ++CGE    P ++      +  QR     G       + S      DG    G V  ++   R S H+ A                         P    E G G         +  +IGL +FNLL V+GRGSYAKVFQVEYK T KIYAMKVIKKE ITD +DI+WVQTEKHVFE ASNHPFLVGLHSCFQTPSRL +VIEF+NGGDLMYHMQR+ R+PE+HAKFYAAEI +A+NFLH R I+YRDLKLDNVLMD +GH+KLTDYGMCKEGI      +TFCGTPNYIAPEILR E+Y  SVDWW+LGVLMFEM++G SPW   G    P++NTEDYLF +ILTKPIR PRSIS KAS+IL+  LNKDPT RL C P+SNF D QN  FF  ++W  L  K++ PPFRPE T +  L +FDP FT+E V FTPDD   I  IDQSEF+GFEY+NPLL+ T E V
Sbjct:    1 MRLKVFHNGTTTITDIDSSFNFQQLQTSIQALYRLRPNDPFTMKWVDDEGDPCMLTCDEELQESIRLYHANKEPFLAVHVFNGAPPSPGLPCPGEDVKMYRRGAKRWNKKFYHLKGHNFVGRRFNKNAICAYCEDRIWGLGQQGYKCTNCKLLIHKRCAPSVDYRCGE--VAPPHE------VIRQRPVTVNGDAGANEMLIS------DGVANSGFVGSVRDATRTSHHKGAAV-----------------------PLPKAEVGDGSLIIPKVPVKSEQIGLENFNLLRVIGRGSYAKVFQVEYKSTSKIYAMKVIKKEIITDEEDIDWVQTEKHVFEIASNHPFLVGLHSCFQTPSRLFFVIEFINGGDLMYHMQRQCRLPEDHAKFYAAEICIAMNFLHERQIVYRDLKLDNVLMDLEGHIKLTDYGMCKEGISETNLTSTFCGTPNYIAPEILRGESYSFSVDWWALGVLMFEMVSGRSPWEGIGSSNNPDQNTEDYLFQVILTKPIRYPRSISVKASNILQRFLNKDPTDRLGCAPNSNFADIQNQPFFSSIDWVALEQKRVPPPFRPEETDEFSLIHFDPTFTNEEVCFTPDDPDVIRAIDQSEFDGFEYLNPLLIKTAETV 592          
BLAST of Protein kinase C vs. TrEMBL
Match: A0A5K3FGB9 (Protein kinase C OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 704.516 bits (1817), Expect = 0.000e+0
Identity = 353/621 (56.84%), Postives = 434/621 (69.89%), Query Frame = 3
Query:   45 IKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRW-KKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            +KLK ++    TIT+I++SV + QL+  +  +      + FT+KW+DDEGDPC +T   EL EA+RLY+ NK+  +++HVF   P  PGMPC GED K+YRRGAKRW KKFYHL GH F A+RFN+ A C YC+DRIWGLGQQG +C  C+LL+HKRC   V  +CGE    P ++      +  QR     G+                G EE+     I+++   +  R      A++      +  +    ++   PV +E        ++GL  F LL V+GRGSYAKVFQVEYKPT KIYAMKVIKKE ITD +DI+WVQTEKHVFE ASNHPFLVGLHSCFQTPSRL +VIEF+NGGDLMYHMQR LR+PEE+AKFYAAEI +ALNFLH R I+YRDLKLDNVLMD +GH+KLTDYGMCKEGI  +   +TFCGTPNYIAPEILR+E+Y  SVDWW+LGVLMFEM++G SPW   G    P+ NTEDYLF +ILTKPIR PRSIS +AS+IL+  LNKDP +RL C P+SNF D QN  FFR ++W  L  K++QPP+RPE   D  L +FDP FT+E V FTPDD   I  IDQSEF+GFEY+NPLL+ T E V
Sbjct:    8 MKLKFVFDGTITITEIDSSVDFQQLQLAVISLYHFSPETLFTLKWVDDEGDPCLLTGDSELREAVRLYQLNKEPFLLVHVFIGAPPEPGMPCPGEDCKMYRRGAKRWNKKFYHLKGHNFLARRFNRNAICAYCEDRIWGLGQQGYKCNACKLLIHKRCAPSVDFRCGE--VAPAHE------VVRQRPVTVNGV----------------GAEEMLVADGIQNNAFIASDREVYDSPASSRKNKQGAKAAPDALVIPEVPVKSE--------QVGLDHFKLLRVIGRGSYAKVFQVEYKPTGKIYAMKVIKKEIITDEEDIDWVQTEKHVFESASNHPFLVGLHSCFQTPSRLFFVIEFINGGDLMYHMQRHLRLPEEYAKFYAAEICIALNFLHERQIVYRDLKLDNVLMDLEGHIKLTDYGMCKEGISENNLTSTFCGTPNYIAPEILRSESYSFSVDWWALGVLMFEMVSGRSPWEGVGVSNNPDHNTEDYLFQVILTKPIRYPRSISVQASNILQRFLNKDPVERLGCPPNSNFADIQNQPFFRSIDWVALEQKRVQPPYRPEKADDYSLIHFDPTFTNEEVCFTPDDPEVIRAIDQSEFDGFEYLNPLLIKTAETV 596          
BLAST of Protein kinase C vs. Ensembl Cavefish
Match: prkcz (protein kinase C zeta type [Source:NCBI gene;Acc:103044996])

HSP 1 Score: 488.419 bits (1256), Expect = 8.481e-166
Identity = 231/348 (66.38%), Postives = 278/348 (79.89%), Query Frame = 3
Query:  861 IGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            +GL DF+L+ V+GRGSYAKV  V  K  + IYAMKV+KKE + D +DI+WVQTEKHVFE AS +PFLVGLHSCFQT SRL  VIE+VNGGDLM+HMQR+ ++PEEHA+FYAAEI +ALNFLH + IIYRDLKLDNVL+D DGH+KLTDYGMCKEGI      +TFCGTPNYIAPEILR E YG SVDWW+LGVLMFEM+AG SP+        P+ NTE+YLF +IL KPIRIPRS+S KA+S+LKG LNKDP +RL C+  + F D ++H FFR ++WD L  K++ PPF+P++T D  L NFD  FT+EPV  TPDD+  I +IDQSEFEGFEYINPLLL+ EE+V
Sbjct:  206 LGLADFDLIRVIGRGSYAKVLLVRLKKNEHIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASTNPFLVGLHSCFQTESRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHEKGIIYRDLKLDNVLLDQDGHIKLTDYGMCKEGIRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIITDN--PDMNTEEYLFQVILEKPIRIPRSLSVKAASVLKGFLNKDPKERLGCQVQTGFTDIKSHTFFRSIDWDQLEQKQVTPPFKPQITDDYGLDNFDTQFTNEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLSNEESV 551          

HSP 2 Score: 201.06 bits (510), Expect = 4.858e-56
Identity = 86/166 (51.81%), Postives = 118/166 (71.08%), Query Frame = 3
Query:   42 LIKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKC 539
            ++K  +    +  I+ +++ VT+ +L  E+  +C +      T+KWIDDEGDPCTI++QMELDEA R+Y  NK + +++HVFPS+P  PGMPC GED  +YRRGA+RW+K Y + GH F AKRFN+ A C +C +RIWGLG+QG RC  CRLL+HKRC +LV   C
Sbjct:    1 MLKCCVCVCRDMLISDLDSGVTFSELCEEVRGMCRVHREQPITLKWIDDEGDPCTISSQMELDEAFRIYSRNKRSGLLLHVFPSIPEKPGMPCPGEDKSIYRRGARRWRKLYRVNGHLFQAKRFNRKAYCGHCSERIWGLGRQGYRCINCRLLVHKRCHKLVPLSC 166          
BLAST of Protein kinase C vs. Ensembl Cavefish
Match: prkcz (protein kinase C zeta type [Source:NCBI gene;Acc:103044996])

HSP 1 Score: 489.96 bits (1260), Expect = 1.203e-165
Identity = 231/348 (66.38%), Postives = 278/348 (79.89%), Query Frame = 3
Query:  861 IGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            +GL DF+L+ V+GRGSYAKV  V  K  + IYAMKV+KKE + D +DI+WVQTEKHVFE AS +PFLVGLHSCFQT SRL  VIE+VNGGDLM+HMQR+ ++PEEHA+FYAAEI +ALNFLH + IIYRDLKLDNVL+D DGH+KLTDYGMCKEGI      +TFCGTPNYIAPEILR E YG SVDWW+LGVLMFEM+AG SP+        P+ NTE+YLF +IL KPIRIPRS+S KA+S+LKG LNKDP +RL C+  + F D ++H FFR ++WD L  K++ PPF+P++T D  L NFD  FT+EPV  TPDD+  I +IDQSEFEGFEYINPLLL+ EE+V
Sbjct:  252 LGLADFDLIRVIGRGSYAKVLLVRLKKNEHIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASTNPFLVGLHSCFQTESRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHEKGIIYRDLKLDNVLLDQDGHIKLTDYGMCKEGIRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIITDN--PDMNTEEYLFQVILEKPIRIPRSLSVKAASVLKGFLNKDPKERLGCQVQTGFTDIKSHTFFRSIDWDQLEQKQVTPPFKPQITDDYGLDNFDTQFTNEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLSNEESV 597          

HSP 2 Score: 208.379 bits (529), Expect = 3.016e-58
Identity = 91/173 (52.60%), Postives = 124/173 (71.68%), Query Frame = 3
Query:   21 MKMHESALIKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKC 539
            M++HE   +K+K  Y  +  I+ +++ VT+ +L  E+  +C +      T+KWIDDEGDPCTI++QMELDEA R+Y  NK + +++HVFPS+P  PGMPC GED  +YRRGA+RW+K Y + GH F AKRFN+ A C +C +RIWGLG+QG RC  CRLL+HKRC +LV   C
Sbjct:    9 MEIHEE-YVKIKAHYGGDMLISDLDSGVTFSELCEEVRGMCRVHREQPITLKWIDDEGDPCTISSQMELDEAFRIYSRNKRSGLLLHVFPSIPEKPGMPCPGEDKSIYRRGARRWRKLYRVNGHLFQAKRFNRKAYCGHCSERIWGLGRQGYRCINCRLLVHKRCHKLVPLSC 180          
BLAST of Protein kinase C vs. Ensembl Cavefish
Match: prkci (protein kinase C, iota [Source:NCBI gene;Acc:117507])

HSP 1 Score: 482.256 bits (1240), Expect = 2.157e-163
Identity = 229/354 (64.69%), Postives = 281/354 (79.38%), Query Frame = 3
Query:  843 GDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            G     +GL DF+LL V+GRGSYAKV  V  K T++IYAMKV+KKE + D +DI+WVQTEKHVFE ASNHPFLVGLHSCFQT SRL +VIE+VNGGDLM+HMQR+ ++PEEHA+FY+AEI+LALN+LH R IIYRDLKLDNVL++++GH+KLTDYGMCKEG+      +TFCGTPNYIAPEILR E YG SVDWW+LGVLMFEM+AG SP+   G    P++NTEDYLF +IL K IRIPRS+S KA+S+LKG LNK+P +RL C P + F D   H FFR ++WD +  K++ PPF+P ++ +  L NFD  FT+EP+  TPDD   + KIDQSEFEGFEYINPLL++ EE V
Sbjct:  193 GKATSSLGLADFDLLRVIGRGSYAKVLLVRLKKTERIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLESEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSLSVKAASVLKGFLNKEPKERLGCHPQTGFADIMAHPFFRNVDWDLMEQKQVVPPFKPNISGEFGLDNFDAQFTNEPIQLTPDDDDVVKKIDQSEFEGFEYINPLLMSAEECV 546          

HSP 2 Score: 179.874 bits (455), Expect = 1.899e-48
Identity = 79/161 (49.07%), Postives = 109/161 (67.70%), Query Frame = 3
Query:  192 GDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTA--------ENGGIENPGYYVES 650
            GDPCT+++Q+EL+EA+RLYE NKD+E+++HVFP +P  PGMPC GED  +YRRGA+RW+K Y+  GH F AKRFN+ A C  C DRIWGLG+QG +C  C+LL+HK+C +LV  +CG       ++S ++ ++    T         E GG  +PG    S
Sbjct:   38 GDPCTVSSQLELEEALRLYELNKDSELIIHVFPCIPEKPGMPCPGEDKSIYRRGARRWRKLYYANGHAFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTVECGRQMIQVRHESGLQWSIHKNSTESINHDEEHEAGGSRDPGKATSS 198          
BLAST of Protein kinase C vs. Ensembl Cavefish
Match: prkceb (protein kinase C, epsilon b [Source:ZFIN;Acc:ZDB-GENE-081028-47])

HSP 1 Score: 356.681 bits (914), Expect = 1.380e-114
Identity = 198/517 (38.30%), Postives = 281/517 (54.35%), Query Frame = 3
Query:  390 HKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDF--------NLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGKI--------GLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDD-FQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLT 1889
            HKFS   +     C +C   +WGL +QGL+C  C++ +H+RC+  V   CG D         +L     +I S++  ++    G    P          P+    E  + K         D + +  +R   +  +             +     E G      ++         L DF+ + V+G+GS+ KV   E + T ++YA+KV+KK+ I   DD++   TEK +   A  HP+L  L  CFQT  RL +V+E+VNGGDLM+ +QR  +  E  ++FYAAE+  AL FLHR  +IYRDLKLDN+L+D +GH KL D+GMCKEGI   I  TTFCGTP+YIAPEIL+   YG SVDWW+LGVLM+EM+AG     QP    P E + ED LF  IL   +  P  +S +A SILK  + K P +RL C  S   ++  + H FF+ ++W  L  +KI+PPF+P +   RD+ NFD  FT E  + TP D + I +I+Q EF+GF Y     L+
Sbjct:   54 HKFSIHNYKVPTFCDHCGSLLWGLMRQGLQCKVCKMNVHRRCESNVAPNCGVDARGIAKVLSDLGVTPDKISSSVQRRKKISQGPDPQP---------LPISPQTEEDRSKSAPTSPCDQDAKDSENIRKALSFDHRGEELKPEAPSSLNEAGAEESGEARENSEVKTLQTKRMSLEDFSFIKVLGKGSFGKVMLAELRGTDEVYAVKVLKKDVILQDDDVDCTLTEKRILALARKHPYLTQLFCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHRNGVIYRDLKLDNILLDAEGHCKLADFGMCKEGILDGITTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAG-----QP----PFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKSPNKRLGCVVSQGMEEAIKVHPFFKEIDWVLLEQRKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTPVDDAIIKQINQDEFKGFSYFGEEALS 552          
BLAST of Protein kinase C vs. Ensembl Cavefish
Match: prkcba (protein kinase C beta [Source:NCBI gene;Acc:103036012])

HSP 1 Score: 343.199 bits (879), Expect = 5.691e-108
Identity = 166/346 (47.98%), Postives = 227/346 (65.61%), Query Frame = 3
Query:  858 KIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTE 1895
            ++ L DFN + V+G+GS+ KV   E K T ++YA+K++KK+ +   DD+E    EK V   +   PFL  LHSCFQT  RL +V+E++NGGDLMY +Q+  +  E HA FYAAEIA+ L FLH + IIYRDLKLDNV++D +GH+K+ D+GMCKE +   +   TFCGTP+YIAPEI+  + YG SVDWW+ GVL++EMLAG     QP    P +   ED LF  I+   +  P+S+S +A +I KGL+ K P +RL C P     D + HAFFR ++W+ L +K++QPPF+P+    RD  NFD  FT  P + TP D+  I  +DQ EF+GF Y+NP     E
Sbjct:  335 RVKLSDFNFVMVLGKGSFGKVMLAERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTMDRLYFVMEYINGGDLMYQIQQVGKFKEPHAVFYAAEIAIGLFFLHSKGIIYRDLKLDNVMLDAEGHIKIADFGMCKENMLDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAG-----QP----PFDGEDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGE-RDIKEHAFFRYMDWEKLQNKEVQPPFKPKAC-GRDAENFDRFFTRHPPVLTPPDQEVILNLDQEEFQGFSYVNPEYAAQE 669          

HSP 2 Score: 67.781 bits (164), Expect = 2.573e-11
Identity = 31/82 (37.80%), Postives = 44/82 (53.66%), Query Frame = 3
Query:  297 PTSPG-MPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKC 539
            P +PG    +G      R+GA R K  + +  HKF A+ F +   C +C D IWG G+QG +C  C  ++HKRC + V   C
Sbjct:    4 PAAPGDAESEGGARGFARQGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSC 85          
BLAST of Protein kinase C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008480.1 (pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1 gene:ENSPMAG00000007654.1 transcript:ENSPMAT00000008480.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 286.96 bits (733), Expect = 1.806e-89
Identity = 137/324 (42.28%), Postives = 203/324 (62.65%), Query Frame = 3
Query:  852 KGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLH-RRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDK 1820
            K K+ + +F+ L ++G+G++ KV  V  K T + YAMK++KKE I   D++    TE  V +  + HPFL  L   FQT  RL +V+E+VNGG+L +H+ R+    E+  +FY AEI  AL++LH  + ++YRDLKL+N+++D DGH+K+ D+G+CKEGI       TFCGTP Y+APE+L +  YG +VDWW LGV+M+EM+ G  P+              + LF LIL + IR PR++S  A ++L GLL KDP QRL      +  +   H+FF G+ W D+ D+K+ PPF+P++  + D   FD  FT + +  TP D+
Sbjct:  142 KSKVTMNNFDYLKLLGKGTFGKVILVREKATGQYYAMKILKKEVIVAKDEVAHTLTENRVLQ-TTKHPFLTLLKYSFQTHDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHTEKNVVYRDLKLENLMLDKDGHIKIADFGLCKEGITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYN---------QDHEKLFELILMEDIRFPRTLSNDARALLSGLLKKDPKQRLGGG-VDDAKEIMRHSFFAGIIWQDVYDRKMTPPFKPQVASETDTRYFDEEFTAQTITITPPDR 454          
BLAST of Protein kinase C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006766.1 (pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 gene:ENSPMAG00000006086.1 transcript:ENSPMAT00000006766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 279.641 bits (714), Expect = 2.062e-87
Identity = 146/368 (39.67%), Postives = 219/368 (59.51%), Query Frame = 3
Query:  816 PPVDTEGGTGDRKGKIGLG----------DFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMF----TPDDKSKISKIDQS--EFEGFEYI 1871
            P   T+G   +    I LG          DF+ L V+G+GS+ KV   ++K     YA+KV+KK  I    + + +  E++V      HPFLVGLH  FQ+  +L +V+++VNGG+L +H+QR+   PE  A+FYAAEI  A+ +LH   I+YRDLK +N+L+D  GH+ LTD+G+CKEGI+      TFCGTP Y+APE+L+   Y  +VDWW LG +++EML G  P+          +N +  ++  IL +P+++    +  A S+L+GLL+KDP QRL    +S+  + +NH FF  +NW+DL  K+I  P+ P ++   DL NFDP FT EP+      + D  S  + +D++   F GF Y+
Sbjct:   62 PRNQTQGPMENDADHINLGPSANLQAKPSDFDFLTVLGKGSFGKVLLAKHKSDGIFYAVKVMKKSIILQKKEEKHIMAERNVLVKNVRHPFLVGLHYSFQSADKLYFVMDYVNGGELFFHLQRQGSFPESRAQFYAAEIGSAIGYLHSLNIVYRDLKPENILLDYQGHIVLTDFGLCKEGIDPHSTTCTFCGTPEYLAPEVLKKHPYDRTVDWWCLGCVLYEMLYGLPPFY--------SKNLKQ-MYESILHQPLQLRPCTTNAAISVLEGLLHKDPHQRLGA--TSDILEIKNHVFFSTINWNDLDAKRIPSPYNPGVSGPCDLHNFDPAFTAEPLSMSMAQSSDTSSVCANVDEAADAFVGFTYM 418          
BLAST of Protein kinase C vs. Ensembl Sea Lamprey
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 271.166 bits (692), Expect = 7.082e-83
Identity = 141/311 (45.34%), Postives = 189/311 (60.77%), Query Frame = 3
Query:  819 PVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLR--MPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPEL 1745
            P ++   +G+  GK+ L  F+LL V+G+GS+ KV   E K   K +A+K +KKE +   DD+E    EK V   A  HPFL  L   FQT   L +V+EF+ GGDLM+H+Q K +  +P    +FYAAE+   L FLH   IIYRDLKLDNVL+D +GH+K+ D+GMCKE +     ATTFCGTP+YIAPEIL   AYG SVDWWS+GVL++EML G SP+           + ED LF  I       PR +S  + +IL  L  +D T+RL         D + H FF+ ++W  L  +KI PPF+P++
Sbjct:  233 PDESTRPSGEIAGKLSLDHFHLLKVLGKGSFGKVMLAELKEQGKFFAIKALKKEVVLMGDDVECTMVEKRVLLMACEHPFLTHLCGTFQTKEHLFFVMEFLTGGDLMFHIQDKGKFDLPTGTNRFYAAEVICGLQFLHSHNIIYRDLKLDNVLLDREGHVKIADFGMCKEHVGAGNLATTFCGTPDYIAPEILLGRAYGTSVDWWSMGVLIYEMLIGQSPFYG---------SDEDELFEAIKGHTPHYPRWLSDSSRNILSCLFERDHTKRLG-----AVGDIRLHPFFKNIDWPSLEARKITPPFKPKV 529          

HSP 2 Score: 52.7582 bits (125), Expect = 2.029e-7
Identity = 28/78 (35.90%), Postives = 39/78 (50.00%), Query Frame = 3
Query:  345 RRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQI 578
            RRGA +  K   + GH F    F +   C  CK+ +WGL +QG +C  C    HKRC   V  +C    +  N Q++I
Sbjct:    2 RRGAIKQAKVKFVKGHAFVTTFFPQPTFCSVCKEFVWGLNKQGFQCKECNASSHKRCVDNVLARCTGSADT-NRQTEI 78          
BLAST of Protein kinase C vs. Ensembl Sea Lamprey
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 256.144 bits (653), Expect = 1.772e-80
Identity = 127/279 (45.52%), Postives = 177/279 (63.44%), Query Frame = 3
Query:  915 KVFQVEYKPT-KKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELT 1748
            +VF  E K   +  +A+K +KK+ +  SDD+E    EK +   A  HP+L  L+S FQT   L++V+E++NGGDLM+H+Q K R   + A FYAAEI   L FLH + IIYRDLKLDN+L+D DGH+K+ D+GMCKE I GD++A TFCGTP+YIAPEI+  + Y  SVDWWS GVL++EML G SP+           + E+ LF  I T     PR I+  +  IL  LL ++P +RL         + + H FFR +NW+ L  ++++PPF+P + 
Sbjct:    1 QVFLAELKSRPRNFFAIKALKKDVVIMSDDVECTLVEKRILSLAWGHPYLAHLYSTFQTKEHLMFVMEYLNGGDLMFHIQVKGRFEIDRATFYAAEIVSGLQFLHDQGIIYRDLKLDNILLDKDGHVKIADFGMCKENIVGDVRAGTFCGTPDYIAPEIVIGQKYNCSVDWWSFGVLLYEMLIGQSPF---------RGDDEEELFESIRTSVPYYPRWITKDSRDILPLLLEREPMKRLGVT-----GEIRQHPFFRTINWEALEKRELEPPFKPRVV 265          
BLAST of Protein kinase C vs. Ensembl Sea Lamprey
Match: sgk1 (serum/glucocorticoid regulated kinase 1 [Source:NCBI gene;Acc:324140])

HSP 1 Score: 191.045 bits (484), Expect = 3.775e-55
Identity = 118/344 (34.30%), Postives = 183/344 (53.20%), Query Frame = 3
Query:  873 DFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTP---NYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEP----VMFTPDDKSKISKIDQSE--FEGFEYINP 1877
            DF+ L ++G+GS+ KV   + K  +K YA+KV++K+ I    + + +  E++V      HPFLVGLH  FQT  +L +V++++NGG++         +     K Y  E    LN LH    I RDLK +N+L+D +GH+ LTD+G+CKEGI+ +   +TFCGTP   +    + +R++    +  W             C+ W + GQ      +  +  F    ++  R   +IS  A  +L+GLL+KD TQRL    S +F + + H FF  +NW+DL+ KKI PPF P +    DL +FDP F  EP    V  +P + +  +   ++   F GF Y  P
Sbjct:    8 DFDFLKIIGKGSFGKVLLAKLKTDEKFYAVKVLQKKAILKKKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTADKLYFVLDYINGGEVRTSTCAPCIVVHHKWKGYREEPIDELNSLHFVNQISRDLKPENILLDFEGHIILTDFGLCKEGIQPNDTTSTFCGTPEESDLTNRKEIRSQRSSRTRGW----------DLRCA-W-RAGQVTTHRPSVSEVSFVPSFSQSRRFKPNISNSARDLLEGLLHKDRTQRLGA--SGDFTEIKGHVFFSPINWEDLLSKKIVPPFNPNVNGPSDLRHFDPEFISEPVPGSVCRSPGEFAVSASFQEARDAFAGFSYAPP 337          
BLAST of Protein kinase C vs. Ensembl Yeast
Match: PKC1 (Protein serine/threonine kinase; essential for cell wall remodeling during growth; localized to sites of polarized growth and the mother-daughter bud neck; homolog of the alpha, beta, and gamma isoforms of mammalian protein kinase C (PKC) [Source:SGD;Acc:S000000201])

HSP 1 Score: 273.478 bits (698), Expect = 1.706e-79
Identity = 138/343 (40.23%), Postives = 214/343 (62.39%), Query Frame = 3
Query:  849 RKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASN--HPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYI 1871
            ++ K+ L +F LL V+G+G++ KV   + K T ++ A+KV+KK+ I  + DIE  + EK VF  A+   HPFL  L+  FQT +R+ + +EF+ GGDLM+H+Q + R+    AKFYAAE+ LAL + H   +IYRDLKL+N+L+  +GH+K+ DYG+CK+ +    + +TFCGTP ++APEIL+ + Y  +VDWW+ GVL+++ML   SP+           + ED +FN ILT     P  ++ +   I +GLL KDP +RL   P  + D+     FFR +N+DD+++ +++PP+ PE+    D + F+  FT  P   TP   S ++   Q EF GF ++
Sbjct:  815 KRRKVSLDNFVLLKVLGKGNFGKVILSKSKNTDRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYAAEVLLALKYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDEMWYGNRTSTFCGTPEFMAPEILKEQEYTKAVDWWAFGVLLYQMLLCQSPF---------SGDDEDEVFNAILTDEPLYPIDMAGEIVQIFQGLLTKDPEKRLGAGP-RDADEVMEEPFFRNINFDDILNLRVKPPYIPEIKSPEDTSYFEQEFTSAPPTLTP-LPSVLTTSQQEEFRGFSFM 1145          
BLAST of Protein kinase C vs. Ensembl Yeast
Match: YPK1 (S/T protein kinase; phosphorylates, downregulates flippase activator Fpk1p; inactivates Orm1p and Orm2p by phosphorylation in response to compromised sphingolipid synthesis; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); mutations affect receptor-mediated endocytosis and sphingolipid-mediated and cell integrity signaling pathways; human homolog SGK1 can complement a null mutant; human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000001609])

HSP 1 Score: 263.462 bits (672), Expect = 1.038e-78
Identity = 134/342 (39.18%), Postives = 208/342 (60.82%), Query Frame = 3
Query:  849 RKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDE-PVMFTPDDKSKISKIDQSEFEGFEYI 1871
            R   + + DF+LL V+G+GS+ KV QV  K T+K+YA+K I+K +I    ++     E+ V     + PF+V L   FQ+P +L +V+ F+NGG+L YH+Q++ R     A+FY AE+  AL+ LH+  ++YRDLK +N+L+D  GH+ L D+G+CK  ++ D K  TFCGTP Y+APE+L    Y  +VDWW+LGVL++EML G  P+    + +P        ++  IL +P+  P      A  +L GLL++DPT+RL    +   D+ +NH FF  L+W  L+ K   PP++P +++  D +NFD  FT E P+    D+   +S+  Q +F G+ Y+
Sbjct:  338 RNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKVYALKAIRKSYIVSKSEVTHTLAERTVL-ARVDCPFIVPLKFSFQSPEKLYFVLAFINGGELFYHLQKEGRFDLSRARFYTAELLCALDNLHKLDVVYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPPYYD--EDVPK-------MYKKILQEPLVFPDGFDRDAKDLLIGLLSRDPTRRLGYNGA---DEIRNHPFFSQLSWKRLLMKGYIPPYKPAVSNSMDTSNFDEEFTREKPIDSVVDE--YLSESVQKQFGGWTYV 664          
BLAST of Protein kinase C vs. Ensembl Yeast
Match: YPK2 (Protein kinase similar to S/T protein kinase Ypk1p; functionally redundant with YPK1 at the genetic level; participates in a signaling pathway required for optimal cell wall integrity; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000004710])

HSP 1 Score: 258.455 bits (659), Expect = 6.693e-77
Identity = 130/337 (38.58%), Postives = 205/337 (60.83%), Query Frame = 3
Query:  861 IGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYI 1871
            + + DF+LL V+G+GS+ KV QV  K T+KIYA+K ++K +I    ++     E+ V     + PF+V L   FQ+P +L  V+ F+NGG+L YH+Q + R     ++FY AE+  AL+ LH+  +IYRDLK +N+L+D  GH+ L D+G+CK  ++ + K  TFCGTP Y+APEIL  + Y  +VDWW+LG+L++EM+ G  P+    + +P        ++  IL +P+  P    P A  +L GLL++DP++RL    +   D+ +NH FF+ ++W  L+ K   PP++P +  + D  NFD  FT E  + +  D+   + I Q +F G+ YI
Sbjct:  339 LSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVL-ARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYD--ENVP-------VMYKKILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRLGVNGT---DEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPIDSVVDEYLSASI-QKQFGGWTYI 661          
BLAST of Protein kinase C vs. Ensembl Yeast
Match: SCH9 (AGC family protein kinase; functional ortholog of mammalian S6 kinase; phosphorylated by Tor1p and required for TORC1-mediated regulation of ribosome biogenesis, translation initiation, and entry into G0 phase; involved in transactivation of osmostress-responsive genes; regulates G1 progression, cAPK activity and nitrogen activation of the FGM pathway; integrates nutrient signals and stress signals from sphingolipids to regulate lifespan [Source:SGD;Acc:S000001248])

HSP 1 Score: 244.973 bits (624), Expect = 9.501e-71
Identity = 133/354 (37.57%), Postives = 211/354 (59.60%), Query Frame = 3
Query:  849 RKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVF--ECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNE-AYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSI-SPKASSILKGLLNKDPTQRLACKPSSNFDD---FQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDK-----SKISKIDQSEFEGFEYIN 1874
            +K   G  DF +L ++G+G++ +V+QV+ K T++IYAMKV+ K+ I   ++I     E+++     + + PF+VGL   FQTP+ L  V ++++GG+L +H+Q++ R  E+ AKFY AE+ LAL  LH   I+YRDLK +N+L+D +G++ L D+G+ K  ++   +  TFCGT  Y+APE+L +E  Y   VD+WSLGVL+FEM  G SP+          EN +  ++  I    ++ PR + S +  S +KGLLN++P  RL        DD    + H FF  ++W+ L  KKI PPF+P L  + D +NFDP FT     +    +     + +S   Q++F GF +++
Sbjct:  403 KKRHYGPQDFEVLRLLGKGTFGQVYQVKKKDTQRIYAMKVLSKKVIVKKNEIAHTIGERNILVTTASKSSPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQKEGRFSEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKD--RTNTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCGWSPFF--------AENNQK-MYQKIAFGKVKFPRDVLSQEGRSFVKGLLNRNPKHRLGA-----IDDGRELRAHPFFADIDWEALKQKKIPPPFKPHLVSETDTSNFDPEFTTASTSYMNKHQPMMTATPLSPAMQAKFAGFTFVD 740          
BLAST of Protein kinase C vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 214.157 bits (544), Expect = 3.033e-63
Identity = 113/311 (36.33%), Postives = 177/311 (56.91%), Query Frame = 3
Query:  846 DRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDR-DLTNFD 1775
            D  GK  L DF +L  +G GS+ +V  +      + YA+K +KK  I     +E    E+ +    S HPF++ +   FQ   ++  V++++ GG+L   +++  R P   AKFYAAE+ LAL +LH + IIYRDLK +N+L+D +GH+K+TD+G  K     D+   T CGTP+YIAPE++  + Y  SVDWWS GVL++EMLAG +P+           NT     N IL   ++ P    P A  +LK L+ +D ++RL    + + +D +NH +F  + W+ L+ + I+ P+ P +   + D + FD
Sbjct:   78 DTSGKYSLSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVS-HPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAK--YVPDV-TYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYN--------SNTMKTYEN-ILNAELKFPPFFHPDAQDLLKKLITRDLSERLGNLQNGS-EDVKNHPWFNEVIWEKLLARYIETPYEPPIQQGQGDTSQFD 374          
BLAST of Protein kinase C vs. Ensembl Nematostella
Match: EDO44938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU22])

HSP 1 Score: 496.508 bits (1277), Expect = 3.595e-169
Identity = 231/348 (66.38%), Postives = 280/348 (80.46%), Query Frame = 3
Query:  861 IGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            I + DFNL+ V+GRGSYAKV  VE K TK+IYAMKV+KKE + D +DI+WVQTEKHVFE ASNHPFLVGLHSCFQT SRL +VIE+V+GGDLMYHMQR+ R+PE+HA+FY+AEI  ALNFLH + +IYRDLKLDNVL+D+DGH+KLTDYGMCKEGI      +TFCGTPNYIAPEILR E YG SVDWW+LGVL++EMLAG SP+   G    P++NTEDYLF +IL KPIRIPRS+S KA+SILKG LNK+PT+RL C P + F D  +HAFFR ++W+ L  +++ PPF+P       L NFDP FT+E V FTPDD   +  IDQ+EFEGFEYINPLL++ E++V
Sbjct:  217 ISVNDFNLIRVIGRGSYAKVMLVELKKTKRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTSSRLFFVIEYVSGGDLMYHMQRQRRLPEDHARFYSAEICCALNFLHEKGVIYRDLKLDNVLLDSDGHIKLTDYGMCKEGIRPGDVTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLLYEMLAGRSPFDIVGSADNPDQNTEDYLFQVILEKPIRIPRSLSVKAASILKGYLNKNPTERLGCHPQTGFADITSHAFFRTVSWEQLEARQVTPPFKPRQEDPYGLENFDPQFTNEDVQFTPDDPKMLETIDQTEFEGFEYINPLLMSVEDSV 564          

HSP 2 Score: 181.03 bits (458), Expect = 3.404e-49
Identity = 75/175 (42.86%), Postives = 116/175 (66.29%), Query Frame = 3
Query:   27 MHESALIKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDF 551
            M+ ++ I ++  Y  +     ++  ++ D    ++  I        FT+KW+D+EGDPCTI++Q EL+EAIRLYE N+D+E+++H+F   P  PG  C GE   +YRRGAKRW+K + + GH F AKRF++ A C +C DRIWGLG+ G +C  C+L++HK+C +L+K +CG+  
Sbjct:    2 MNSTSAIAVRAAYNGDIMCLSMDPHISLDTFTEDMKDIFKFRKEQTFTLKWLDEEGDPCTISSQEELNEAIRLYEINRDSELVVHLFLGEPQYPGQLCNGETRNIYRRGAKRWRKIHIVNGHSFVAKRFSRLAACAFCSDRIWGLGRSGYKCLECKLVVHKKCHKLIKIQCGQQL 176          
BLAST of Protein kinase C vs. Ensembl Nematostella
Match: EDO35585 (Protein kinase C [Source:UniProtKB/TrEMBL;Acc:A7SL27])

HSP 1 Score: 369.392 bits (947), Expect = 5.501e-118
Identity = 199/503 (39.56%), Postives = 290/503 (57.65%), Query Frame = 3
Query:  390 HKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAI---QRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKG----KIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINP 1877
            HKF  K +N+   C  C   ++G+ +QG++C  C++ +H+RC Q V + CG +   P   ++I   + I   +   E+  I+ P ++  +N                 K   + +   V+      + + N     +  L    + P       G+R+     K+ L DF  + V+G+GS+ KV   E K T ++YA+K++KKE +   DD+E    E+ V   ++ HPFL  LHS FQT  RL +V+E+VNGGDLM+ +Q+  +  E  ++FYAAE+ LAL FLH+  +IYRDLKLDNVL+D DGH+KL D+GMCKE +      TTFCGTP+YIAPEIL+ + YG SVDWW+LGVLM+EM+AG  P+          EN ED LF  IL   +  P  +S +A SILKG + K+  +RL C P+S     + HAFFR +N++ L  ++I PPF+P++    D+ NFD  FT E    TP D++ I  IDQ EF GF ++NP
Sbjct:  241 HKFEKKSYNRPTFCELCGSLLYGIVRQGMQCTVCKMNVHRRCHQNVANNCGIN---PKKMAEILEEIGISPDRIHEESQQIKKPSFHDCTN-----------------KPAKKMTPRSVSSPSMMESVNENGLPGSTFKLESHQTSP-------GERRRHVLRKMTLKDFTFIKVLGKGSFGKVLLAERKGTDEVYAIKILKKESVLQDDDVECTMIERRVLALSAGHPFLTSLHSSFQTVERLFFVMEYVNGGDLMFQIQKSRKFDENRSRFYAAEVVLALQFLHQNGVIYRDLKLDNVLLDADGHIKLADFGMCKENMAPGKTTTTFCGTPDYIAPEILQEQPYGFSVDWWALGVLMYEMMAGQPPF--------EAENEED-LFESILHDDVLYPVWLSREAVSILKGFMTKNYLKRLGCTPTSTESSIREHAFFRLINFEKLEARQINPPFKPKIRSRTDVGNFDTDFTKEEPKLTPTDRNVIVNIDQREFRGFSFVNP 707          

HSP 2 Score: 53.5286 bits (127), Expect = 2.299e-7
Identity = 22/56 (39.29%), Postives = 33/56 (58.93%), Query Frame = 3
Query:  375 YHLYGHKFSAKRFNKYAECFYCKDRIWG-LGQQGLRCGTCRLLLHKRCQQLVKHKC 539
            + +  HKF A    +   C +C D IWG +G+QG +C  C  ++HKRC ++V  KC
Sbjct:  161 HQINSHKFMATYLRQPTFCSHCNDFIWGVIGKQGYQCQVCTCVVHKRCHKMVVTKC 216          
BLAST of Protein kinase C vs. Ensembl Nematostella
Match: EDO37800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEW2])

HSP 1 Score: 293.893 bits (751), Expect = 9.007e-93
Identity = 148/341 (43.40%), Postives = 214/341 (62.76%), Query Frame = 3
Query:  873 DFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEP----VMFTPDDKSKISKIDQSE--FEGFEYINP 1877
            DF  L V+G+GS+ KVF  + K   K YA+KV+ K  I   ++ + +  E++V      HPFLVGLH  FQT  +L +V+++VNGG+L +H+QR+   PE  A+FYAAEIA A+ +LH   IIYRDLK +N+L+D+ GH+ LTD+G+CKEGI+     +TFCGTP Y+APE+LR + Y  SVDWW LG +++EM+ G  P+          +  E  +++ IL KP+R+  +IS  A  IL+GLL KD T+RL      +F+D + H+FFR +NW  LV + I+PP+ P ++   DL +FDP F  EP    V  + D     + +D  +  F GF Y+ P
Sbjct:   73 DFLFLKVIGKGSFGKVFLSKNKQEDKFYAIKVLNKSAIRKRNEAKHIMAERNVLVQNVTHPFLVGLHYSFQTKDKLYFVLDYVNGGELFFHLQRERYFPESRARFYAAEIASAIGYLHGLQIIYRDLKPENILLDSKGHIVLTDFGLCKEGIDRSGTTSTFCGTPEYLAPEVLRKQDYDKSVDWWCLGAVLYEMMYGLPPFYS-------RDTAE--MYDNILHKPLRLRTNISQSARHILEGLLQKDKTKRLGSG-EGDFEDIRTHSFFRSINWQQLVARGIEPPYNPNVSGQLDLKHFDPEFVREPVPGSVGKSADSNFVSASVDDPDDAFVGFTYVAP 403          
BLAST of Protein kinase C vs. Ensembl Nematostella
Match: EDO41166 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S521])

HSP 1 Score: 261.151 bits (666), Expect = 3.168e-80
Identity = 137/349 (39.26%), Postives = 214/349 (61.32%), Query Frame = 3
Query:  858 KIGLGDFNLLCVVGRGSYAKVFQVEYK---PTKKIYAMKVIKKEFITDSD-DIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTT 1892
            K+G   F LL V+G+G Y KVF V+       +KI+AMKV+KK  I  S  D    + E+++ EC   HPF+V L   FQT  +L  ++E+++GG+L   ++R+    E+ A FY +EI++AL  LH++ I+YRDLK +N+L+D +GH+KLTD+G+CKE I  +    TFCGT  Y+APEIL    +G +VDWWSLG LM++ML G  P+           +      + IL   + IP  ++P+A   ++ LL + P  RL    + + +  + H+FFR + W+DL+ KK++PPFRP ++ + D++ FD  FT +  + +PDD S +S+   + F+GF Y+ P +L +
Sbjct:   59 KVGPESFELLKVLGKGGYGKVFLVKKNHGHSKEKIFAMKVLKKAAIIRSQKDTAHTKAERNILECV-KHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFLEDTACFYLSEISMALEHLHKQGIVYRDLKPENILLDANGHVKLTDFGLCKESIFENSLTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMYDMLTGTPPFCA---------DNRKKTIDKILKGKLIIPPYLTPEAKDFIRKLLKRHPQARLGGM-AGDANPIKAHSFFRHICWEDLLAKKVEPPFRPSISGEEDVSQFDSKFTRQTPVDSPDD-SMLSESASNIFQGFTYVAPSVLES 395          
BLAST of Protein kinase C vs. Ensembl Nematostella
Match: EDO39163 (Ribosomal protein S6 kinase [Source:UniProtKB/TrEMBL;Acc:A7SAZ2])

HSP 1 Score: 251.521 bits (641), Expect = 2.933e-73
Identity = 132/354 (37.29%), Postives = 209/354 (59.04%), Query Frame = 3
Query:  858 KIGLGDFNLLCVVGRGSYAKVFQVEYKPTK---KIYAMKVIKKEFITD-SDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKE--GIEGDIKATTFCGTPNYIAPEILRNEAYG--ASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTE 1895
            K+G+ +F LL V+G G+Y KVF    +      +++AMKV+KK  I   +   E  +TE+ V E     PFLV LH  FQT ++L  ++++VNGG+L  H+ ++ +  E+  + Y  EI +AL+ LH+  IIYRD+KL+N+L+D DGH+ LTD+G+ KE        +A +FCGT  Y+APE+++  + G   +VDWWSLGVLM+E+L G SP+   G     E+N++  +   IL     +P  +S +A  +L  LL KDP +RL  K +    + + H FF+  +W DL +K+I  PF+P +  + D++NF   FTD    ++P   + + K     F G+ ++ P ++  E
Sbjct:   10 KVGIENFELLRVLGTGAYGKVFLARKRGGHHDGRLFAMKVLKKATIVQKAKTAEHTRTERQVLEAVRRCPFLVTLHWAFQTEAKLHLIMDYVNGGELFTHLYQREKFTEDEVRLYIGEIVVALDHLHQLGIIYRDIKLENILLDKDGHVVLTDFGLSKEFAAPNSGERAYSFCGTIEYMAPEVVKGGSRGHDKAVDWWSLGVLMYELLTGASPFTVDG-----EKNSQSEISKRILHNNPPMPHDLSAEAIDLLHKLLQKDPKKRLGAKGAH---ELKAHPFFKAFDWADLAEKRIPAPFKPRIRDELDVSNFSEEFTDMAPTYSP---AAVPKTADRVFRGYSFVAPSIIFGE 352          

HSP 2 Score: 119.783 bits (299), Expect = 5.100e-28
Identity = 80/261 (30.65%), Postives = 135/261 (51.72%), Query Frame = 3
Query:  891 VVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVL-MDN--DGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEIL----RNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIP----RSISPKASSILKGLLNKDPTQRLACK 1640
            V+G GS++   +  +  + + YA+K+I +      D    VQ+ K        HP +V L+  +Q       V+E + GG+L+  +++K    E  A     +I  A+ F+H+R +++RDLK +N+L +DN  D  +K+ D+G      E   +  T C T +Y APE+L     N  Y  S D WSLGV+++ ML+G  P+   G      +++  ++   I    +R      +SISP+A  +++GLL  DP+QRL  +
Sbjct:  401 VLGDGSFSTCRRCVHLRSGQEYAVKIISRR----CDHTREVQSLK----MCHGHPNIVTLYDVYQDEFHTYLVMELLAGGELLERIRKKKMFTESAASVIMRKIVSAVEFMHQRGVVHRDLKPENLLFVDNSEDAEIKIVDFGFACVKPEAQ-QLQTPCFTLSYAAPEVLDQTVSNSGYDESCDLWSLGVILYTMLSGQVPFQSSGSWY---KSSTGFVMQRITQGDVRFDGQQWQSISPQAKDLIQGLLTVDPSQRLTVQ 649          
BLAST of Protein kinase C vs. Ensembl Medaka
Match: prkcz (protein kinase C zeta [Source:NCBI gene;Acc:101164401])

HSP 1 Score: 665.996 bits (1717), Expect = 0.000e+0
Identity = 328/624 (52.56%), Postives = 423/624 (67.79%), Query Frame = 3
Query:   36 SALIKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKG-KIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            S ++K+K  +  +  IT + ASVT+ QL  E+  +C +      T+KWIDDEGDPCTI++QMELDEA R+Y   + + +++HVFPS+P  PG+PC GED  +YRRGA+RW+K Y + GH F AKRFN+ A C +C +RIWGLG QG +C TC+LL+HKRC +L+   C         QS +   M  Q    +   E         +D P D  E+  Q+  + H+        A                    +      VD   G    +G  + L DF L+ V+GRGSYAKV  V  K  ++++AMKV+KKE + D +DI+WVQTEKHVFE AS +PFLVGLHSCFQT SRL  VIE+VNGGDLM+HMQR+ ++PEEHA+FYAAEI +ALNFLH + IIYRDLKLDNVL+D++GH+KLTDYGMCKEGI      +TFCGTPNYIAPEILR E YG SVDWW+LGVLMFEM+AG SP+        P+ NTE+YLF +IL KPIRIPRS+S KA+S+LKG LNKDP +RL C+  + F D ++H FFR ++W  L  K++ PPF+P+++ +  L NFD  FT+EPV  TPDD+  I +IDQSEFEGFEYINPLLLTTEE++
Sbjct:   15 SKVVKIKAHFRGDMLITDLPASVTFLQLCAEVKSMCSVAKQQPITLKWIDDEGDPCTISSQMELDEAFRIYSRTRRSGLLLHVFPSIPERPGLPCPGEDKSIYRRGARRWRKLYRVNGHLFQAKRFNRKAYCGHCAERIWGLGTQGYKCITCKLLVHKRCHRLLPQTC---------QSLMDPVMPSQEPLSDAQSEE--------VDPPADDTEDADQIPFLPHNCVEEKTEDA-------------------ETEDIKAVVDGLDGIKLSQGVTLKLSDFELIRVIGRGSYAKVLLVRLKKNEQVFAMKVVKKELVHDDEDIDWVQTEKHVFEQASTNPFLVGLHSCFQTDSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHEKGIIYRDLKLDNVLLDHEGHIKLTDYGMCKEGIRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIITDN--PDMNTEEYLFQVILEKPIRIPRSLSVKAASVLKGFLNKDPKERLGCQVQTGFTDIKSHTFFRSIDWQQLEKKEMTPPFKPQISDEFGLENFDTQFTNEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLTTEESI 600          
BLAST of Protein kinase C vs. Ensembl Medaka
Match: prkcz (protein kinase C zeta [Source:NCBI gene;Acc:101164401])

HSP 1 Score: 658.677 bits (1698), Expect = 0.000e+0
Identity = 325/609 (53.37%), Postives = 413/609 (67.82%), Query Frame = 3
Query:   81 ITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKG-KIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            IT + ASVT+ QL  E+  +C +      T+KWIDDEGDPCTI++QMELDEA R+Y   + + +++HVFPS+P  PG+PC GED  +YRRGA+RW+K Y + GH F AKRFN+ A C +C +RIWGLG QG +C TC+LL+HKRC +L+   C         QS +   M  Q    +   E         +D P D  E+  Q +   H+L                                   VD   G    +G  + L DF L+ V+GRGSYAKV  V  K  ++++AMKV+KKE + D +DI+WVQTEKHVFE AS +PFLVGLHSCFQT SRL  VIE+VNGGDLM+HMQR+ ++PEEHA+FYAAEI +ALNFLH + IIYRDLKLDNVL+D++GH+KLTDYGMCKEGI      +TFCGTPNYIAPEILR E YG SVDWW+LGVLMFEM+AG SP+        P+ NTE+YLF +IL KPIRIPRS+S KA+S+LKG LNKDP +RL C+  + F D ++H FFR ++W  L  K++ PPF+P+++ +  L NFD  FT+EPV  TPDD+  I +IDQSEFEGFEYINPLLLTTEE++
Sbjct:   39 ITDLPASVTFLQLCAEVKSMCSVAKQQPITLKWIDDEGDPCTISSQMELDEAFRIYSRTRRSGLLLHVFPSIPERPGLPCPGEDKSIYRRGARRWRKLYRVNGHLFQAKRFNRKAYCGHCAERIWGLGTQGYKCITCKLLVHKRCHRLLPQTC---------QSLMDPVMPSQEPLSDAQSEE--------VDPPADDTEDADQSETQHHNL-----------------------------------VDGLDGIKLSQGVTLKLSDFELIRVIGRGSYAKVLLVRLKKNEQVFAMKVVKKELVHDDEDIDWVQTEKHVFEQASTNPFLVGLHSCFQTDSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHEKGIIYRDLKLDNVLLDHEGHIKLTDYGMCKEGIRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIITDN--PDMNTEEYLFQVILEKPIRIPRSLSVKAASVLKGFLNKDPKERLGCQVQTGFTDIKSHTFFRSIDWQQLEKKEMTPPFKPQISDEFGLENFDTQFTNEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLTTEESI 593          
BLAST of Protein kinase C vs. Ensembl Medaka
Match: prkci (protein kinase C iota [Source:NCBI gene;Acc:101165764])

HSP 1 Score: 504.212 bits (1297), Expect = 6.489e-172
Identity = 232/355 (65.35%), Postives = 283/355 (79.72%), Query Frame = 3
Query:  840 TGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
             G     +GL DF+LL V+GRGSYAKV  V+ K T++IYAMKV+KKE + D +DI+WVQTEKHVFE ASNHPFLVGLHSCFQT SRL +VIE+VNGGDLM+HMQR+ ++PEEHA+FY+AEI+LALN+LH R IIYRDLKLDNVL+D++GH+KLTDYGMCKEG+      +TFCGTPNYIAPEILR E YG SVDWW+LGVLMFEM+AG SP+   G    P++NTEDYLF +IL K IRIPRS+S KA+S+LKG LNKDP +RL C P + F D   H FFR ++WD L  K++ PPF+P ++ +  L NFD  FT+EP+  TPDD+  + KIDQSEFEGFEYINPLL++ EE V
Sbjct:  200 AGKSPSSLGLADFDLLRVIGRGSYAKVLLVQLKKTERIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILNKQIRIPRSLSVKAASVLKGFLNKDPKERLGCHPQTGFADITGHPFFRNVDWDLLQQKQVVPPFKPNISGEFGLDNFDAQFTNEPIQLTPDDEDVVKKIDQSEFEGFEYINPLLMSAEECV 554          

HSP 2 Score: 179.489 bits (454), Expect = 2.731e-48
Identity = 77/169 (45.56%), Postives = 113/169 (66.86%), Query Frame = 3
Query:   36 SALIKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCG 542
            S  +++K  Y  +  IT    S++Y+ L  E+  +C + +   FTMKWID+EGDPCT+++Q+EL+EA+RLYE NKD+E+++H                ++ +YRRGA+RW+K Y+  GH F AKRFN+ A C  C DRIWGLG+QG +C  C+LL+HK+C +LV  +CG
Sbjct:   16 SHQVRVKAYYKGDIMITHFEPSISYEGLSGEVRDMCSMENDQLFTMKWIDEEGDPCTVSSQLELEEALRLYELNKDSELIIH--------------AAEVSIYRRGARRWRKLYYASGHVFQAKRFNRRAHCAICSDRIWGLGRQGYKCINCKLLVHKKCHKLVTMECG 170          
BLAST of Protein kinase C vs. Ensembl Medaka
Match: prkceb (protein kinase C epsilon type [Source:NCBI gene;Acc:101172355])

HSP 1 Score: 357.451 bits (916), Expect = 1.940e-112
Identity = 200/527 (37.95%), Postives = 301/527 (57.12%), Query Frame = 3
Query:  390 HKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDF------------------NLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHR------VAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGG--TGDRKG-------KIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDD-FQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEY 1868
            H FS   F     C +C   +WGL +QGL+C  C++ +H+RC+  V   CG D                   N    + ++      Q++      E+     +S    P D  +++ ++++I+  L + DHR      + ++  ++ A+    ++   G +  +S   D EG    G+ KG       ++ L DF  + V+G+GS+ KV   E K T +++A+KV+KK+ I   DD++   TEK +   A  HP+L  L+ CFQT  RL +V+E+VNGGDLM+ +QR  +  E  ++FYAAE+  AL FLHR  ++YRDLKLDN+L+D +GH KL D+GMCKEGI   +  TTFCGTP+YIAPEIL+   YG SVDWW+LGVLM+EM+AG     QP    P E + ED LF  IL   +  P  +S +A SIL+  + K P++RL C  +   ++  + H FFR ++W  L ++K++PPF+P +   RD+ NFD  FT E  + TP D + + +I+Q EF+GF Y
Sbjct:  245 HMFSIHNFKVLTFCDHCGSLLWGLLRQGLQCKVCKVNVHRRCESNVAPNCGVDARGIAKVLSDLGVTPDKISNSAQRRKKLPQTQDAQQSLSEAQTEDD--RSKSAPTSPCD--QDVKELENIRKAL-SFDHRGEELTTLPLSSSSSIATVTCDTHEGEGGAEENSAGGDAEGSQENGEVKGPSAPETKRMNLHDFVFIKVLGKGSFGKVMLAELKGTDEVFAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEARSRFYAAEVTSALMFLHRHGVVYRDLKLDNILLDAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELDYGPSVDWWALGVLMYEMMAG-----QP----PFEADNEDDLFESILHDDVLYPVWLSKEAVSILRAFMTKSPSKRLGCVAAQGLEEAIKVHPFFREIDWTLLEERKVKPPFKPRIKTKRDVNNFDQDFTREEPVLTPVDDTIVKQINQDEFKGFSY 757          

HSP 2 Score: 62.3882 bits (150), Expect = 1.232e-9
Identity = 28/67 (41.79%), Postives = 42/67 (62.69%), Query Frame = 3
Query:  345 RRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWG-LGQQGLRCGTCRLLLHKRCQQLVKHKCG 542
            R+GA R ++ + + GHKF A    +   C +C+D IWG LG+QG +C  C  ++HKRC +L+  KC 
Sbjct:  156 RQGAVR-RRVHQVNGHKFMATYLRQPTYCSHCRDFIWGVLGKQGYQCQVCTCVVHKRCHELIITKCA 221          
BLAST of Protein kinase C vs. Ensembl Medaka
Match: prkcha (protein kinase C eta [Source:NCBI gene;Acc:101158986])

HSP 1 Score: 354.369 bits (908), Expect = 3.835e-112
Identity = 192/500 (38.40%), Postives = 275/500 (55.00%), Query Frame = 3
Query:  390 HKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFD-DFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLL 1886
            HKF+   +     C +C   +WG+ +QGL C  C++ +H RCQ  V   CG +            ++ +  T    G++  G    + I            VK+  +  ++   RV+   R +T                      T   +  +  ++G+ +F  L V+G+GS+ KV   +    ++++A+KV+KK+ I   DD+E   TEK V   A  HP+L  L+ CFQTP RL +V+EFVNGGDLM+H+Q+  +  E  A+FY AEI  AL FLH + IIYRDLKLDNVL+D DGH KL D+GMCKE I       TFCGTP+YIAPEIL+   YGASVDWW+LGVL++EML+G +P+         E   ED LF  IL + I     +S +A  ILK LL K+P +RL C  +   +    +H FF G++W+ L +++++PPF+P +    D+ NFDP FT E    TP D   I  ++Q EF  F + +P LL
Sbjct:  241 HKFNHHNYKSPTFCDHCGSLLWGIVRQGLHCKICKMNVHIRCQGNVAPNCGVN------------SVELANTLAEMGLQAGGLSKRNTI------------VKNATNS-QSEKQRVSSERREST----------------------TSTESRQQMPRLGISNFTFLQVLGKGSFGKVMLAKLNGKERVFAVKVLKKDIILQDDDVECTMTEKRVLSLARCHPYLTELYCCFQTPDRLFFVMEFVNGGDLMFHIQKSRKFDEPRARFYTAEITSALMFLHSKGIIYRDLKLDNVLLDQDGHCKLADFGMCKENIFEGAATGTFCGTPDYIAPEILQEMMYGASVDWWALGVLLYEMLSGHAPF---------EAENEDDLFESILNEEIVYASWLSTEAVDILKALLTKNPARRLGCVAAEGGECAVTSHVFFTGIDWEKLNNREMEPPFKPRIKTPEDVNNFDPDFTHEEPTLTPIDGPVIPSVNQEEFRNFSFTSPELL 684          

HSP 2 Score: 61.6178 bits (148), Expect = 1.953e-9
Identity = 28/66 (42.42%), Postives = 42/66 (63.64%), Query Frame = 3
Query:  345 RRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGL-GQQGLRCGTCRLLLHKRCQQLVKHKC 539
            R+GA R ++ + + GHKF +    +   CF+CK+ IWG+ G+QG +C  C  ++HKRC QLV   C
Sbjct:  155 RQGAVR-RRIHQVNGHKFMSTFLRQPTFCFHCKEFIWGVFGKQGYQCQICTCVVHKRCHQLVVTVC 219          
BLAST of Protein kinase C vs. Planmine SMEST
Match: SMESG000037135.1 (SMESG000037135.1)

HSP 1 Score: 1261.9 bits (3264), Expect = 0.000e+0
Identity = 625/627 (99.68%), Postives = 626/627 (99.84%), Query Frame = 3
Query:   27 MHESALIKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENG-GIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            MHESALIKLKIIYMSEATITQINAS+TYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENG GIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRANTASGNASSNGSGGLSLLSSPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV
Sbjct:    1 MHESALIKLKIIYMSEATITQINASITYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENGAGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRANTASGNASSNGSGGLSLLSSPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 627          
BLAST of Protein kinase C vs. Planmine SMEST
Match: SMESG000037135.1 (SMESG000037135.1)

HSP 1 Score: 1234.55 bits (3193), Expect = 0.000e+0
Identity = 612/614 (99.67%), Postives = 613/614 (99.84%), Query Frame = 3
Query:   66 MSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENG-GIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            MSEATITQINAS+TYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENG GIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRANTASGNASSNGSGGLSLLSSPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV
Sbjct:    1 MSEATITQINASITYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENGAGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRANTASGNASSNGSGGLSLLSSPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 614          
BLAST of Protein kinase C vs. Planmine SMEST
Match: SMESG000037135.1 (SMESG000037135.1)

HSP 1 Score: 1064.68 bits (2752), Expect = 0.000e+0
Identity = 526/628 (83.76%), Postives = 542/628 (86.31%), Query Frame = 3
Query:   21 MKMHESALIKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            MKMHESALIKLKIIYMSEATITQINAS+TYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGT        C+ L+  +C +              +   +  E+  + N    ++SN+                    R +++   +                        PPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV
Sbjct:    1 MKMHESALIKLKIIYMSEATITQINASITYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGT--------CRLLLHKRCQQ--------------LVKHKCGEDFNLPNYQSQIKSNMAIQ-----------------RTAENGAGIE----------------NPGYYVEPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 573          
BLAST of Protein kinase C vs. Planmine SMEST
Match: SMESG000037135.1 (SMESG000037135.1)

HSP 1 Score: 1040.02 bits (2688), Expect = 0.000e+0
Identity = 514/613 (83.85%), Postives = 531/613 (86.62%), Query Frame = 3
Query:   66 MSEATITQINASVTYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 1904
            MSEATITQINAS+TYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRL        L+  +C +              +   +  E+  + N    ++SN+   +    E G +++  + +                                 PPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV
Sbjct:    1 MSEATITQINASITYDQLRYEIHQICDLPDVSNFTMKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPCQGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRL--------LLHKRCQQ--------------LVKHKCGEDFNLPNYQSQIKSNM--AIQRTAENGGIENPGYYVE--------------------------------PPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKSKISKIDQSEFEGFEYINPLLLTTEEAV 557          
BLAST of Protein kinase C vs. Planmine SMEST
Match: SMESG000042308.1 (SMESG000042308.1)

HSP 1 Score: 348.206 bits (892), Expect = 4.365e-109
Identity = 196/524 (37.40%), Postives = 284/524 (54.20%), Query Frame = 3
Query:  339 VYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKS----------NMAIQRTAENGGIENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRXXXXXXXXXXXXXXXXXXXXXPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKVFQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGLHSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNFLHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPNYIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTEDYLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDD-FQNHAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDKS-KISKIDQSEFEGFEYIN 1874
             Y     +  +F     HKF    F + A C +C   ++GL +QGL+C  C+L +HKRC++ V   CG   N  +    IK           N   +RT+ +  I +     + + D P+         + +   +        + +         +S       ++S  P   +   GD      L DFN + V+G+GS+ KV   E+K T  +YA+K++KKE I   +D+E   TE+ +   A+ HPFL  LHS FQT  RL +V+E+VNGGDLM+ +QR  R  E  A FY++E+ LAL FLH+  IIYRDLKLDN+L+D +GH KL D+GMCKEG+ G    +TFCGTP+YIAPEIL  + YG SVDWW+LGVLM+EM+AG  P+         E +TE  LFN I    +  P S+ P +  I+   L K+P +RL C            H FFR ++W  L +++I+PPFRP++    D +NFD  FT E  + TP + S +I+ + +  F GF++ N
Sbjct:  226 TYSSSEAQLNRFNINVPHKFRVHTFMRPAFCDHCGSLLFGLMRQGLQCEACKLNIHKRCEKNVAPHCG--VNTKDLVEAIKKCGLNPLDLGYNPRYERTSTSANITDS---TQKSSDLPI-------HERSLSSPIPTHPDNYPITIEPVNKCLVLNSGDRSSKRVISHRPSSLQE-YGDTPKVPCLSDFNFVKVLGKGSFGKVILAEHKSTCDVYAIKILKKEVILQDEDVECTMTEQRILALAAKHPFLTALHSSFQTDDRLFFVMEYVNGGDLMFQIQRVRRFDEPRACFYSSEVTLALMFLHKHGIIYRDLKLDNILLDAEGHCKLADFGMCKEGMSGSKLTSTFCGTPDYIAPEILAEQDYGFSVDWWALGVLMYEMMAGAPPF---------EGDTEQDLFNAISYDSVSFPSSLQPASVDIVSKFLIKNPLKRLGCVAHEGGQQAIMRHPFFREIDWVLLEERRIRPPFRPKVRSRTDTSNFDKDFTSEDPVLTPIENSCEIAALGKDVFAGFDFFN 727          

HSP 2 Score: 62.003 bits (149), Expect = 1.375e-9
Identity = 28/68 (41.18%), Postives = 38/68 (55.88%), Query Frame = 3
Query:  336 KVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQGLRCGTCRLLLHKRCQQLVKHKC 539
            K YR GA R ++ + + GHKF    F ++  C  C   IWGL  QG +C  C  ++HKRC Q V  +C
Sbjct:  154 KHYRAGALR-RRIHQIKGHKFQVTLFKQFTFCSLCNSFIWGLWNQGYQCQVCTCVVHKRCYQNVIVRC 220          
The following BLAST results are available for this feature:
BLAST of Protein kinase C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRKCI0.000e+052.87protein kinase C iota [Source:HGNC Symbol;Acc:HGNC... [more]
PRKCZ0.000e+053.37protein kinase C zeta [Source:HGNC Symbol;Acc:HGNC... [more]
PRKCZ0.000e+055.01protein kinase C zeta [Source:HGNC Symbol;Acc:HGNC... [more]
PRKCZ4.163e-17065.56protein kinase C zeta [Source:HGNC Symbol;Acc:HGNC... [more]
PRKCZ9.738e-13866.10protein kinase C zeta [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkc-31.008e-15462.12Protein kinase C-like 3 [Source:UniProtKB/Swiss-P... [more]
pkc-11.434e-11339.56Protein kinase C-like 1B [Source:UniProtKB/Swiss-... [more]
pkc-15.167e-11139.36Protein kinase C-like 1B [Source:UniProtKB/Swiss-... [more]
pkc-11.927e-11039.36Protein kinase C-like 1B [Source:UniProtKB/Swiss-... [more]
pkc-21.567e-10650.44Protein kinase C-like 2 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aPKC8.005e-16966.48gene:FBgn0261854 transcript:FBtr0303432[more]
aPKC1.297e-16866.86gene:FBgn0261854 transcript:FBtr0303433[more]
aPKC1.627e-16866.86gene:FBgn0261854 transcript:FBtr0329888[more]
aPKC1.379e-16766.48gene:FBgn0261854 transcript:FBtr0329890[more]
aPKC1.933e-16766.86gene:FBgn0261854 transcript:FBtr0303434[more]
back to top
BLAST of Protein kinase C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkci0.000e+052.90protein kinase C, iota [Source:NCBI gene;Acc:11750... [more]
prkcz0.000e+052.56protein kinase C, zeta [Source:ZFIN;Acc:ZDB-GENE-0... [more]
prkcz0.000e+052.56protein kinase C, zeta [Source:ZFIN;Acc:ZDB-GENE-0... [more]
prkcea3.130e-11237.71protein kinase C, epsilon a [Source:ZFIN;Acc:ZDB-G... [more]
prkceb6.478e-11237.71protein kinase C, epsilon b [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkcz0.000e+053.10protein kinase C zeta [Source:NCBI gene;Acc:100101... [more]
zfhx40.000e+051.76zinc finger homeobox 4 [Source:Xenbase;Acc:XB-GENE... [more]
prkcz0.000e+053.03protein kinase C zeta [Source:NCBI gene;Acc:100101... [more]
prkcz0.000e+053.61protein kinase C zeta [Source:NCBI gene;Acc:100101... [more]
prkcz0.000e+053.61protein kinase C zeta [Source:NCBI gene;Acc:100101... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prkci0.000e+052.97protein kinase C, iota [Source:MGI Symbol;Acc:MGI:... [more]
Prkcz0.000e+053.22protein kinase C, zeta [Source:MGI Symbol;Acc:MGI:... [more]
Prkcz2.349e-16965.29protein kinase C, zeta [Source:MGI Symbol;Acc:MGI:... [more]
Prkch6.500e-11537.45protein kinase C, eta [Source:MGI Symbol;Acc:MGI:9... [more]
Prkce7.464e-11539.96protein kinase C, epsilon [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Protein kinase C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P41743|KPCI_HUMAN0.000e+052.87Protein kinase C iota type OS=Homo sapiens OX=9606... [more]
sp|Q5R4K9|KPCI_PONAB0.000e+052.87Protein kinase C iota type OS=Pongo abelii OX=9601... [more]
sp|Q62074|KPCI_MOUSE0.000e+052.97Protein kinase C iota type OS=Mus musculus OX=1009... [more]
sp|F1M7Y5|KPCI_RAT0.000e+052.97Protein kinase C iota type OS=Rattus norvegicus OX... [more]
sp|Q90XF2|KPCI_DANRE0.000e+052.90Protein kinase C iota type OS=Danio rerio OX=7955 ... [more]
back to top
BLAST of Protein kinase C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504Y6V30.000e+053.28Protein kinase C OS=Fasciola gigantica OX=46835 GN... [more]
A0A4E0R5500.000e+053.13Protein kinase C OS=Fasciola hepatica OX=6192 GN=D... [more]
A0A1B6DB110.000e+055.91Protein kinase C OS=Clastoptera arizonana OX=38151... [more]
A0A564YUI60.000e+056.92Protein kinase C OS=Hymenolepis diminuta OX=6216 G... [more]
A0A5K3FGB90.000e+056.84Protein kinase C OS=Mesocestoides corti OX=53468 P... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkcz8.481e-16666.38protein kinase C zeta type [Source:NCBI gene;Acc:1... [more]
prkcz1.203e-16566.38protein kinase C zeta type [Source:NCBI gene;Acc:1... [more]
prkci2.157e-16364.69protein kinase C, iota [Source:NCBI gene;Acc:11750... [more]
prkceb1.380e-11438.30protein kinase C, epsilon b [Source:ZFIN;Acc:ZDB-G... [more]
prkcba5.691e-10847.98protein kinase C beta [Source:NCBI gene;Acc:103036... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008480.11.806e-8942.28pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1... [more]
ENSPMAT00000006766.12.062e-8739.67pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 g... [more]
PRKCD7.082e-8345.34protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
PRKCD1.772e-8045.52protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
sgk13.775e-5534.30serum/glucocorticoid regulated kinase 1 [Source:NC... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PKC11.706e-7940.23Protein serine/threonine kinase; essential for cel... [more]
YPK11.038e-7839.18S/T protein kinase; phosphorylates, downregulates ... [more]
YPK26.693e-7738.58Protein kinase similar to S/T protein kinase Ypk1p... [more]
SCH99.501e-7137.57AGC family protein kinase; functional ortholog of ... [more]
TPK33.033e-6336.33cAMP-dependent protein kinase catalytic subunit; p... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO449383.595e-16966.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355855.501e-11839.56Protein kinase C [Source:UniProtKB/TrEMBL;Acc:A7S... [more]
EDO378009.007e-9343.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411663.168e-8039.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391632.933e-7337.29Ribosomal protein S6 kinase [Source:UniProtKB/TrE... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkcz0.000e+052.56protein kinase C zeta [Source:NCBI gene;Acc:101164... [more]
prkcz0.000e+053.37protein kinase C zeta [Source:NCBI gene;Acc:101164... [more]
prkci6.489e-17265.35protein kinase C iota [Source:NCBI gene;Acc:101165... [more]
prkceb1.940e-11237.95protein kinase C epsilon type [Source:NCBI gene;Ac... [more]
prkcha3.835e-11238.40protein kinase C eta [Source:NCBI gene;Acc:1011589... [more]
back to top
BLAST of Protein kinase C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037135.10.000e+099.68SMESG000037135.1[more]
SMESG000037135.10.000e+099.67SMESG000037135.1[more]
SMESG000037135.10.000e+083.76SMESG000037135.1[more]
SMESG000037135.10.000e+083.85SMESG000037135.1[more]
SMESG000042308.14.365e-10937.40SMESG000042308.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008057 ID=SMED30008057|Name=Protein kinase C|organism=Schmidtea mediterranea sexual|type=transcript|length=2112bp
TCTATATAAATCTTATATGAATGAAAATGCATGAATCTGCTTTAATCAAA
TTAAAAATAATTTATATGTCAGAAGCCACTATAACTCAGATTAATGCTAG
TGTTACTTATGATCAATTAAGATACGAAATTCATCAAATTTGTGATTTAC
CTGATGTAAGCAATTTTACTATGAAGTGGATCGATGATGAGGGTGATCCG
TGTACTATTACTACTCAAATGGAACTTGATGAAGCTATACGATTATATGA
AACTAATAAAGATGCTGAGATTATGATGCATGTGTTCCCAAGCCTGCCTA
CAAGTCCCGGAATGCCGTGCCAAGGAGAAGACCTAAAAGTTTATCGAAGA
GGAGCAAAGCGATGGAAGAAATTCTATCATTTATATGGACATAAATTTTC
TGCTAAGCGTTTCAACAAGTACGCCGAATGCTTCTACTGCAAGGATCGAA
TCTGGGGTTTGGGCCAGCAGGGACTGCGCTGTGGTACTTGCCGCCTGTTG
CTCCACAAGCGATGCCAACAACTCGTCAAGCACAAGTGCGGTGAGGATTT
CAATTTGCCCAATTACCAGAGCCAGATTAAGTCAAACATGGCAATCCAGC
GCACCGCGGAGAACGGAGGCATCGAGAATCCCGGATATTATGTCGAGTCG
AATATTGATTATCCGGTTGACGGATTTGAGGAGCTCGGCCAGGTGAAGGA
CATAAAGCACGATTTGCGTGCCTCGGATCATCGGGTTGCTGTTGCCGTCC
GTGCCAATACCGCCTCTGGCAACGCCAGTAGCAACGGCAGCGGTGGATTA
TCATTATTGTCCAGTCCGCCCGTTGACACCGAAGGAGGAACCGGGGACCG
CAAAGGCAAGATTGGGCTGGGCGATTTCAATCTGCTATGCGTGGTGGGAC
GGGGCAGCTATGCCAAGGTGTTCCAGGTCGAGTACAAGCCAACCAAGAAG
ATCTATGCGATGAAGGTCATCAAGAAGGAGTTTATCACAGATAGCGACGA
CATCGAGTGGGTGCAAACGGAGAAACATGTATTTGAATGCGCCAGCAATC
ATCCCTTTCTCGTCGGTCTCCATTCGTGCTTCCAAACGCCGAGCAGATTG
ATTTATGTTATTGAATTCGTCAACGGAGGCGACCTCATGTACCACATGCA
ACGGAAACTCAGAATGCCGGAGGAGCACGCCAAATTCTATGCTGCAGAAA
TCGCGTTGGCGCTGAATTTCCTGCACAGGAGAGCAATCATTTATCGGGAC
TTGAAATTGGACAACGTGCTGATGGACAATGATGGCCACCTGAAATTGAC
CGATTACGGAATGTGCAAGGAGGGAATAGAGGGCGACATCAAGGCTACAA
CGTTCTGCGGAACTCCCAATTATATCGCTCCGGAAATATTGCGCAATGAG
GCTTATGGAGCAAGTGTCGATTGGTGGTCTCTCGGTGTATTGATGTTTGA
AATGTTGGCCGGATGTTCTCCCTGGATGCAACCGGGTCAAGGGATCCCAC
CCGAGGAGAATACGGAGGATTATTTGTTCAATTTGATCCTAACGAAACCG
ATCAGAATACCCAGAAGCATTTCCCCGAAAGCCAGCAGCATTTTGAAAGG
ACTGCTGAACAAGGATCCTACTCAACGGCTCGCGTGCAAGCCCAGCTCCA
ATTTCGATGATTTCCAGAATCACGCATTTTTCCGCGGATTGAATTGGGAC
GATTTAGTTGACAAGAAAATCCAGCCTCCTTTCCGACCGGAATTGACTCA
CGATCGCGATTTGACTAATTTTGATCCGTTATTTACAGATGAGCCGGTGA
TGTTTACTCCGGATGACAAGAGCAAAATCAGTAAGATTGACCAATCGGAA
TTCGAAGGATTCGAGTACATAAATCCGTTGCTATTGACAACCGAGGAAGC
GGTGTAAAACCCCGCTGACCAATGGCATTCGCGCGCGCTCCTCGTCCGGC
CCGCACACACACACAATTAATCCATATCGTGATCACTGGTCTATTTCATT
ATTGATTTTATTTATATTATCTTGTGATGGACAATTTTTTATTATTCGTA
GCTTCCTTGTTCTTTTGATTTTTACTCTAATATTTTATTCGGTATTTGTC
TTTTAAAAAAAA
back to top

protein sequence of SMED30008057-orf-1

>SMED30008057-orf-1 ID=SMED30008057-orf-1|Name=SMED30008057-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=629bp
MKMHESALIKLKIIYMSEATITQINASVTYDQLRYEIHQICDLPDVSNFT
MKWIDDEGDPCTITTQMELDEAIRLYETNKDAEIMMHVFPSLPTSPGMPC
QGEDLKVYRRGAKRWKKFYHLYGHKFSAKRFNKYAECFYCKDRIWGLGQQ
GLRCGTCRLLLHKRCQQLVKHKCGEDFNLPNYQSQIKSNMAIQRTAENGG
IENPGYYVESNIDYPVDGFEELGQVKDIKHDLRASDHRVAVAVRANTASG
NASSNGSGGLSLLSSPPVDTEGGTGDRKGKIGLGDFNLLCVVGRGSYAKV
FQVEYKPTKKIYAMKVIKKEFITDSDDIEWVQTEKHVFECASNHPFLVGL
HSCFQTPSRLIYVIEFVNGGDLMYHMQRKLRMPEEHAKFYAAEIALALNF
LHRRAIIYRDLKLDNVLMDNDGHLKLTDYGMCKEGIEGDIKATTFCGTPN
YIAPEILRNEAYGASVDWWSLGVLMFEMLAGCSPWMQPGQGIPPEENTED
YLFNLILTKPIRIPRSISPKASSILKGLLNKDPTQRLACKPSSNFDDFQN
HAFFRGLNWDDLVDKKIQPPFRPELTHDRDLTNFDPLFTDEPVMFTPDDK
SKISKIDQSEFEGFEYINPLLLTTEEAV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004698calcium-dependent protein kinase C activity
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0005515protein binding
GO:0004674protein serine/threonine kinase activity
GO:0000166nucleotide binding
GO:0004697protein kinase C activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR012233PKC
IPR020454DAG/PE-bd
IPR000719Prot_kinase_dom
IPR002219PE/DAG-bd
IPR000270PB1_dom
IPR000961AGC-kinase_C
IPR017892Pkinase_C
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0035556intracellular signal transduction
GO:0016310phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020454Diacylglycerol/phorbol-ester bindingPRINTSPR00008DAGPEDOMAINcoord: 137..146
score: 47.23
coord: 150..161
score: 40.26
coord: 121..135
score: 32.15
coord: 162..174
score: 42.96
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 286..554
e-value: 6.3E-89
score: 311.4
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 291..540
e-value: 2.1E-64
score: 217.4
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 286..554
score: 45.502
IPR000961AGC-kinase, C-terminalSMARTSM00133pkinase_C_6coord: 555..618
e-value: 4.0E-18
score: 76.2
IPR000961AGC-kinase, C-terminalPROSITEPS51285AGC_KINASE_CTERcoord: 555..626
score: 18.327
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainSMARTSM00109c1_12coord: 124..173
e-value: 3.2E-6
score: 36.7
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPFAMPF00130C1_1coord: 124..175
e-value: 2.2E-12
score: 46.7
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPROSITEPS00479ZF_DAG_PE_1coord: 124..173
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPROSITEPS50081ZF_DAG_PE_2coord: 123..173
score: 14.111
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainCDDcd00029C1coord: 124..173
e-value: 1.4155E-10
score: 54.8056
IPR000270PB1 domainSMARTSM00666PB1_newcoord: 8..91
e-value: 4.4E-16
score: 69.4
IPR000270PB1 domainPFAMPF00564PB1coord: 9..90
e-value: 2.5E-13
score: 49.8
IPR000270PB1 domainPROSITEPS51745PB1coord: 8..91
score: 22.627
IPR012233Protein kinase CPIRSFPIRSF000554PKC_zetacoord: 1..234
e-value: 4.3E-72
score: 240.8
coord: 235..628
e-value: 5.3E-181
score: 600.5
NoneNo IPR availableGENE3DG3DSA:3.30.60.20coord: 108..175
e-value: 3.2E-18
score: 67.2
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 284..612
e-value: 4.2E-128
score: 428.8
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 370..585
e-value: 4.2E-128
score: 428.8
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 6..94
e-value: 1.1E-31
score: 110.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 252..276
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 252..268
NoneNo IPR availablePANTHERPTHR24356:SF303ATYPICAL PROTEIN KINASE Ccoord: 14..625
NoneNo IPR availablePANTHERPTHR24356SERINE/THREONINE-PROTEIN KINASEcoord: 14..625
NoneNo IPR availableSUPERFAMILYSSF54277CAD & PB1 domainscoord: 7..90
NoneNo IPR availableSUPERFAMILYSSF57889Cysteine-rich domaincoord: 104..175
IPR017892Protein kinase, C-terminalPFAMPF00433Pkinase_Ccoord: 575..616
e-value: 2.0E-7
score: 31.6
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 292..319
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 406..418
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 283..610